ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf58c21 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os02g56014:12002.t005526:unspliced-genomic 40S ribosomal protein S30, putative, expressed| Length = 648 Score = 144 bits (310), Expect(2) = 3e-35 Identities = 60/62 (96%), Positives = 62/62 (100%) Frame = +3 / +1 Query: 90 GKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNSSE 269 GKVHGSLARAGKVRGQTPKVAKQDKKK+PRGRAHKR+QYNRRFVTAVVGFGKKRGPNSSE Sbjct: 199 GKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSE 378 Query: 270 K* 275 K* Sbjct: 379 K* 384 Score = 23.1 bits (44), Expect(2) = 3e-35 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 / +2 Query: 64 AAPPPQQPWV 93 A PPP PWV Sbjct: 62 APPPPPPPWV 91 Score = 129 bits (277), Expect = 9e-30 Identities = 52/62 (83%), Positives = 55/62 (88%) Frame = -2 / -2 Query: 274 YFSDELGPRFLPKPTTAVTKRRLYWMRLWARPRGCFFLSCFATLGVWPRTFPARASDPCT 95 YFS+E GPRFLPKPTTAVTKRRLY +RLWARPRG FFLSCFAT GV P TFPARAS+P T Sbjct: 383 YFSEEFGPRFLPKPTTAVTKRRLYCIRLWARPRGFFFLSCFATFGVCPLTFPARASEP*T 204 Query: 94 LP 89 LP Sbjct: 203 LP 198 Score = 31.8 bits (63), Expect(2) = 0.020 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +2 / +3 Query: 182 PRPQAHPVQPPXXXXXXXXXQEAWPQLVGEV 274 PRPQA VQPP QEA +L+ EV Sbjct: 291 PRPQADAVQPPFRHRRRRLRQEARAKLLREV 383 Score = 24.9 bits (48), Expect(2) = 0.020 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 / +2 Query: 76 PQQPWVRCTDRWRVPGRCG 132 P + VR T RW PGR G Sbjct: 185 PPRSQVRFTARWLAPGR*G 241
>LOC_Os06g07580:12006.t00641:unspliced-genomic expressed protein| Length = 653 Score = 144 bits (310), Expect = 3e-34 Identities = 60/62 (96%), Positives = 62/62 (100%) Frame = +3 / +1 Query: 90 GKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRGPNSSE 269 GKVHGSLARAGKVRGQTPKVAKQDKKK+PRGRAHKR+QYNRRFVTAVVGFGKKRGPNSSE Sbjct: 178 GKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSE 357 Query: 270 K* 275 K* Sbjct: 358 K* 363 Score = 144 bits (310), Expect = 3e-34 Identities = 56/62 (90%), Positives = 58/62 (93%) Frame = -2 / -1 Query: 274 YFSDELGPRFLPKPTTAVTKRRLYWMRLWARPRGCFFLSCFATLGVWPRTFPARASDPCT 95 YFS+ELGPRFLP PTTAVTKRRLY + LWARPRG FFLSCFATLGVWPRTFPARASDPCT Sbjct: 362 YFSEELGPRFLPNPTTAVTKRRLYCILLWARPRGFFFLSCFATLGVWPRTFPARASDPCT 183 Query: 94 LP 89 LP Sbjct: 182 LP 177 Score = 34.5 bits (69), Expect(2) = 5e-05 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +2 / +3 Query: 179 RPRPQAHPVQPPXXXXXXXXXQEAWPQLVGEVVDP 283 RPRPQ VQPP QEA QL+ EV P Sbjct: 267 RPRPQEDAVQPPLRHRRRRIRQEARAQLLREVDAP 371 Score = 31.3 bits (62), Expect(2) = 5e-05 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +1 / +2 Query: 82 QPWVRCTDRWRVPGRC 129 +P VRCTDR PGRC Sbjct: 170 RPQVRCTDRSLAPGRC 217
>LOC_Os04g47150:12004.t04242:unspliced-genomic subtilisin-like protease precursor, putative, expressed| Length = 2896 Score = 29.5 bits (58), Expect(3) = 0.002 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -3 / +3 Query: 342 PKATGEQANKQKRRGSARPAGSTTSPTSW 256 P+ TG A ++RR S+RP + SW Sbjct: 426 PRTTGSSAPTRRRRTSSRPPTRRSCSASW 512 Score = 26.3 bits (51), Expect(3) = 0.002 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -2 / +3 Query: 232 TTAVTKRRLYWMRLWARPRGCFFLSCFATLGVWPRTFPAR 113 TT+ ++R R +GC SC +T G RT PAR Sbjct: 684 TTSSSERAPTSSRRSGSGKGCATRSCRSTRGSTGRTRPAR 803 Score = 25.8 bits (50), Expect(3) = 0.002 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -3 / +3 Query: 114 APAIRAPYPWLLRR 73 APA RAP PW L R Sbjct: 2409 APAARAPPPWGLHR 2450
>LOC_Os05g03450:12005.t00242:unspliced-genomic carbohydrate binding protein, putative, expressed| Length = 2524 Score = 29.9 bits (59), Expect(2) = 0.034 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 / -1 Query: 61 AAAPPPQQPWVRCTDRWR 114 A PPP PW R + WR Sbjct: 1177 ACRPPPPAPWCRASSPWR 1124 Score = 25.8 bits (50), Expect(2) = 0.034 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 / -1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AA+ARAP L R+ PPP Sbjct: 1219 AASARAPPPTLGCRACRPPPP 1157
>LOC_Os01g20030:12001.t01791:unspliced-genomic expressed protein| Length = 738 Score = 36.8 bits (74), Expect = 0.091 Identities = 17/31 (54%), Positives = 19/31 (61%) Frame = +1 / +2 Query: 22 AARAPSVHLADRSAAAPPPQQPWVRCTDRWR 114 AAR S A SA APPP++P R T RWR Sbjct: 362 AARRTSSSAARWSACAPPPRRPSGRWTGRWR 454
>LOC_Os07g39310:12007.t03592:unspliced-genomic zinc finger, C2H2 type family protein, expressed| Length = 3369 Score = 29.0 bits (57), Expect(2) = 0.11 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 / -3 Query: 13 DAAAARAPSVHLADRSAAAPPPQQPW 90 DA A + + +R+AAAPPP W Sbjct: 1234 DAPAVSEAAAAVMERTAAAPPPPPGW 1157 Score = 24.9 bits (48), Expect(2) = 0.11 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 / -3 Query: 179 RPRPQAHPVQPP 214 RPRPQ +P PP Sbjct: 1144 RPRPQVNPHSPP 1109
>LOC_Os01g48430:12001.t04287:unspliced-genomic hypothetical protein| Length = 1116 Score = 29.5 bits (58), Expect(2) = 0.16 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 / +1 Query: 10 PDAAAARAPSVHLADRSAAAPPPQQPWVR 96 P AAAA A D++AAAP + W+R Sbjct: 223 PLAAAAAARRKEADDQAAAAPSAEPAWIR 309 Score = 24.0 bits (46), Expect(2) = 0.16 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 / +3 Query: 179 RPRPQAHPVQPP 214 RPRP PV PP Sbjct: 387 RPRPAPEPVPPP 422
>LOC_Os08g12990:12008.t01177:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 10657 Score = 31.3 bits (62), Expect(2) = 0.28 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -3 / +2 Query: 330 GEQANKQKRRGSARPAGSTTSPTS 259 G + ++++ RGS RPAG T PTS Sbjct: 626 GPRGSRRRWRGSWRPAGGPTCPTS 697 Score = 26.3 bits (51), Expect(2) = 0.28 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 / +3 Query: 262 ELGPRFLPKPTTAVTKRRLYWMR 194 E PR++PK A KRRL +R Sbjct: 6336 EPNPRWMPKDLMATQKRRLQRLR 6404
>LOC_Os04g57130:12004.t05179:unspliced-genomic dirigent-like protein pDIR17, putative, expressed| Length = 1075 Score = 35.0 bits (70), Expect = 0.32 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +1 / -2 Query: 7 QPDAAAARAPSVHLADRSAAAPPPQQPWVRCTDRWR 114 +P A RAP RSAA P P P RC R R Sbjct: 600 RPSRPATRAPRGRAPSRSAATPGPAPPAARCPTRSR 493
>LOC_Os04g32240:12004.t02903:unspliced-genomic expressed protein| Length = 1533 Score = 35.0 bits (70), Expect = 0.32 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +1 / -1 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPWVRCTDR 108 L P A A APS L R+ AAPPP P R R Sbjct: 1278 LLPPAVAPAAPSRRLGRRTPAAPPPTAPQGRALPR 1174
>LOC_Os12g37230:12012.t03403:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 462 Score = 27.2 bits (53), Expect(2) = 0.39 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A A PPP Sbjct: 22 AAAATAPQRHAAAAVATPPPP 84 Score = 24.4 bits (47), Expect(2) = 0.39 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 78 AAAATPPRQPPPRC 119
>LOC_Os09g13490:12009.t01139:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 462 Score = 27.2 bits (53), Expect(2) = 0.39 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A A PPP Sbjct: 22 AAAATAPQRHAAAAVATPPPP 84 Score = 24.4 bits (47), Expect(2) = 0.39 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 78 AAAATPPRQPPPRC 119
>LOC_Os02g28640:12002.t02558:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 462 Score = 27.2 bits (53), Expect(2) = 0.39 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A A PPP Sbjct: 22 AAAATAPQRHAAAAVATPPPP 84 Score = 24.4 bits (47), Expect(2) = 0.39 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 78 AAAATPPRQPPPRC 119
>LOC_Os01g55030:12001.t04916:unspliced-genomic expressed protein| Length = 1897 Score = 34.5 bits (69), Expect = 0.44 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 / -1 Query: 58 SAAAPPPQQPWVRCTDRWRV 117 S++ PPP PWVR + WRV Sbjct: 205 SSSPPPPPPPWVRKKEHWRV 146
>LOC_Os08g29180:12008.t02673:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 12963 Score = 27.2 bits (53), Expect(2) = 0.45 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 / +3 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A A PPP Sbjct: 7818 AAAATAPQRHAAAAVATPPPP 7880 Score = 24.4 bits (47), Expect(2) = 0.45 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +2 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 7874 AAAATPPRQPPSRC 7915
>LOC_Os11g12360:12011.t01123:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 12033 Score = 27.2 bits (53), Expect(2) = 0.45 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 / +2 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A A PPP Sbjct: 7274 AAAATAPQRHAAAAVATPPPP 7336 Score = 24.4 bits (47), Expect(2) = 0.45 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +1 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 7330 AAAATPPRQPPPRC 7371
>LOC_Os07g23440:12007.t02042:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 11382 Score = 27.2 bits (53), Expect(2) = 0.45 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 / +3 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A A PPP Sbjct: 6285 AAAATAPQRHAAAAVATPPPP 6347 Score = 24.4 bits (47), Expect(2) = 0.45 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +2 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 6341 AAAATPPRQPPPRC 6382
>LOC_Os08g11310:12008.t01013:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 7007 Score = 27.2 bits (53), Expect(2) = 0.47 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 / +3 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A A PPP Sbjct: 6639 AAAATAPQRHAAAAVATPPPP 6701 Score = 24.4 bits (47), Expect(2) = 0.47 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +2 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 6695 AAAATPPRQPPPRC 6736
>LOC_Os04g24240:12004.t02138:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5315 Score = 27.2 bits (53), Expect(2) = 0.48 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A A PPP Sbjct: 22 AAAATAPQRHAAAAVATPPPP 84 Score = 24.4 bits (47), Expect(2) = 0.48 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 78 AAAATPPRQPPPRC 119
>LOC_Os11g43430:12011.t03873:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5054 Score = 27.2 bits (53), Expect(2) = 0.48 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A A PPP Sbjct: 22 AAAATAPQRHAAAAVATPPPP 84 Score = 24.4 bits (47), Expect(2) = 0.48 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 78 AAAATPPRQPPPRC 119
>LOC_Os02g33990:12002.t03040:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4936 Score = 27.2 bits (53), Expect(2) = 0.48 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A A PPP Sbjct: 22 AAAATAPQRHAAAAVATPPPP 84 Score = 24.4 bits (47), Expect(2) = 0.48 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 78 AAAATPPRQPPPRC 119
>LOC_Os12g16790:12012.t01532:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4922 Score = 27.2 bits (53), Expect(2) = 0.48 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A A PPP Sbjct: 22 AAAATAPQRHAAAAVATPPPP 84 Score = 24.4 bits (47), Expect(2) = 0.48 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 78 AAAATPPRQPPPRC 119
>LOC_Os08g04870:12008.t00381:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4904 Score = 27.2 bits (53), Expect(2) = 0.48 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A A PPP Sbjct: 22 AAAATAPQRHAAAAVATPPPP 84 Score = 24.4 bits (47), Expect(2) = 0.48 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 78 AAAATPPRQPPPRC 119
>LOC_Os05g18570:12005.t01624:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4836 Score = 27.2 bits (53), Expect(2) = 0.48 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A A PPP Sbjct: 22 AAAATAPQRHAAAAVATPPPP 84 Score = 24.4 bits (47), Expect(2) = 0.48 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 171 AAAATPPRQPPPRC 212
>LOC_Os12g01870:12012.t00085:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4787 Score = 27.2 bits (53), Expect(2) = 0.48 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A A PPP Sbjct: 22 AAAAMAPQRHAAAAVATPPPP 84 Score = 24.4 bits (47), Expect(2) = 0.48 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 78 AAAATPPRQPPPRC 119
>LOC_Os12g11560:12012.t01030:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4633 Score = 27.2 bits (53), Expect(2) = 0.48 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A A PPP Sbjct: 22 AAAATAPQRHAAAAVATPPPP 84 Score = 24.4 bits (47), Expect(2) = 0.48 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 78 AAAATPPRQPPPRC 119
>LOC_Os09g26230:12009.t02302:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2336 Score = 27.2 bits (53), Expect(2) = 0.50 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A A PPP Sbjct: 22 AAAATAPQRHAAAAVATPPPP 84 Score = 24.4 bits (47), Expect(2) = 0.50 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 78 AAAATPPRQPPPRC 119
>LOC_Os05g16340:12005.t01404:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 1428 Score = 27.2 bits (53), Expect(2) = 0.52 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A A PPP Sbjct: 46 AAAATAPQRHAAAAVATLPPP 108 Score = 24.4 bits (47), Expect(2) = 0.52 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 102 AAAATPPRQPPPRC 143
>LOC_Os06g40910:12006.t03786:unspliced-genomic cytidine deaminase, putative| Length = 591 Score = 26.7 bits (52), Expect(2) = 0.55 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 / +2 Query: 16 AAAARAPSVHLADRSAAAPPPQQPWVRCTDRWRVP 120 AA++ S L ++ +PPP RC RVP Sbjct: 215 AASSSRRSAALVGSASLSPPPTPSGARCRPSSRVP 319 Score = 24.9 bits (48), Expect(2) = 0.55 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +3 / +3 Query: 123 KVRGQTPKVAKQDKKKQPRGRAH 191 + R P+ +Q ++QPR R H Sbjct: 342 QARPSRPQTTRQPSRRQPRYRCH 410
>LOC_Os10g27260:12010.t02132:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 15984 Score = 28.6 bits (56), Expect(2) = 0.59 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +1 / +2 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A +A PPP Sbjct: 8009 AAAATAPQRHAAAAAATPPPP 8071 Score = 22.6 bits (43), Expect(2) = 0.59 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 / +1 Query: 58 SAAAPPPQQPWVRC 99 +A A PP+QP RC Sbjct: 8065 AAVATPPRQPPPRC 8106
>LOC_Os07g37470:12007.t03416:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5504 Score = 27.2 bits (53), Expect(2) = 0.64 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A A PPP Sbjct: 46 AAAATAPQRHAAAAVATPPPP 108 Score = 24.0 bits (46), Expect(2) = 0.64 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 102 AAAATPPRQPPRRC 143
>LOC_Os12g06410:12012.t00526:unspliced-genomic ubiquitin-protein ligase, putative, expressed| Length = 1314 Score = 29.0 bits (57), Expect(2) = 0.70 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 / +3 Query: 10 PDAAAARAPSVHLADRSAAAPPPQQPWVR 96 PD AAA A S HL R PP P R Sbjct: 33 PDLAAADAGSRHLPHRHLLRPPRHPPLAR 119 Score = 22.1 bits (42), Expect(2) = 0.70 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 / +3 Query: 179 RPRPQAHPVQP 211 RP PQ HP P Sbjct: 168 RPHPQPHPPPP 200
>LOC_Os11g45890:12011.t04114:unspliced-genomic expressed protein| Length = 1772 Score = 33.6 bits (67), Expect = 0.84 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +1 / -2 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPWVRC 99 LQP A A A +H+ADR + PP RC Sbjct: 850 LQPPAPAVAARELHVADRDSTPPPVSMTPSRC 755
>LOC_Os11g39140:12011.t03457:unspliced-genomic thioredoxin domain-containing protein 9, putative, expressed| Length = 3633 Score = 33.6 bits (67), Expect = 0.84 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 / -2 Query: 16 AAAARAPSVHLADRSAAAPPPQQPWVRCTDRWR 114 AA + +PS A +A+A PP+ P +R RWR Sbjct: 116 AAPSSSPSATAASAAASARPPRSPPLRLRFRWR 18
>LOC_Os09g21630:12009.t01897:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4054 Score = 33.6 bits (67), Expect = 0.84 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +1 / -2 Query: 4 LQPDAAAARAPSVHLADRSAAAPP 75 L P AA A AP+ H A SAA PP Sbjct: 534 LPPPAAGAEAPTAHAAAESAAPPP 463
>LOC_Os12g22900:12012.t02027:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 486 Score = 25.8 bits (50), Expect(2) = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 / +1 Query: 19 AAARAPSVHLADRSAAAPPP 78 AAA AP H A A PPP Sbjct: 25 AAATAPQRHAATAVATPPPP 84 Score = 24.4 bits (47), Expect(2) = 1.0 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 78 AAAATPPRQPPPRC 119
>LOC_Os08g41160:12008.t03845:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 9717 Score = 25.8 bits (50), Expect(2) = 1.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 / +3 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A PPP Sbjct: 4698 AAAATAPQRHATTAVATPPPP 4760 Score = 24.4 bits (47), Expect(2) = 1.1 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +2 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 4754 AAAATPPRQPPPRC 4795
>LOC_Os11g06170:12011.t00509:unspliced-genomic transcription factor RF2b, putative, expressed| Length = 3563 Score = 33.1 bits (66), Expect = 1.2 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +1 / +1 Query: 10 PDAAAARAPSVHLADRSAAAPPPQQPWVRCTDRWRVPG 123 P AA A + A R PPPQ W R + R R PG Sbjct: 16 PSHFAAAAAAAAAASRRR*PPPPQPSWTRDSRRRRRPG 129
>LOC_Os10g02650:12010.t00155:unspliced-genomic conserved hypothetical protein| Length = 3664 Score = 33.1 bits (66), Expect = 1.2 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 / +2 Query: 61 AAAPPPQQPWVRCTDRWRVPGRC 129 A P PQ+PW RW P RC Sbjct: 278 APPPCPQRPWTFSCSRWATPRRC 346
>LOC_Os03g24610:12003.t02155:unspliced-genomic hydrolase, putative, expressed| Length = 3383 Score = 33.1 bits (66), Expect = 1.2 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 / -2 Query: 10 PDAAAARAPSVHLADRSAAAPPPQQPWVRCTDRWRVP 120 P A+A A +V + S A PP+ P C RW P Sbjct: 694 PAPASASASAVAAGNGSGAPTPPRTPTSTCRSRWSPP 584
>LOC_Os03g16334:12003.t01418:unspliced-genomic transferase, transferring glycosyl groups, putative, expressed| Length = 4996 Score = 33.1 bits (66), Expect = 1.2 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 / -1 Query: 351 GNGPKATGEQANKQKRRGSARPAGSTTSP 265 G P A A ++ RRG A P G+TT+P Sbjct: 604 GTSPPARAPPAARRARRGRASPRGATTAP 518
>LOC_Os01g68060:12001.t06163:unspliced-genomic copine-6, putative, expressed| Length = 4426 Score = 33.1 bits (66), Expect = 1.2 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 / -1 Query: 342 PKATGEQANKQKRRGSARPAGSTTSP 265 P A G A+ + RG +RPAGS+T P Sbjct: 421 PTAAGTTASGRTSRGRSRPAGSSTGP 344
>LOC_Os01g42140:12001.t03734:unspliced-genomic expressed protein| Length = 1343 Score = 33.1 bits (66), Expect = 1.2 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 / +2 Query: 28 RAPSVHLADRSAAAPPPQQPW 90 RAPS R+AA PPP +PW Sbjct: 722 RAPSATRPSRTAAPPPPWRPW 784
>LOC_Os05g46250:12005.t04113:unspliced-genomic expressed protein| Length = 3310 Score = 27.2 bits (53), Expect(2) = 1.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 / -3 Query: 28 RAPSVHLADRSAAAPPPQQP 87 RAP DR AAPPP P Sbjct: 275 RAPVPRRRDREPAAPPPPPP 216 Score = 23.1 bits (44), Expect(2) = 1.2 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 / -1 Query: 179 RPRPQAHPVQPP 214 RPRP+ P +PP Sbjct: 235 RPRPRRRPREPP 200
>LOC_Os02g10300:12002.t00878:unspliced-genomic exopolygalacturonase precursor, putative, expressed| Length = 2964 Score = 25.8 bits (50), Expect(2) = 1.2 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 / -3 Query: 70 PPPQQPWVRCTDRWRVP 120 PP W CT WR P Sbjct: 142 PPALPAWPACTALWRTP 92 Score = 24.4 bits (47), Expect(2) = 1.2 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +1 / -3 Query: 7 QPDAAAARAPSVHLADRSAAAPPPQQP 87 +P AAR P+ A + PPP P Sbjct: 274 RPSPPAARCPAAPPAPTAPPPPPPAWP 194
>LOC_Os10g07120:12010.t00574:unspliced-genomic hypothetical protein| Length = 321 Score = 26.3 bits (51), Expect(2) = 1.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 / -2 Query: 19 AAARAPSVHLADRSAAAPPPQQP 87 AA A HLA S A PPP P Sbjct: 248 AAGPAEPAHLARPSQAEPPPLPP 180 Score = 23.1 bits (44), Expect(2) = 1.2 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +1 / -2 Query: 67 APPPQQPWVRCTDRWRVP 120 APPP + RC R+ P Sbjct: 149 APPPPSRFQRCRSRFAPP 96
>LOC_Os03g10680:12003.t00869:unspliced-genomic actin binding protein, putative, expressed| Length = 4512 Score = 27.6 bits (54), Expect(2) = 1.4 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +1 / +3 Query: 16 AAAARAPSVHLADRSAAAPPPQQPWVRCTDRWRVP 120 AA R+ S AAPPP P + RW P Sbjct: 594 AATRRSCSAPTVPARIAAPPPPPPTSSTSARWSPP 698 Score = 26.3 bits (51), Expect(2) = 1.4 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 / +1 Query: 132 GQTPKVAKQDKKKQPRGRAHKR 197 G TP+ + D++ P GR H+R Sbjct: 982 GLTPQPPQHDQRLLPPGRCHRR 1047
>LOC_Os05g15540:12005.t01325:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5218 Score = 25.8 bits (50), Expect(2) = 1.6 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 / +3 Query: 55 RSAAAPPPQQPWVRC 99 R AAA PP+QP RC Sbjct: 66 RHAAATPPRQPPPRC 110 Score = 24.0 bits (46), Expect(2) = 1.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPP 75 AAAA AP H A A PP Sbjct: 22 AAAATAPQRHAAAAVATPPP 81
>LOC_Os01g27080:12001.t02412:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5023 Score = 25.8 bits (50), Expect(2) = 1.6 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 / +3 Query: 55 RSAAAPPPQQPWVRC 99 R AAA PP+QP RC Sbjct: 66 RHAAATPPRQPPPRC 110 Score = 24.0 bits (46), Expect(2) = 1.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPP 75 AAAA AP H A A PP Sbjct: 22 AAAATAPQRHAAAAVATPPP 81
>LOC_Os12g23240:12012.t02057:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4689 Score = 25.4 bits (49), Expect(2) = 1.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A PPP Sbjct: 22 AAAATAPQRHATAAVATLPPP 84 Score = 24.4 bits (47), Expect(2) = 1.6 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 78 AAAATPPRQPPPRC 119
>LOC_Os09g20140:12009.t01748:unspliced-genomic hypothetical protein| Length = 1124 Score = 32.7 bits (65), Expect = 1.6 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 / +2 Query: 10 PDAAAARAPSVHLADRSAAAPPPQQPWVRCTDRWR 114 P ARA S A R PPP+QP VR R R Sbjct: 620 PPQPNARASSASAAGRPTHVPPPRQPGVRVRARER 724
>LOC_Os08g04950:12008.t00389:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5876 Score = 32.7 bits (65), Expect = 1.6 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 / +2 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D A AP +HL PPP PW Sbjct: 698 LLDDGQATGAPRLHLPRHGVPLPPPSSPW 784
>LOC_Os08g04930:12008.t00387:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1343 Score = 32.7 bits (65), Expect = 1.6 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 / +2 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D A AP +HL PPP PW Sbjct: 698 LLDDGQATGAPRLHLPRHGVPLPPPSSPW 784
>LOC_Os07g36450:12007.t03315:unspliced-genomic expressed protein| Length = 2549 Score = 32.7 bits (65), Expect = 1.6 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 / +1 Query: 31 APSVHLADRSAAAPPPQQPWVRCTDRWRVPGRCG 132 APS A R + +PPP P R T R P RCG Sbjct: 145 APSSSSATRPSLSPPPPPPPRRPTASSRGPPRCG 246
>LOC_Os06g09230:12006.t00802:unspliced-genomic serine threonine kinase, putative, expressed| Length = 4511 Score = 32.7 bits (65), Expect = 1.6 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -3 / +1 Query: 342 PKATGEQANKQKRRGSARPAGSTTSPTS 259 PKAT + ++ RRG+ P+ +TT+P S Sbjct: 1948 PKATTTASRRRARRGAETPSAATTTPPS 2031
>LOC_Os05g40650:12005.t03604:unspliced-genomic ATCHX15, putative, expressed| Length = 3108 Score = 32.7 bits (65), Expect = 1.6 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = +1 / -1 Query: 22 AARAPSVHLADRSAAAPPPQQPWVRCTDRWRVPGRCG 132 A PS A SAA+ P + RCT R R P CG Sbjct: 2532 APATPSTRRAPTSAASSPRRGGGRRCTARARCPAGCG 2422
>LOC_Os04g59140:12004.t05372:unspliced-genomic expressed protein| Length = 1383 Score = 32.7 bits (65), Expect = 1.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 / +2 Query: 7 QPDAAAARAPSVHLADRSAAAPPPQQPWVRC 99 +P A+R P+ + A+PPP PW C Sbjct: 866 RPSGEASRCPARTTSPPPEASPPPSTPWAPC 958
>LOC_Os04g57890:12004.t05254:unspliced-genomic oligosaccharyl transferase STT3 subunit, putative, expressed| Length = 5157 Score = 32.7 bits (65), Expect = 1.6 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPPQQP 87 A++AR+PS + RSA++PPP P Sbjct: 505 ASSARSPSPSTSARSASSPPPSSP 576
>LOC_Os02g42080:12002.t03795:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6138 Score = 32.7 bits (65), Expect = 1.6 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 / +2 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D A AP +HL PPP PW Sbjct: 698 LLDDGQATGAPRLHLPRHGVPLPPPSSPW 784
>LOC_Os01g70690:12001.t06368:unspliced-genomic RALFL33, putative| Length = 336 Score = 32.7 bits (65), Expect = 1.6 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 / +2 Query: 19 AAARAPSVHLADRSAAAPPPQQPWVRCTDRWRVPGR 126 AA R+P + S++ PPP++PW W GR Sbjct: 14 AARRSPPPPCSSSSSSRPPPRRPWRWRRTAWASRGR 121
>LOC_Os01g65350:12001.t05901:unspliced-genomic ATP binding protein, putative, expressed| Length = 4209 Score = 32.7 bits (65), Expect = 1.6 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 / -2 Query: 4 LQPDAAAARAPSVHLADRSAAAPPP 78 LQ AA R+PS H D SA+ PPP Sbjct: 533 LQESRAARRSPSPHRPDFSASYPPP 459
>LOC_Os01g56150:12001.t05024:unspliced-genomic lysosomal Pro-X carboxypeptidase precursor, putative, expressed| Length = 3409 Score = 32.7 bits (65), Expect = 1.6 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 / +1 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L P AA+ P V S ++PPP++PW Sbjct: 55 LLPTTPAAKRPCVRSLSSS*SSPPPRRPW 141
>LOC_Os01g23050:12001.t02034:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 825 Score = 32.7 bits (65), Expect = 1.6 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 / +3 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D A AP +HL PPP PW Sbjct: 624 LLDDGQATGAPRLHLPRHGVPLPPPSSPW 710
>LOC_Os10g19010:12010.t01448:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4298 Score = 25.4 bits (49), Expect(2) = 1.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A PPP Sbjct: 22 AAAATAPQRHAVAAVATPPPP 84 Score = 24.4 bits (47), Expect(2) = 1.6 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 78 AAAATPPRQPPPRC 119
>LOC_Os01g04230:12001.t00312:unspliced-genomic receptor kinase, putative, expressed| Length = 2455 Score = 26.3 bits (51), Expect(2) = 1.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 / -3 Query: 16 AAAARAPSVHLADRSAAAPP 75 +AA RAP + R+AA+PP Sbjct: 2075 SAAGRAPPTRSSGRAAASPP 2016 Score = 23.5 bits (45), Expect(2) = 1.6 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = +1 / -3 Query: 58 SAAAPPPQQPW 90 +AAAPPP++ W Sbjct: 1931 TAAAPPPRRRW 1899
>LOC_Os04g20450:12004.t01783:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2331 Score = 25.8 bits (50), Expect(2) = 1.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 / +3 Query: 55 RSAAAPPPQQPWVRC 99 R AAA PP+QP RC Sbjct: 66 RHAAATPPRQPPPRC 110 Score = 24.0 bits (46), Expect(2) = 1.7 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPP 75 AAAA AP H A A PP Sbjct: 22 AAAATAPQRHAAAAVATPPP 81
>LOC_Os03g64200:12003.t05631:unspliced-genomic ATPase, coupled to transmembrane movement of substances, putative,| expressed Length = 5162 Score = 26.3 bits (51), Expect(2) = 2.1 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 / +1 Query: 70 PPPQQPWVRCTDRWRVPGRCG 132 PPP P + RW VP CG Sbjct: 454 PPPPPPAEEESARWPVPPWCG 516 Score = 23.1 bits (44), Expect(2) = 2.1 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 / +3 Query: 10 PDAAAARAPSVHLADRSAAAPPP 78 PD A S+HLA SA+A P Sbjct: 351 PDWADDDVDSIHLATASASASLP 419
>LOC_Os04g25650:12004.t02272:unspliced-genomic protein kinase, putative, expressed| Length = 1342 Score = 29.9 bits (59), Expect(2) = 2.1 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +3 / -1 Query: 108 LARAGKVRGQTPKVAKQDKKKQPRGRAHKR 197 L RAG + P++A +++KQ RGR +R Sbjct: 169 LVRAGAGVARRPRLAGGERRKQQRGRRRRR 80 Score = 21.7 bits (41), Expect(2) = 2.1 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +1 / -3 Query: 61 AAAPPPQQPWVRC 99 AA P PW RC Sbjct: 707 AAGPASTAPWSRC 669
>LOC_Os10g41400:12010.t03376:unspliced-genomic peptide methionine sulfoxide reductase, putative, expressed| Length = 2489 Score = 32.2 bits (64), Expect = 2.2 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 / -3 Query: 184 RPRGCFFLSCFATLGVWPRTFPAR 113 R RG FLS A + WPR+F AR Sbjct: 120 RHRGRLFLSASAFVAAWPRSFDAR 49
>LOC_Os08g39440:12008.t03676:unspliced-genomic RNA recognition motif family protein, expressed| Length = 8350 Score = 32.2 bits (64), Expect = 2.2 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 / +3 Query: 16 AAAARAPSVHLADRSAAAPPPQQPWVR 96 AAAA A +V DR A P+ PW+R Sbjct: 75 AAAAAAAAVRAVDRCGAVGAPRAPWMR 155
>LOC_Os05g33840:12005.t02979:unspliced-genomic 1-deoxy-D-xylulose-5-phosphate synthase, chloroplast precursor,| putative, expressed Length = 5981 Score = 32.2 bits (64), Expect = 2.2 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 / +1 Query: 361 LRRRPNQVSVIDCCVGNGNL 420 L+ RP++V V+DCC G G L Sbjct: 340 LQSRPHKVCVVDCCYGTGLL 399
>LOC_Os04g42784:12004.t03824:unspliced-genomic DNA mismatch repair protein, putative, expressed| Length = 16390 Score = 27.6 bits (54), Expect(2) = 2.3 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 / -2 Query: 16 AAAARAPSVHLADRSAAAPPPQQP 87 AAAA P+ H + A+PPP +P Sbjct: 10047 AAAAGQPTSHRRREAHASPPPPKP 9976 Score = 27.2 bits (53), Expect(2) = 2.3 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 / -3 Query: 174 PRGRAHKRIQYNRRFVTAVVGFGKKRG 254 PRG KR RR + AV GFGK +G Sbjct: 83 PRGFWGKRGAEKRREIWAVWGFGKCQG 3
>LOC_Os03g03790:12003.t00260:unspliced-genomic acyl-activating enzyme 11, putative, expressed| Length = 2286 Score = 26.3 bits (51), Expect(2) = 2.5 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -1 / -1 Query: 128 HLPGTRQRSVHLTH 87 H PG R R VHL H Sbjct: 534 HRPGHRHREVHLVH 493 Score = 25.8 bits (50), Expect(2) = 2.5 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 / -3 Query: 306 RRGSARPAGSTTSPTS 259 RRG RP+ S++SP+S Sbjct: 1960 RRGGRRPSSSSSSPSS 1913
>LOC_Os04g25454:12004.t02254:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class, expressed| Length = 12585 Score = 24.9 bits (48), Expect(2) = 2.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPP 75 AAAA AP H A A PP Sbjct: 5935 AAAATAPQRHAAAAGATPPP 5994 Score = 24.0 bits (46), Expect(2) = 2.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +1 / +3 Query: 61 AAAPPPQQPWVRC 99 AAA PP+QP RC Sbjct: 5985 AAATPPRQPPPRC 6023
>LOC_Os07g30700:12007.t02757:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 6823 Score = 24.4 bits (47), Expect(2) = 2.8 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP + A A PPP Sbjct: 6238 AAAATAPQRYAAAAVATPPPP 6300 Score = 24.4 bits (47), Expect(2) = 2.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 6294 AAAATPPRQPPPRC 6335
>LOC_Os09g23480:12009.t02032:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5070 Score = 24.4 bits (47), Expect(2) = 2.8 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAA AP H+A PPP Sbjct: 22 AAATTAPQRHVAAAVTTPPPP 84 Score = 24.4 bits (47), Expect(2) = 2.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 78 AAAATPPRQPPPRC 119
>LOC_Os04g25060:12004.t02217:unspliced-genomic protein kinase, putative, expressed| Length = 1346 Score = 29.5 bits (58), Expect(2) = 2.8 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +3 / -2 Query: 108 LARAGKVRGQTPKVAKQDKKKQPRGRAHKR 197 L RAG + P++A +++KQ RGR +R Sbjct: 166 LVRAGAGVARWPRLAGGERRKQQRGRRRRR 77 Score = 21.7 bits (41), Expect(2) = 2.8 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +1 / -1 Query: 61 AAAPPPQQPWVRC 99 AA P PW RC Sbjct: 704 AAGPASTAPWSRC 666
>LOC_Os03g39160:12003.t03354:unspliced-genomic expressed protein| Length = 3093 Score = 25.4 bits (49), Expect(2) = 2.9 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 / +3 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA PS H+ +PPP Sbjct: 939 AAAATPPSPHVTSARRFSPPP 1001 Score = 23.5 bits (45), Expect(2) = 2.9 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRCTDRWRVP 120 S +A P PW R RW P Sbjct: 1089 SCSAACPSSPWRRRRARWSRP 1151
>LOC_Os01g19080:12001.t01698:unspliced-genomic ligA, putative| Length = 429 Score = 24.9 bits (48), Expect(2) = 2.9 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +2 / -2 Query: 179 RPRPQAHPVQP 211 RP P+AHPV P Sbjct: 86 RPAPRAHPVPP 54 Score = 23.5 bits (45), Expect(2) = 2.9 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 / -3 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQP 87 L P A AAR +V R +P P P Sbjct: 358 LAPRATAARRVAVRRRRRPTPSPSPSPP 275
>LOC_Os11g38550:12011.t03398:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 1908 Score = 31.8 bits (63), Expect = 3.0 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPPQQP 87 AAAA AP H A +AA PP Q P Sbjct: 22 AAAATAPQRHAAAAAAATPPRQPP 93
>LOC_Os03g52120:12003.t04538:unspliced-genomic expressed protein| Length = 2957 Score = 31.8 bits (63), Expect = 3.0 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 / -3 Query: 16 AAAARAPSVHLADRSAAAPPPQQPWVRCTDRWRVPGRCG 132 A+ A AP A A PPP P T R R P CG Sbjct: 420 ASTAPAPPAAAAGAEAPPPPPTPPGTGGTARARRPPACG 304
>LOC_Os02g01380:12002.t00038:unspliced-genomic expressed protein| Length = 2538 Score = 31.8 bits (63), Expect = 3.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 / -3 Query: 7 QPDAAAARAPSVHLADRSAAAPPPQQPWVRCTDRWRVPG 123 +P A R P R AP P PW R TD PG Sbjct: 1318 RPRARTCRPPGGATPRRGRRAPAPGAPWCRGTDGGGSPG 1202
>LOC_Os01g41720:12001.t03693:unspliced-genomic conserved hypothetical protein| Length = 4199 Score = 31.8 bits (63), Expect = 3.0 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 / -2 Query: 19 AAARAPSVHLADRSAAAPPPQQPWVRCTDRWRVP 120 A R+P A R A PPP P R T RW P Sbjct: 646 APRRSPGGATARRPATRPPPGAPPPRGTTRWAPP 545
>LOC_Os02g15980:12002.t01391:unspliced-genomic expressed protein| Length = 3953 Score = 30.9 bits (61), Expect(2) = 3.0 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 / +2 Query: 88 WVRCTDRWRVPG 123 W+RCT RWR PG Sbjct: 458 WLRCTRRWRPPG 493 Score = 21.7 bits (41), Expect(2) = 3.0 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +1 / +2 Query: 58 SAAAPPPQQPW 90 S ++PPP PW Sbjct: 83 SPSSPPPPLPW 115
>LOC_Os03g55280:12003.t04792:unspliced-genomic aspartate-semialdehyde dehydrogenase, putative, expressed| Length = 3210 Score = 28.1 bits (55), Expect(2) = 3.4 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 / +3 Query: 114 RAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRR 215 RAG+VR + ++ ++ QPR R+ R Q RR Sbjct: 381 RAGRVRRGGHRALQRRRRGQPRPRSRGRRQRRRR 482 Score = 24.0 bits (46), Expect(2) = 3.4 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 / +2 Query: 16 AAAARAPSVHLADRSAAAPPPQQPWVRCTDRWR 114 A + AP+ +A R+A PP + R RWR Sbjct: 128 ARTSSAPTPAVAARAARRPPCGWRFGRTGRRWR 226
>LOC_Os11g39650:12011.t03507:unspliced-genomic sec12-like protein 2, putative, expressed| Length = 4279 Score = 25.8 bits (50), Expect(2) = 3.8 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 / -2 Query: 179 RPRPQAHPVQPP 214 RPRP+ HP PP Sbjct: 213 RPRPRPHPPPPP 178 Score = 22.6 bits (43), Expect(2) = 3.8 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 / -2 Query: 67 APPPQQPWVRCTDR 108 APPP+ P RC R Sbjct: 366 APPPRPPQRRCRAR 325
>LOC_Os01g42540:12001.t03771:unspliced-genomic ENT domain containing protein| Length = 1385 Score = 25.4 bits (49), Expect(2) = 3.9 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +1 / -3 Query: 64 AAPPPQQPWVRCTDRWRVP 120 AAPPP PW W P Sbjct: 744 AAPPPLLPWRGSASSWPRP 688 Score = 25.4 bits (49), Expect(2) = 3.9 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 / -3 Query: 102 GSLARAGKVRGQTPKVAKQDKKKQPRG 182 GS AGK + ++ KQD KK+ RG Sbjct: 504 GSPRPAGKKARRGVRLRKQDSKKRRRG 424
>LOC_Os05g32250:12005.t02821:unspliced-genomic hypothetical protein| Length = 2974 Score = 26.3 bits (51), Expect(2) = 3.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPPQQP 87 AA RAPS + +PPP++P Sbjct: 1651 AATRRAPSPTTSPPPTTSPPPERP 1722 Score = 22.1 bits (42), Expect(2) = 3.9 Identities = 11/37 (29%), Positives = 13/37 (35%) Frame = +2 / +3 Query: 179 RPRPQAHPVQPPXXXXXXXXXQEAWPQLVGEVVDPAG 289 R R + +Q P WP L VDP G Sbjct: 1812 RGRTPSGGLQRPAPTSVGTDPAPTWPDLAS*PVDPGG 1922
>LOC_Os01g08130:12001.t00691:unspliced-genomic signal transducer, putative, expressed| Length = 1006 Score = 28.1 bits (55), Expect(2) = 4.0 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 / -2 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AA+AR S LA +AAAPPP Sbjct: 858 AASAR*ASTSLATLAAAAPPP 796 Score = 22.1 bits (42), Expect(2) = 4.0 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +3 / -1 Query: 120 GKVRGQTPKVAKQDKKKQPRGRAH 191 G +RGQ P ++ +++ R R H Sbjct: 436 GALRGQEPPRRRRRRRRGRRRRGH 365
>LOC_Os04g38600:12004.t03430:unspliced-genomic glyceraldehyde-3-phosphate dehydrogenase A, chloroplast precursor,| putative, expressed Length = 1995 Score = 25.4 bits (49), Expect(2) = 4.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 10 PDAAAARAPSVHLADRSAAAPPPQQPW 90 P+A + R S RSA++ P PW Sbjct: 634 PEA*SRRRTSSSTTPRSASSTPTSSPW 714 Score = 23.1 bits (44), Expect(2) = 4.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 / +2 Query: 120 GKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRR 215 G++R Q + A + +PR R H+ ++ RR Sbjct: 752 GRLRPQPVQPAVGRARHRPRHRGHRCVRRPRR 847
>LOC_Os12g17350:12012.t01587:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3107 Score = 31.3 bits (62), Expect = 4.1 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -2 / +1 Query: 277 YYFSDELGPRFLPKPTTAVTKRRLYWMRLWARPRGC 170 Y S LG LPKPTT+ T +Y L R C Sbjct: 481 YSLSGSLGLPLLPKPTTSCTSYIIYTYSLLGRRTWC 588
>LOC_Os10g41300:12010.t03366:unspliced-genomic expressed protein| Length = 1388 Score = 31.3 bits (62), Expect = 4.1 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +1 / -3 Query: 55 RSAAAPPPQQPWVRCTDRWRVP 120 RS AAPPP +PW R R P Sbjct: 987 RSPAAPPPWRPWRRRASSGRAP 922
>LOC_Os08g42700:12008.t03999:unspliced-genomic resistance protein, putative, expressed| Length = 7984 Score = 31.3 bits (62), Expect = 4.1 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 / +3 Query: 178 RGCFFLSCFATLGVWPRTFPARASDPCT 95 + C L+C L ++P+T RA D C+ Sbjct: 2865 QSCHLLNCRCNLNLFPKTLSERAEDKCS 2948
>LOC_Os07g38270:12007.t03493:unspliced-genomic insulin-degrading enzyme, putative, expressed| Length = 16948 Score = 31.3 bits (62), Expect = 4.1 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 / -3 Query: 34 PSVHLADRSAAAPPPQQPWVRCTDRWR 114 P+ H S ++ PP++P V T RWR Sbjct: 13820 PAAHPPASSHSSAPPERPAVEATTRWR 13740
>LOC_Os06g47620:12006.t04448:unspliced-genomic IAA-amino acid hydrolase ILR1-like 6 precursor, putative, expressed| Length = 5540 Score = 31.3 bits (62), Expect = 4.1 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 / +2 Query: 354 YGNGPKATGEQANKQKRRGSARPAGSTTSPTSW 256 +G + G + +++RRG AR G +TS SW Sbjct: 353 WGGRRRLPGWRGGRRRRRGCARCGGGSTSGRSW 451
>LOC_Os06g14210:12006.t01296:unspliced-genomic hypothetical protein| Length = 783 Score = 31.3 bits (62), Expect = 4.1 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 / -2 Query: 19 AAARAPSVHLADRSAAAPPPQQP 87 A+AR+P+ + S+A+PPPQ P Sbjct: 530 ASARSPTTSSSSSSSASPPPQPP 462
>LOC_Os04g02850:12004.t00179:unspliced-genomic expressed protein| Length = 2424 Score = 31.3 bits (62), Expect = 4.1 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 / -3 Query: 7 QPDAAAARAPSVHLADRSAAAPPPQQPWVRCTDR 108 +P ++ RAPS LA S ++PPP + R R Sbjct: 2041 RPRSSCTRAPSPRLAAASCSSPPPPESTARPRSR 1940
>LOC_Os03g52794:12003.t04602:unspliced-genomic phosphatidylinositol 3- and 4-kinase family protein, expressed| Length = 18038 Score = 31.3 bits (62), Expect = 4.1 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +3 / -2 Query: 114 RAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFG 242 RAG + G+T + + +++ +G + F+ AVVGFG Sbjct: 4327 RAGILGGETAEAEAEAGRRREKGGTKPEVPRRESFLHAVVGFG 4199
>LOC_Os03g16860:12003.t01467:unspliced-genomic heat shock cognate 70 kDa protein 2, putative, expressed| Length = 2917 Score = 31.3 bits (62), Expect = 4.1 Identities = 15/55 (27%), Positives = 25/55 (45%) Frame = +3 / +3 Query: 90 GKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKRG 254 G HG L + RG+ P + ++ +PR RA +R+ A G ++ G Sbjct: 1698 GAQHGPLPQVHGARGEVPPRRQDGQEHRPRRRARRRLHPYPPRAAAAPGLLQREG 1862
>LOC_Os03g14500:12003.t01239:unspliced-genomic expressed protein| Length = 1888 Score = 31.3 bits (62), Expect = 4.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 / -2 Query: 46 LADRSAAAPPPQQPWVRCTDRWRVPGRCG 132 L R A P P W R RWR RCG Sbjct: 159 LGFRGAVVPVPAVCWWRQARRWRCGARCG 73
>LOC_Os03g04210:12003.t00301:unspliced-genomic IQ calmodulin-binding motif family protein, expressed| Length = 1002 Score = 31.3 bits (62), Expect = 4.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 / +2 Query: 4 LQPDAAAARAPSVHLADRSAAAPPP 78 L P AAAA A +V +AAAPPP Sbjct: 194 LSPAAAAAAAAAVTTTSAAAAAPPP 268
>LOC_Os02g04540:12002.t00353:unspliced-genomic vegetative cell wall protein gp1 precursor, putative, expressed| Length = 2382 Score = 31.3 bits (62), Expect = 4.1 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +3 / +1 Query: 111 ARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRR 215 ARA + RG P V +QD R RAH+R + R Sbjct: 745 ARAQQPRGMHPAVHRQDGGHAQRDRAHRRRAHRLR 849
>LOC_Os01g01130:12001.t00013:unspliced-genomic snurportin-1, putative, expressed| Length = 2421 Score = 31.3 bits (62), Expect = 4.1 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -2 / -1 Query: 373 VFFLACIRERTESYW*TSKQTKKEG*RETGWI 278 +F A +ER + Y *TS++ KKE + GWI Sbjct: 525 MFHQAAAQERRQRYE*TSQKRKKEKAGQEGWI 430
>LOC_Os08g19550:12008.t01775:unspliced-genomic expressed protein| Length = 1405 Score = 25.8 bits (50), Expect(2) = 4.2 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 / +3 Query: 136 WPRTFPARASDPC 98 WP+ PAR+S PC Sbjct: 69 WPQEVPARSSWPC 107 Score = 22.6 bits (43), Expect(2) = 4.2 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -2 / +2 Query: 217 KRRLYWMRLWA 185 +RRL+W+ WA Sbjct: 26 RRRLWWLPCWA 58
>LOC_Os01g73810:12001.t06661:unspliced-genomic ATCHX15, putative| Length = 777 Score = 24.9 bits (48), Expect(2) = 4.2 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 / +2 Query: 16 AAAARAPSVHLADRSAAAPPPQQPWVRCT 102 A++ R + + +AA+ PP++ W CT Sbjct: 131 ASSRRRHAPSASSSTAASAPPRRGWPPCT 217 Score = 24.9 bits (48), Expect(2) = 4.2 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 / +3 Query: 94 RCTDRWRVPGR 126 RC RWR PGR Sbjct: 735 RCRRRWRSPGR 767
>LOC_Os12g30430:12012.t02750:unspliced-genomic asparagine-rich protein, putative| Length = 483 Score = 24.4 bits (47), Expect(2) = 4.4 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 171 AAAATPPRQPPPRC 212 Score = 23.5 bits (45), Expect(2) = 4.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A A PP Sbjct: 115 AAAATAPQRHAAAAVATPSPP 177
>LOC_Os05g17050:12005.t01474:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 18350 Score = 24.4 bits (47), Expect(2) = 4.5 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 58 SAAAPPPQQPWVRC 99 +AAA PP+QP RC Sbjct: 8490 AAAATPPRQPPPRC 8531 Score = 23.5 bits (45), Expect(2) = 4.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPP 78 AAAA AP H A A PP Sbjct: 8434 AAAATAPQRHAAAAVATPSPP 8496
>LOC_Os03g44140:12003.t03801:unspliced-genomic OsWAK26 - OsWAK receptor-like protein kinase, expressed| Length = 9497 Score = 26.7 bits (52), Expect(2) = 4.7 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 / +1 Query: 64 AAPPPQQPWVRCTDR 108 AAPP ++PWVR D+ Sbjct: 5587 AAPPRRRPWVRQRDQ 5631 Score = 26.3 bits (51), Expect(2) = 4.7 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 / +2 Query: 179 RPRPQAHPVQPP 214 R RPQ HPV+PP Sbjct: 8687 RVRPQWHPVRPP 8722
>LOC_Os01g66020:12001.t05963:unspliced-genomic BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1| precursor, putative, expressed Length = 2766 Score = 28.6 bits (56), Expect(2) = 5.4 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 / +2 Query: 342 PKATGEQANKQKRRGSARPAGSTTSPTS 259 P+A+ +A RR + RP S SPTS Sbjct: 230 PRASAPRATSGYRRRTPRPPASAPSPTS 313 Score = 22.6 bits (43), Expect(2) = 5.4 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -2 / +2 Query: 181 PRGCFFLSCFATLGVWPRTFPARASDPC 98 P GC + G RT P RA+ PC Sbjct: 1691 PPGCTPWRGSCSSGSCARTSPWRAAPPC 1774
>LOC_Os12g31570:12012.t02861:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6194 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +3 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 699 LLDDGQTTGAPRLHLPRHGVPLPPPSSPW 785
>LOC_Os12g29090:12012.t02619:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1339 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +1 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 694 LLDDGQVTGAPRLHLPRHGVPLPPPSSPW 780
>LOC_Os12g28470:12012.t02557:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6181 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +2 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 698 LLDDGQTTGAPRLHLPRHGVPLPPPSSPW 784
>LOC_Os11g38090:12011.t03351:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5705 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +3 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 243 LLDDGQTTGAPRLHLPRHGVPLPPPSSPW 329
>LOC_Os10g17820:12010.t01338:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5731 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +3 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 243 LLDDGQVTGAPRLHLPRHGVPLPPPSSPW 329
>LOC_Os09g34900:12009.t03017:unspliced-genomic bile acid sodium symporter, putative, expressed| Length = 3323 Score = 30.9 bits (61), Expect = 5.6 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 / -2 Query: 330 GEQANKQKRRGSARPAGSTTSPTSWG 253 GE A RRGS RP G +P WG Sbjct: 187 GETAWGGARRGSRRPVGRWWTPAMWG 110
>LOC_Os09g28260:12009.t02504:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5713 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +3 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 243 LLDDGQVTGAPRLHLPRHGVPLPPPSSPW 329
>LOC_Os08g32790:12008.t03022:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5192 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +3 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 243 LLDDGQTTGAPRLHLPRHGVPLPPPSSPW 329
>LOC_Os08g20370:12008.t01855:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6161 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +2 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 698 LLDDGQTTGAPRLHLPRHGVPLPPPSSPW 784
>LOC_Os07g30910:12007.t02778:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5731 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +3 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 243 LLDDGQTTGAPRLHLPRHGVPLPPPSSPW 329
>LOC_Os07g30740:12007.t02761:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1343 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +2 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 698 LLDDGQTTGAPRLHLPRHGVPLPPPSSPW 784
>LOC_Os07g19250:12007.t01781:unspliced-genomic transposon protein, putative, unclassified| Length = 1901 Score = 30.9 bits (61), Expect = 5.6 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +1 / -2 Query: 10 PDAAAARAPSVHLADRSAAAPPPQQPWVRCTDRWRVP 120 P R S+ +A ++PP VRC + WR+P Sbjct: 1831 PPRRRRRPSSIRVAPPLPSSPPVAVTAVRCAEVWRIP 1721
>LOC_Os06g48900:12006.t04576:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6173 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +2 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 698 LLDDGQTTGAPRLHLPRHGVPLPPPSSPW 784
>LOC_Os06g48400:12006.t04526:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2230 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +3 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 243 LLDDGQTTGAPRLHLPRHGVPLPPPSSPW 329
>LOC_Os06g48380:12006.t04524:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5707 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +3 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 243 LLDDGQTTGAPRLHLPRHGVPLPPPSSPW 329
>LOC_Os06g48370:12006.t04523:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5707 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +3 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 243 LLDDGQTTGAPRLHLPRHGVPLPPPSSPW 329
>LOC_Os06g41520:12006.t03844:unspliced-genomic F-box domain containing protein| Length = 1556 Score = 30.9 bits (61), Expect = 5.6 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +1 / +2 Query: 43 HLADRSAAAPPPQQPWVRCTDRWRVP 120 H + R +P + W+RC+ RW P Sbjct: 560 HQSRRRKQSPRRRSAWIRCSHRWTAP 637
>LOC_Os06g32450:12006.t02943:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3078 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +2 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 698 LLDDGQTTGAPRLHLPRHGVPLPPPSSPW 784
>LOC_Os05g50250:12005.t04457:unspliced-genomic dihydroflavonol-4-reductase, putative, expressed| Length = 5773 Score = 30.9 bits (61), Expect = 5.6 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -3 / +2 Query: 375 RSSS*HAYGNGPKATGEQANKQKRRGSARPAGSTTSPTSWG 253 RS++ G GP+ +G ++ RR P S SWG Sbjct: 227 RSAATARGGRGPRRSGRPGRRRARRPRPAPCASPAGYRSWG 349
>LOC_Os05g39990:12005.t03539:unspliced-genomic alpha-expansin 1 precursor, putative, expressed| Length = 1967 Score = 30.9 bits (61), Expect = 5.6 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 / -2 Query: 16 AAAARAPSVHLADRSAAAPPPQQPWVRCTDRWRVPGRCG 132 + AAR + R+A+ + W RC RWR PGR G Sbjct: 1423 SVAARTGHPRRSGRTASRGGRRCCW*RCGRRWR*PGRRG 1307
>LOC_Os05g37300:12005.t03273:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3308 Score = 30.9 bits (61), Expect = 5.6 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 / -2 Query: 357 AYGNGPKATGEQANKQKRRGSARPAGSTTSPTSWG 253 ++G P A E +RRG R + S++ PTS G Sbjct: 559 SWGPAPGADSEVGGALRRRGGCRTSRSSSHPTSCG 455
>LOC_Os05g07520:12005.t00635:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5671 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +3 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 243 LLDDGQTTGAPRLHLPRHGVPLPPPSSPW 329
>LOC_Os05g07500:12005.t00634:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5707 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +3 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 243 LLDDGQTTGAPRLHLPRHGVPLPPPSSPW 329
>LOC_Os05g07400:12005.t00625:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5708 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +3 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 243 LLDDGQVTGAPRLHLPRHGVPLPPPSSPW 329
>LOC_Os05g07380:12005.t00624:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5708 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +3 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 243 LLDDGQVTGAPRLHLPRHGVPLPPPSSPW 329
>LOC_Os04g57060:12004.t05173:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4967 Score = 30.9 bits (61), Expect = 5.6 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -2 / +3 Query: 277 YYFSDELGPRFLPKPTTAVTKRRLYWMRLWARPRGC 170 Y S LG LPKPTT+ T +Y L R C Sbjct: 609 YSLSGSLGLPLLPKPTTSCTPYIIYTYSLLGRGTWC 716
>LOC_Os04g24060:12004.t02121:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6185 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +2 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 698 LLDDGQVTGAPRLHLPRHGVPLPPPSSPW 784
>LOC_Os04g06290:12004.t00507:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5621 Score = 30.9 bits (61), Expect = 5.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 / -2 Query: 28 RAPSVHLADRSAAAPPPQQPWVRCTDRWRVPGR 126 R+ H A R+A PP + R +RW V GR Sbjct: 1009 RSDRSHAASRTACTPPVEPLSCRLLNRWYVTGR 911
>LOC_Os03g61510:12003.t05382:unspliced-genomic pectinesterase inhibitor domain containing protein, expressed| Length = 913 Score = 30.9 bits (61), Expect = 5.6 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +1 / -3 Query: 7 QPDAAAARAPSVHLADRSAAAPPPQQPWVRCTDRWR 114 +P A R PS A R+ PPP++ W R R R Sbjct: 293 RPGTATCRCPSRCRAPRARTCPPPRRWWRRSGRRSR 186
>LOC_Os03g61040:12003.t05337:unspliced-genomic expressed protein| Length = 1941 Score = 30.9 bits (61), Expect = 5.6 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 / -3 Query: 22 AARAPSVHLADRSAAAPPPQQPWVRCTDRW 111 AARA S A+ SA PP P C + W Sbjct: 850 AARACSAQAANSSAVGAPPPPPEALCLEGW 761
>LOC_Os03g19270:12003.t01693:unspliced-genomic ER6 protein, putative, expressed| Length = 1349 Score = 30.9 bits (61), Expect = 5.6 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 / -3 Query: 58 SAAAPPPQQPWVRCTDRWRVPGR 126 SA +PPP P CT +WR P R Sbjct: 468 SAPSPPPPPPPPCCTRQWRRPPR 400
>LOC_Os02g52314:12002.t04812:unspliced-genomic ER6 protein, putative, expressed| Length = 3833 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +1 / -1 Query: 28 RAPSVHLADRSAAAPPPQQPWVRCTDRWRVP 120 RAP+ + + PPP W C WR P Sbjct: 233 RAPTAARSCSPRSRPPPPPRWPGCRSPWRAP 141
>LOC_Os02g42750:12002.t03860:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5700 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +3 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 243 LLDDGQVTGAPRLHLPRHGVPLPPPSSPW 329
>LOC_Os02g39360:12002.t03574:unspliced-genomic salt tolerance-like protein, putative, expressed| Length = 1344 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 / -3 Query: 58 SAAAPPPQQPWVRCTDRWRVPGRCG 132 S++ PPP QP + ++ R P RCG Sbjct: 169 SSSPPPPPQPRTQLKNKIRQPQRCG 95
>LOC_Os02g01679:12002.t00068:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1343 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +2 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 698 LLDDGQTTGAPRLHLPRHGVPLPPPSSPW 784
>LOC_Os02g01649:12002.t00065:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1343 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +2 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 698 LLDDGQTTGAPRLHLPRHGVPLPPPSSPW 784
>LOC_Os01g74170:12001.t06697:unspliced-genomic expressed protein| Length = 3088 Score = 30.9 bits (61), Expect = 5.6 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 / -3 Query: 439 FNWTKQ*DFHYQHNSQLQ 386 FNW *+FHY H+ QL+ Sbjct: 1472 FNWQYH*NFHYLHHQQLE 1419
>LOC_Os01g73344:12001.t06616:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6168 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 / +1 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPW 90 L D AP +HL PPP PW Sbjct: 694 LLDDGQVTGAPRLHLPRHGVPLPPPSSPW 780
>LOC_Os01g65260:12001.t05892:unspliced-genomic amidophosphoribosyltransferase, chloroplast precursor, putative,| expressed Length = 1948 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 / +2 Query: 55 RSAAAPPPQQPWVRCTDRWRVPGRC 129 R + APPP +P RC P RC Sbjct: 92 RCSGAPPPSRPLSRCATARAAPRRC 166
>LOC_Os01g42420:12001.t03760:unspliced-genomic expressed protein| Length = 747 Score = 30.9 bits (61), Expect = 5.6 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 / -3 Query: 345 GPKATGEQANKQKRRGSARPAGSTTSPTSW 256 G + G + +RRG+ RPAG + SW Sbjct: 733 GCRGRGAWRRRHRRRGAGRPAGGAGTARSW 644
>LOC_Os01g37030:12001.t03250:unspliced-genomic conserved hypothetical protein| Length = 466 Score = 30.9 bits (61), Expect = 5.6 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 / -1 Query: 439 FNWTKQ*DFHYQHNSQLQ 386 FNW *+FHY H+ QL+ Sbjct: 109 FNWQYH*NFHYLHHQQLE 56
>LOC_Os01g36970:12001.t03246:unspliced-genomic expressed protein| Length = 3245 Score = 30.9 bits (61), Expect = 5.6 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 / +1 Query: 90 GKVHGSLARAGKVRGQTPKVAKQDKKKQPRGRAH 191 G+VHG RA R + A ++ ++PRG AH Sbjct: 2704 GEVHGRGGRAAAGRAEGAGGADREDHRRPRGHAH 2805
>LOC_Os11g41840:12011.t03717:unspliced-genomic arabinose-proton symporter, putative| Length = 1619 Score = 25.4 bits (49), Expect(2) = 6.1 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 / +2 Query: 306 RRGSARPAGSTTSP 265 RR S RPA +TTSP Sbjct: 26 RRSSRRPATTTTSP 67 Score = 24.9 bits (48), Expect(2) = 6.1 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 / +1 Query: 160 SCFATLGVWPRTFPARASDP 101 SC+ T WP P R++ P Sbjct: 370 SCWRTRSSWPARSPCRSAPP 429
>LOC_Os02g09960:12002.t00843:unspliced-genomic protein kinase, putative, expressed| Length = 2372 Score = 26.7 bits (52), Expect(2) = 6.3 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 / +3 Query: 67 APPPQQPWVRCTDRWR 114 +PP +PW RC+ R R Sbjct: 1977 SPPRGRPWTRCSSRSR 2024 Score = 24.0 bits (46), Expect(2) = 6.3 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +1 / +1 Query: 7 QPDAAAARAPSVHLADRSAAAPPPQQP 87 +P AARA V R+ PP QP Sbjct: 1441 RPGVEAARAGGVRRRRRAQLPPPLHQP 1521
>LOC_Os12g38860:12012.t03566:unspliced-genomic IBS1, putative, expressed| Length = 3619 Score = 24.4 bits (47), Expect(2) = 7.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 / +1 Query: 55 RSAAAPPPQQPWVRCTDR 108 R ++ PPP P RC D+ Sbjct: 2056 RCSSPPPPASPGPRCHDQ 2109 Score = 23.1 bits (44), Expect(2) = 7.0 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 / +2 Query: 7 QPDAAAARAPSVHLADRSAAAPPP 78 +PDAAAA A V PPP Sbjct: 1973 RPDAAAASAADVPELPGRRRRPPP 2044
>LOC_Os03g26530:12003.t02338:unspliced-genomic acyltransferase, putative, expressed| Length = 2005 Score = 25.4 bits (49), Expect(2) = 7.3 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 / +3 Query: 150 AKQDKKKQPRGRAHKRIQYNRRFVTAVVGFGKKR 251 A+QD + PR R H+R + R A G + R Sbjct: 765 ARQDGARLPRARQHRRQRRRPRLRAAAGGRRRHR 866 Score = 22.1 bits (42), Expect(2) = 7.3 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 / +2 Query: 58 SAAAPPPQQPWVRCT 102 +AAAPP P RC+ Sbjct: 716 AAAAPPCWSPTTRCS 760
>LOC_Os07g06450:12007.t00525:unspliced-genomic ribonucleoprotein, chloroplast precursor, putative, expressed| Length = 1994 Score = 24.0 bits (46), Expect(2) = 7.3 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 / -2 Query: 19 AAARAPSVHLADRSAAAPPPQQP 87 A ARAP+ A APPP P Sbjct: 400 ALARAPAGFSAGSIREAPPPPPP 332 Score = 23.5 bits (45), Expect(2) = 7.3 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +1 / -2 Query: 70 PPPQQPWVRCTDRWRVP 120 PPP+ P RWR P Sbjct: 307 PPPRTPPPLLPPRWRTP 257
>LOC_Os09g27430:12009.t02422:unspliced-genomic hypothetical protein| Length = 774 Score = 27.2 bits (53), Expect(2) = 7.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 / +3 Query: 28 RAPSVHLADRSAAAPPPQQP 87 R P VH+ + AA PP +P Sbjct: 288 RVPEVHVPEAEVAAAPPPRP 347 Score = 21.7 bits (41), Expect(2) = 7.6 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +1 / +2 Query: 88 WVRCTDRWRVPGRCG 132 W+R RW P CG Sbjct: 593 WMRSGARWTSPR*CG 637
>LOC_Os12g42690:12012.t03943:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3552 Score = 30.4 bits (60), Expect = 7.7 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 / -3 Query: 342 PKATGEQANKQKRRGSARPAGSTTSPTSWG 253 P A E +RRG R +++ PTSWG Sbjct: 544 PGAGSEVGGALRRRGGCRTNRTSSRPTSWG 455
>LOC_Os12g32260:12012.t02927:unspliced-genomic expressed protein| Length = 1294 Score = 30.4 bits (60), Expect = 7.7 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 / +2 Query: 19 AAARAPSVHLADRSAAAPPPQQPW 90 AAA A S + SAA PPP PW Sbjct: 671 AAAPAQSSGPSSSSAATPPPPSPW 742
>LOC_Os12g30930:12012.t02799:unspliced-genomic conserved hypothetical protein| Length = 680 Score = 30.4 bits (60), Expect = 7.7 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 / -1 Query: 10 PDAAAARAPSVHLADRSAAAPPPQQPWVRC 99 P A PS L+ + A PP PW+RC Sbjct: 392 PTPARCPPPSPWLSPPTPARCPPPSPWLRC 303
>LOC_Os12g09300:12012.t00809:unspliced-genomic AAP6, putative, expressed| Length = 3860 Score = 30.4 bits (60), Expect = 7.7 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = -3 / +1 Query: 372 SSS*HAYGNGPKATGEQANKQKRRGSARPAGSTTSPTS 259 +SS A P AT A S P+GS+TSPTS Sbjct: 2860 TSSSAAPATPPSATTPPATSSPASPSTSPSGSSTSPTS 2973
>LOC_Os11g48050:12011.t04298:unspliced-genomic expressed protein| Length = 1815 Score = 30.4 bits (60), Expect = 7.7 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 / +1 Query: 303 RGSARPAGSTTSPTSWGH 250 RGSARPA +T SP S H Sbjct: 334 RGSARPASATASPASTRH 387
>LOC_Os11g10810:12011.t00969:unspliced-genomic PHA synthase, putative| Length = 993 Score = 30.4 bits (60), Expect = 7.7 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -3 / +3 Query: 351 GNGPKATGEQANKQKRRGSARPAGSTTSPTSWG 253 GNG KA G ++RR R G + T WG Sbjct: 693 GNGRKAVGVGRRGRRRRAVMRGGGESGRATVWG 791
>LOC_Os10g38890:12010.t03128:unspliced-genomic expressed protein| Length = 3757 Score = 30.4 bits (60), Expect = 7.7 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +3 / -1 Query: 123 KVRGQTPKVAKQDKKKQPRGRAHKRIQYNRRFVTAVVG 236 K R P + QD+K+QP G AH Q +R V G Sbjct: 217 KPR*GRPPMLLQDRKRQP*GHAHSGGQRQQRTAATVPG 104
>LOC_Os09g38850:12009.t03352:unspliced-genomic OsWAK91 - OsWAK receptor-like protein kinase, expressed| Length = 3140 Score = 30.4 bits (60), Expect = 7.7 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +1 / +2 Query: 16 AAAARAPSVHLADRSAAAPPPQQPWVRCTDRWRVP 120 AA +R S S+AA PP RC+ WR P Sbjct: 473 AATSRPRSPGRTPTSSAAAPPSARSARCSPAWRRP 577
>LOC_Os09g27320:12009.t02411:unspliced-genomic zinc finger protein, putative| Length = 960 Score = 30.4 bits (60), Expect = 7.7 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 / +2 Query: 55 RSAAAPPPQQPWVRCTDRWR 114 R +PPP PW R RWR Sbjct: 644 RCGVSPPPPSPWRRPPRRWR 703
>LOC_Os08g40830:12008.t03813:unspliced-genomic pumilio domain-containing protein PPD1, putative, expressed| Length = 15552 Score = 30.4 bits (60), Expect = 7.7 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 / +1 Query: 10 PDAAAARAPSVHLADRSAAAPPPQQPWVRCTDR 108 P AAAA A ++ L+ AA PPP + C R Sbjct: 4759 PTAAAATATAIALSAPDAATPPPAAVALECEIR 4857
>LOC_Os08g39350:12008.t03667:unspliced-genomic glycerophosphoryl diester phosphodiesterase family protein,| putative, expressed Length = 6221 Score = 30.4 bits (60), Expect = 7.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 / -3 Query: 342 PKATGEQANKQKRRGSARPAGS 277 P ATGE ++ RRGS RP S Sbjct: 333 PHATGEGGSRAYRRGSCRPGAS 268
>LOC_Os06g35650:12006.t03262:unspliced-genomic reticuline oxidase precursor, putative, expressed| Length = 1815 Score = 30.4 bits (60), Expect = 7.7 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 / -3 Query: 342 PKATGEQANKQKRRGSARPAGSTTSPTSW 256 P++T A ++ R RPA STT+ TSW Sbjct: 499 PESTHAVAARRLTRTERRPARSTTANTSW 413
>LOC_Os06g28520:12006.t02556:unspliced-genomic hypothetical protein| Length = 1811 Score = 30.4 bits (60), Expect = 7.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 / +1 Query: 67 APPPQQPWVRCTDRWR 114 APPP PW R T WR Sbjct: 19 APPPPVPWTRSTVDWR 66
>LOC_Os06g25510:12006.t02358:unspliced-genomic hypothetical protein| Length = 348 Score = 30.4 bits (60), Expect = 7.7 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 / -3 Query: 7 QPDAAAARAPSVHLADRSAAAPPPQQPWVR 96 +P AAA + P+ S++ PPP+ W R Sbjct: 169 EPPAAARQEPAARRIYSSSSTPPPRALWAR 80
>LOC_Os06g18960:12006.t01719:unspliced-genomic cadmium tolerance factor, putative, expressed| Length = 4035 Score = 30.4 bits (60), Expect = 7.7 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +1 / -2 Query: 10 PDAAAARAPSVHLADRSAAAPPPQQPWVRCTDRWRVP 120 P A+ R + R +AAP P P R T RW P Sbjct: 269 PGASGRRPCTARRRRRPSAAPRPAAPGRRSTSRWPPP 159
>LOC_Os05g30490:12005.t02648:unspliced-genomic harpin-induced 1, putative| Length = 783 Score = 30.4 bits (60), Expect = 7.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 / -3 Query: 67 APPPQQPWVRCTDRWRVPGRC 129 APPP P R T WR P RC Sbjct: 619 APPP*APPRRTTRPWRAPPRC 557
>LOC_Os05g10400:12005.t00875:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2374 Score = 30.4 bits (60), Expect = 7.7 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 / +1 Query: 16 AAAARAPSVHLADRSAAAPPPQQPWVRCTDR 108 AAAA AP H A A PPP P R R Sbjct: 22 AAAATAPQRHAAAAVATPPPPPPPRRRANRR 114
>LOC_Os04g35460:12004.t03216:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2143 Score = 30.4 bits (60), Expect = 7.7 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -3 / +3 Query: 348 NGPKATGEQANKQKRRGSARPAGS 277 NG +A GE+A R+ +ARPAG+ Sbjct: 624 NGGQAGGEEAAATPRKATARPAGA 695
>LOC_Os03g56610:12003.t04920:unspliced-genomic expressed protein| Length = 2366 Score = 30.4 bits (60), Expect = 7.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 / +3 Query: 342 PKATGEQANKQKRRGSARPAGSTTSPTSWG 253 P +Q + + R SA GST+S +SWG Sbjct: 81 PTVYQQQPSSRARAASAMAGGSTSSSSSWG 170
>LOC_Os02g44200:12002.t04012:unspliced-genomic pollen thioesterase, putative| Length = 2219 Score = 30.4 bits (60), Expect = 7.7 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 / -1 Query: 19 AAARAPSVHLADRSAAAPPPQQPWVRCTDRWRVPGRCG 132 AA RAP+ ++ S + P+ PW+R D P CG Sbjct: 158 AA*RAPARRPSEWSTCSSTPRWPWLRRDDPAADPACCG 45
>LOC_Os02g43610:12002.t03946:unspliced-genomic hypothetical protein| Length = 707 Score = 30.4 bits (60), Expect = 7.7 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 / -3 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQPWVRC 99 LQP A A A +H+A R + PP RC Sbjct: 582 LQPPAPAVAARELHVAGRDSTLPPVSMTPSRC 487
>LOC_Os01g71410:12001.t06437:unspliced-genomic glucan endo-1,3-beta-glucosidase GII precursor, putative, expressed| Length = 1126 Score = 30.4 bits (60), Expect = 7.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 / +3 Query: 88 WVRCTDRWRVPGRCG 132 W CT RWR PGR G Sbjct: 825 WTPCTRRWRRPGRRG 869
>LOC_Os01g51400:12001.t04572:unspliced-genomic Leucine Rich Repeat family protein, expressed| Length = 2337 Score = 30.4 bits (60), Expect = 7.7 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 / -1 Query: 16 AAAARAPSVHLADRSAAAPPPQQPWVRCTDRWRVP 120 A+AAR P L ++++PPP + RWR P Sbjct: 1320 ASAARPPGSRLPSAASSSPPPPRQPCPPRRRWRRP 1216
>LOC_Os01g46980:12001.t04147:unspliced-genomic vacuolar ATP synthase subunit E, putative, expressed| Length = 4862 Score = 30.4 bits (60), Expect = 7.7 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -2 / -1 Query: 247 FLPKPTTAVTKRRLYWMRLWARPRGCFFLSCFATL 143 F+ TT+ KR LY LW R CF S F L Sbjct: 2921 FIQT*TTSSFKRFLYSWWLWLTRRSCFVASSFMEL 2817
>LOC_Os01g41834:12001.t03704:unspliced-genomic chalcone synthase 4, putative| Length = 3743 Score = 30.4 bits (60), Expect = 7.7 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 / +1 Query: 7 QPDAAAARAPSVHLADRSAAAPPPQQPW 90 +P AAA+ AP+ + SA+ PP PW Sbjct: 2920 RPPAAASPAPTSSSSASSASRRPPSAPW 3003
>LOC_Os10g23820:12010.t01810:unspliced-genomic agmatine coumaroyltransferase, putative, expressed| Length = 1581 Score = 26.7 bits (52), Expect(2) = 8.0 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 / -3 Query: 55 RSAAAPPPQQPWVRCTDRWRVPGRCG 132 R PP + CT R R P RCG Sbjct: 1207 RRRRPPPRSRRTTGCTARRRAPRRCG 1130 Score = 23.1 bits (44), Expect(2) = 8.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +3 / -3 Query: 132 GQTPKVAKQDKKKQPRGRAHKRIQYNRR 215 G+TP A + + + PRGR + RR Sbjct: 766 GRTPAPAGRGEPRSPRGRRTASGGWRRR 683
>LOC_Os08g38270:12008.t03563:unspliced-genomic fasciclin-like arabinogalactan protein 10 precursor, putative,| expressed Length = 1183 Score = 26.7 bits (52), Expect(2) = 8.3 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +1 / +2 Query: 70 PPPQQPWVRCTDRW 111 P P W RC+ RW Sbjct: 551 PSPSTRWTRCSSRW 592 Score = 22.6 bits (43), Expect(2) = 8.3 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +1 / +1 Query: 4 LQPDAAAARAPSVHLADRSAAAPPPQQP 87 L AA +A + ++ AAPPP P Sbjct: 76 LAVSAADGKAAAAPAKAKAPAAPPPAPP 159
>LOC_Os01g49270:12001.t04366:unspliced-genomic XPA-binding protein 2, putative, expressed| Length = 2328 Score = 28.1 bits (55), Expect(2) = 8.3 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 / +3 Query: 22 AARAPSVHLADRSAAAPPPQQP 87 AARAP R AA PPP++P Sbjct: 411 AARAPRHAAPPRLAALPPPRRP 476 Score = 22.1 bits (42), Expect(2) = 8.3 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 / +1 Query: 67 APPPQQPWVRCTDRWR 114 APP + PW R R R Sbjct: 1534 APPTRAPWPRAPRRRR 1581
>LOC_Os01g40480:12001.t03572:unspliced-genomic phosphoribosylanthranilate transferase, 3 partial, putative,| expressed Length = 3329 Score = 26.7 bits (52), Expect(2) = 8.4 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 / -3 Query: 105 SLARAGKVRGQTPKVAKQDKKKQPRGRAHKRIQYNRR 215 S +RAG R P A+ ++ RGR ++ RR Sbjct: 516 SASRAGSTRSPPPLAARTATRRCARGRGSGSSRHRRR 406 Score = 24.0 bits (46), Expect(2) = 8.4 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 / -3 Query: 22 AARAPSVHLADRSAAAPPPQQPWVRCTDRWRVPGRC 129 AA AP A RSA PP R R P C Sbjct: 3075 AAPAPPASAASRSAPGAPPAAARRRTPPPGRRPPPC 2968
>LOC_Os11g45250:12011.t04053:unspliced-genomic ribonucleases P/MRP protein subunit POP1 containing protein,| expressed Length = 4918 Score = 27.6 bits (54), Expect(2) = 8.8 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 / +2 Query: 13 DAAAARAPSVHLADRSAAAPPPQQPWVR 96 DAA RAP H APPP +P R Sbjct: 167 DAAPLRAPPHHGPPPLQQAPPPPKPGCR 250 Score = 23.5 bits (45), Expect(2) = 8.8 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +1 / +2 Query: 79 QQPWVRCTDRWR 114 Q PW R T+ WR Sbjct: 2273 QFPWTRITNSWR 2308
>LOC_Os05g40660:12005.t03605:unspliced-genomic ulp1 protease family, C-terminal catalytic domain containing protein| Length = 4721 Score = 24.0 bits (46), Expect(2) = 9.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 / -1 Query: 46 LADRSAAAPPPQQPWVRCTDR 108 L+ S APPP+ P RC R Sbjct: 1571 LSPPSRLAPPPRSPSRRCRCR 1509 Score = 23.1 bits (44), Expect(2) = 9.1 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = +3 / -2 Query: 141 PKVAKQDKKKQPRGRAHKRIQYNRRF 218 P+ + +++ P R H+R + RRF Sbjct: 1426 PRPPLRRRRRPPEHRRHRRPEDRRRF 1349
>LOC_Os12g06150:12012.t00501:unspliced-genomic plant-specific domain TIGR01568 family protein, expressed| Length = 1379 Score = 25.4 bits (49), Expect(2) = 9.5 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +1 / -1 Query: 349 PVCMLRRRPNQVSVIDCCVGNGNLTA 426 P CM RRR C G+ TA Sbjct: 272 PSCMARRRSRTRGTTPCAAGSSRRTA 195 Score = 24.0 bits (46), Expect(2) = 9.5 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 / -1 Query: 55 RSAAAPPPQQPW 90 R APPP PW Sbjct: 803 RGGRAPPPSPPW 768
>LOC_Os02g47770:12002.t04361:unspliced-genomic zinc finger homeodomain protein 1, putative, expressed| Length = 2101 Score = 23.5 bits (45), Expect(2) = 9.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 / +3 Query: 25 ARAPSVHLADRSAAAPP 75 AR+PSVH +AAA P Sbjct: 84 ARSPSVHDGGGAAAAAP 134 Score = 23.5 bits (45), Expect(2) = 9.8 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 / +2 Query: 179 RPRPQAHPVQPPXXXXXXXXXQEAWPQLVG 268 R R + PV P +E W +LVG Sbjct: 236 RRRRRRRPVDPTCMRLTTMGREEGWRRLVG 325 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 150,189,616 Number of extensions: 2250631 Number of successful extensions: 20631 Number of sequences better than 10.0: 190 Length of query: 150 Length of database: 55,613,886 Length adjustment: 47 Effective length of query: 103 Effective length of database: 52,968,820 Effective search space: 5455788460 Effective search space used: 5455788460 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
