| Clone Name | FLbaf50k18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | A4RMV8:ROK1_MAGGR ATP-dependent RNA helicase ROK1 - Magnaporthe ... | 36 | 0.33 | 2 | P31902:HYPB_RALEH Hydrogenase nickel incorporation protein hypB ... | 33 | 2.2 |
|---|
>A4RMV8:ROK1_MAGGR ATP-dependent RNA helicase ROK1 - Magnaporthe grisea (Rice blast| fungus) (Pyricularia grisea) Length = 775 Score = 36.2 bits (82), Expect = 0.33 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 3/77 (3%) Frame = -1 Query: 1130 GSSTNQILI*TTRKAVTDRSKLQPIFIDSCFLFFNQSR---SILPKRTAIEPQKEEEETT 960 GS T + +K + K +PI +D C R ++LP + A P K E+ + Sbjct: 95 GSKTKAADVKKAKKDADEADKARPIELDECKRILRSHRLKYTLLPVQKAA-PAKVEKSSA 153 Query: 959 SGKRKKEKTDEIQEAIQ 909 K+KK+K D++ A Q Sbjct: 154 KKKKKKDKGDKVDGAAQ 170
>P31902:HYPB_RALEH Hydrogenase nickel incorporation protein hypB - Ralstonia eutropha| (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)) Length = 361 Score = 33.5 bits (75), Expect = 2.2 Identities = 17/62 (27%), Positives = 25/62 (40%) Frame = -2 Query: 718 GRAVDPEVVVAGDPRAHLPPHPAVDAHVHQHVPGRLVLRERDGELRREHDAVHGSEVGRP 539 G+ + ++ + LP H A AH H+H R+ DG+ HD H Sbjct: 159 GKGCHLDALMVANAYERLPLHAAAHAHTHEH-------RQEDGQHSHHHDHEHARHDHHD 211 Query: 538 HR 533 HR Sbjct: 212 HR 213 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 170,860,525 Number of extensions: 3072896 Number of successful extensions: 9126 Number of sequences better than 10.0: 2 Number of HSP's gapped: 9079 Number of HSP's successfully gapped: 2 Length of query: 462 Length of database: 100,686,439 Length adjustment: 117 Effective length of query: 345 Effective length of database: 68,593,924 Effective search space: 23664903780 Effective search space used: 23664903780 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)