| Clone Name | FLbaf52g02 |
|---|---|
| Clone Library Name | barley_pub |
>Q8JHZ8:PALD_CHICK Paladin - Gallus gallus (Chicken)| Length = 868 Score = 34.3 bits (77), Expect = 0.26 Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = +3 Query: 174 GSRRTPPPPHPSLQ--KKQFRLPRSWMERFPRTSQRIIEIDHLVA 302 G+ P PPHP+ + +FR+ +S++E P+ Q + E+D ++A Sbjct: 333 GAAPKPDPPHPAKMPPRARFRVIQSFIEMVPKGQQMVEEVDSVIA 377
>P18251:BLA1_ENTCL Beta-lactamase Ohio-1 precursor - Enterobacter cloacae| Length = 286 Score = 31.2 bits (69), Expect = 2.2 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 6/46 (13%) Frame = -3 Query: 139 GAGLP--DVGSEEKQRPAHHRRR----HDEVGERHLRLSLSPGPVC 20 GAGL D G E+ +R H+RR+ + V E+HL ++ G +C Sbjct: 74 GAGLARVDAGDEQLERKIHYRRQDLVDYSPVSEKHLADGMTVGELC 119
>Q03149:WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase - Emericella| nidulans (Aspergillus nidulans) Length = 2157 Score = 30.8 bits (68), Expect = 2.9 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = -1 Query: 276 SFGLSLGISPSSFLGGGTASFADLDAAEAVSSS 178 SF SLGI+PS LG FA ++AA +S+S Sbjct: 985 SFWASLGITPSFVLGHSLGDFAAMNAAGVLSTS 1017
>Q9QWV9:CCNT1_MOUSE Cyclin-T1 - Mus musculus (Mouse)| Length = 724 Score = 30.0 bits (66), Expect = 4.9 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 112 EEKQR--PAHHRRRHDEVGERHLRLSLSPGPVCR 17 +EKQR P++H H+ RH L L GPV + Sbjct: 506 KEKQRTHPSNHHHHHNHHSHRHSHLQLPAGPVSK 539
>P37991:COAT_CVB Coat protein - Chrysanthemum virus B (CVB)| Length = 315 Score = 29.3 bits (64), Expect = 8.4 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +3 Query: 174 GSRRTPPPPHPSLQKKQFRLPRSWMERFPRTSQRIIE 284 GS TPPPP P+ ++ RL + MER R ++++E Sbjct: 16 GSTPTPPPPPPARTAEEARLRLAEMER-EREQEQLLE 51
>Q8BL07:GP150_MOUSE Probable G-protein coupled receptor 150 - Mus musculus (Mouse)| Length = 427 Score = 25.0 bits (53), Expect(2) = 9.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -2 Query: 308 ISCDQMVYFNDPLACPWESLHPASWEAELLL 216 + CD + YF LA W S WE E L+ Sbjct: 298 VGCD-LPYFAARLAAAWSSKPAGDWERESLV 327 Score = 22.7 bits (47), Expect(2) = 9.0 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -1 Query: 171 CRIWRALRRK 142 CR+WR LRR+ Sbjct: 353 CRLWRRLRRR 362 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 83,754,220 Number of extensions: 1567466 Number of successful extensions: 4472 Number of sequences better than 10.0: 6 Number of HSP's gapped: 4466 Number of HSP's successfully gapped: 7 Length of query: 174 Length of database: 100,686,439 Length adjustment: 106 Effective length of query: 68 Effective length of database: 71,611,169 Effective search space: 4869559492 Effective search space used: 4869559492 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)