| Clone Name | FLbaf53a13 |
|---|---|
| Clone Library Name | barley_pub |
>Q39214:RPM1_ARATH Disease resistance protein RPM1 - Arabidopsis thaliana (Mouse-ear| cress) Length = 926 Score = 33.5 bits (75), Expect(2) = 0.072 Identities = 20/47 (42%), Positives = 28/47 (59%), Gaps = 8/47 (17%) Frame = -2 Query: 578 LKIV-----LSFYDLP---SHYLLHVSIYPEDYKIKRDQFI*RWMAE 462 LKIV LSF DLP L+ S++P +Y++KR + I WMA+ Sbjct: 413 LKIVRSIMFLSFNDLPYPLKRCFLYCSLFPVNYRMKRKRLIRMWMAQ 459 Score = 23.9 bits (50), Expect(2) = 0.072 Identities = 11/35 (31%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -1 Query: 414 SYFNELINRSMIQPVDIT-IKAEKSYDVHDMMLDL 313 SY NEL+ R+M+Q + K++ +HD++ ++ Sbjct: 476 SYLNELVYRNMLQVILWNPFGRPKAFKMHDVIWEI 510
>Q8W3K0:DRL9_ARATH Probable disease resistance protein At1g58602 - Arabidopsis| thaliana (Mouse-ear cress) Length = 1138 Score = 34.7 bits (78), Expect = 1.00 Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 3/40 (7%) Frame = -2 Query: 566 LSFYDLPS---HYLLHVSIYPEDYKIKRDQFI*RWMAEDL 456 LSF +LPS H L+++ +PEDY+IK + W AE++ Sbjct: 419 LSFEELPSYLKHCFLYLAHFPEDYEIKVENLSYYWAAEEI 458
>Q9SI85:DRL14_ARATH Probable disease resistance protein At1g62630 - Arabidopsis| thaliana (Mouse-ear cress) Length = 893 Score = 32.0 bits (71), Expect(2) = 1.2 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = -2 Query: 536 LLHVSIYPEDYKIKRDQFI*RWMAEDL 456 LL+ ++YPED KI+++ I W+ E++ Sbjct: 408 LLYCALYPEDAKIRKEDLIEHWICEEI 434 Score = 21.2 bits (43), Expect(2) = 1.2 Identities = 6/25 (24%), Positives = 15/25 (60%) Frame = -1 Query: 366 ITIKAEKSYDVHDMMLDLIYWLRRE 292 + +K + S +HD++ ++ W+ E Sbjct: 465 VDLKGKSSVIMHDVVREMALWIASE 489
>Q9STE7:R13L3_ARATH Putative disease resistance RPP13-like protein 3 - Arabidopsis| thaliana (Mouse-ear cress) Length = 847 Score = 26.2 bits (56), Expect(2) = 1.9 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -2 Query: 533 LHVSIYPEDYKIKRDQFI*RWMAE 462 L+ S++PEDY+IK ++ I +AE Sbjct: 422 LYFSVFPEDYEIKVEKLIHLLVAE 445 Score = 26.2 bits (56), Expect(2) = 1.9 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -1 Query: 411 YFNELINRSMIQPVDITIKAEKSYDVHDMMLDLIYWLRRETPMA-MFNLQEH 259 Y +EL++RS+++ I S +HD++ DL +E ++N ++H Sbjct: 463 YIDELVDRSLVKAERIERGKVMSCRIHDLLRDLAIKKAKELNFVNVYNEKQH 514
>Q9FJB5:RP8L3_ARATH Disease resistance RPP8-like protein 3 - Arabidopsis thaliana| (Mouse-ear cress) Length = 901 Score = 33.5 bits (75), Expect = 2.2 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = -2 Query: 566 LSFYDLPS---HYLLHVSIYPEDYKIKRDQFI*RWMAEDL 456 LS+ DLP+ H L+++ +PEDYKIK W AE + Sbjct: 408 LSYEDLPTDLKHCFLYLAHFPEDYKIKTRTLYSYWAAEGI 447
>Q8W3J8:DRL10_ARATH Probable disease resistance protein RDL5/RF45 - Arabidopsis| thaliana (Mouse-ear cress) Length = 855 Score = 33.5 bits (75), Expect = 2.2 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 3/40 (7%) Frame = -2 Query: 566 LSFYDLPS---HYLLHVSIYPEDYKIKRDQFI*RWMAEDL 456 LSF +LPS H L+++ +PEDY+IK + W AE + Sbjct: 415 LSFEELPSYLKHCFLYLAHFPEDYEIKVENLSYYWAAEGI 454
>P59584:RP8HA_ARATH Disease resistance protein RPH8A - Arabidopsis thaliana (Mouse-ear| cress) Length = 910 Score = 33.1 bits (74), Expect = 2.9 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = -2 Query: 566 LSFYDLPSHY---LLHVSIYPEDYKIKRDQFI*RWMAEDL 456 LS+ DLP+H LH++ YPED KI W AE + Sbjct: 414 LSYEDLPTHLKHCFLHLAHYPEDSKIYTQDLFNYWAAEGI 453
>Q38834:R13L4_ARATH Disease resistance RPP13-like protein 4 - Arabidopsis thaliana| (Mouse-ear cress) Length = 852 Score = 33.1 bits (74), Expect = 2.9 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = -2 Query: 566 LSFYDLPSHY---LLHVSIYPEDYKIKRDQFI*RWMAE 462 LS+ +LPSH +L +S+YPED I + Q + W+ E Sbjct: 406 LSYDELPSHLKSCILTLSLYPEDCVIPKQQLVHGWIGE 443
>Q9LMP6:DRL3_ARATH Probable disease resistance protein At1g15890 - Arabidopsis| thaliana (Mouse-ear cress) Length = 921 Score = 31.6 bits (70), Expect = 8.4 Identities = 10/24 (41%), Positives = 19/24 (79%) Frame = -2 Query: 533 LHVSIYPEDYKIKRDQFI*RWMAE 462 L+ S++PEDY++++++ I WM E Sbjct: 480 LYCSLFPEDYEVRKEELIEYWMCE 503 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 215,334,426 Number of extensions: 4201149 Number of successful extensions: 8881 Number of sequences better than 10.0: 9 Number of HSP's gapped: 8881 Number of HSP's successfully gapped: 12 Length of query: 471 Length of database: 100,686,439 Length adjustment: 117 Effective length of query: 354 Effective length of database: 68,593,924 Effective search space: 24282249096 Effective search space used: 24282249096 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)