| Clone Name | FLbaf55c01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | O94953:JHD3B_HUMAN JmjC domain-containing histone demethylation ... | 31 | 4.5 | 2 | Q9Y2P4:S27A6_HUMAN Long-chain fatty acid transport protein 6 - H... | 30 | 7.7 |
|---|
>O94953:JHD3B_HUMAN JmjC domain-containing histone demethylation protein 3B - Homo| sapiens (Human) Length = 1096 Score = 30.8 bits (68), Expect = 4.5 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = -3 Query: 190 PGLPRSPAAAPSGPQLGMK--LQPLKHG*GSRSRAGSPLPGAVQAISPSVSSE 38 P LP PA PS L + L+P G G + SPLP + + P V SE Sbjct: 464 PQLPPPPAHFPSEEALWLPSPLEPPVLGPGPAAMEESPLPAPLNVVPPEVPSE 516
>Q9Y2P4:S27A6_HUMAN Long-chain fatty acid transport protein 6 - Homo sapiens (Human)| Length = 619 Score = 30.0 bits (66), Expect = 7.7 Identities = 21/55 (38%), Positives = 28/55 (50%) Frame = +1 Query: 7 PSWVGTLEEMLQMRQMERLPALHLAVVTLLGFCCLIHASRAATSFPTAALRAQLQ 171 P V +L+E L E +P H VV+LL CL + T P AA+ +QLQ Sbjct: 187 PQGVISLKEKLSTSPDEPVPRSH-HVVSLLKSTCLYIFTSGTTGLPKAAVISQLQ 240 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 100,333,469 Number of extensions: 1980117 Number of successful extensions: 4925 Number of sequences better than 10.0: 2 Number of HSP's gapped: 4921 Number of HSP's successfully gapped: 2 Length of query: 217 Length of database: 100,686,439 Length adjustment: 109 Effective length of query: 108 Effective length of database: 70,788,284 Effective search space: 7645134672 Effective search space used: 7645134672 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)