ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf54g14 |
|---|---|
| Clone Library Name | barley_pub |
>Q93XX8:NOLA3_ARATH H/ACA ribonucleoprotein complex subunit 3-like protein -| Arabidopsis thaliana (Mouse-ear cress) Length = 64 Score = 107 bits (267), Expect = 2e-23 Identities = 51/64 (79%), Positives = 56/64 (87%) Frame = +2 Query: 86 MYLQYYINEKGIKVYTTKKESPLGVPTQSAHPARFSPDDKYARQRYLLKKRFGLLPTQQP 265 MYLQ YINEKG KVYTTKKESPLG+ T+SAHPARFSPDDKY++QR LLKKRFGLLPTQ Sbjct: 1 MYLQCYINEKGEKVYTTKKESPLGLATESAHPARFSPDDKYSKQRVLLKKRFGLLPTQNA 60 Query: 266 AQKY 277 +Y Sbjct: 61 PLQY 64
>Q6DRH5:NOLA3_DANRE H/ACA ribonucleoprotein complex subunit 3 - Danio rerio (Zebrafish)| (Brachydanio rerio) Length = 64 Score = 90.5 bits (223), Expect = 3e-18 Identities = 41/60 (68%), Positives = 48/60 (80%) Frame = +2 Query: 86 MYLQYYINEKGIKVYTTKKESPLGVPTQSAHPARFSPDDKYARQRYLLKKRFGLLPTQQP 265 M+LQ+Y+NE G +VYT KK P G PT SAHPARFSPDDK++R R +KKRFGLL TQQP Sbjct: 1 MFLQFYLNENGERVYTLKKVDPSGQPTSSAHPARFSPDDKFSRHRVTIKKRFGLLLTQQP 60
>Q9P7M5:NOP10_SCHPO H/ACA ribonucleoprotein complex subunit 3 - Schizosaccharomyces| pombe (Fission yeast) Length = 64 Score = 89.7 bits (221), Expect = 5e-18 Identities = 42/64 (65%), Positives = 52/64 (81%) Frame = +2 Query: 86 MYLQYYINEKGIKVYTTKKESPLGVPTQSAHPARFSPDDKYARQRYLLKKRFGLLPTQQP 265 M+L YY+N++G +VYT KK SP G T+S+HPARFSPDDKY+RQRY LKKRF +L TQ P Sbjct: 1 MHLMYYLNDEGKRVYTLKKVSPDGRVTKSSHPARFSPDDKYSRQRYTLKKRFHVLLTQLP 60 Query: 266 AQKY 277 A+ Y Sbjct: 61 AKPY 64
>Q9CQS2:NOLA3_MOUSE H/ACA ribonucleoprotein complex subunit 3 - Mus musculus (Mouse)| Length = 64 Score = 87.0 bits (214), Expect = 3e-17 Identities = 40/60 (66%), Positives = 48/60 (80%) Frame = +2 Query: 86 MYLQYYINEKGIKVYTTKKESPLGVPTQSAHPARFSPDDKYARQRYLLKKRFGLLPTQQP 265 M+LQYY+NE+G +VYT KK P+G T SAHPARFSPDDKY+R R +KKRF +L TQQP Sbjct: 1 MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQP 60
>Q9NPE3:NOLA3_HUMAN H/ACA ribonucleoprotein complex subunit 3 - Homo sapiens (Human)| Length = 64 Score = 87.0 bits (214), Expect = 3e-17 Identities = 40/60 (66%), Positives = 48/60 (80%) Frame = +2 Query: 86 MYLQYYINEKGIKVYTTKKESPLGVPTQSAHPARFSPDDKYARQRYLLKKRFGLLPTQQP 265 M+LQYY+NE+G +VYT KK P+G T SAHPARFSPDDKY+R R +KKRF +L TQQP Sbjct: 1 MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQP 60
>Q9V5P6:NOLA3_DROME H/ACA ribonucleoprotein complex subunit 3 - Drosophila melanogaster| (Fruit fly) Length = 64 Score = 86.3 bits (212), Expect = 5e-17 Identities = 42/64 (65%), Positives = 48/64 (75%) Frame = +2 Query: 86 MYLQYYINEKGIKVYTTKKESPLGVPTQSAHPARFSPDDKYARQRYLLKKRFGLLPTQQP 265 MYL Y INE G +VYT KK + G PT SAHPARFSP+DKY+RQR +KKRFGLL TQ+P Sbjct: 1 MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKKRFGLLLTQKP 60 Query: 266 AQKY 277 Y Sbjct: 61 EPIY 64
>Q6BQP3:NOP10_DEBHA H/ACA ribonucleoprotein complex subunit 3 - Debaryomyces hansenii| (Yeast) (Torulaspora hansenii) Length = 58 Score = 76.3 bits (186), Expect = 5e-14 Identities = 37/58 (63%), Positives = 43/58 (74%) Frame = +2 Query: 86 MYLQYYINEKGIKVYTTKKESPLGVPTQSAHPARFSPDDKYARQRYLLKKRFGLLPTQ 259 M+L Y + G +VYT K + G T+SAHPARFSPDDKY+RQR LKKRFGLLPTQ Sbjct: 1 MHLMYTLGPDGKRVYTLNKTTSDGEITKSAHPARFSPDDKYSRQRVTLKKRFGLLPTQ 58
>Q6Q547:NOP10_YEAST H/ACA ribonucleoprotein complex subunit 3 - Saccharomyces| cerevisiae (Baker's yeast) Length = 58 Score = 74.3 bits (181), Expect = 2e-13 Identities = 35/58 (60%), Positives = 43/58 (74%) Frame = +2 Query: 86 MYLQYYINEKGIKVYTTKKESPLGVPTQSAHPARFSPDDKYARQRYLLKKRFGLLPTQ 259 M+L Y + G ++YT KK + G T+SAHPARFSPDDKY+RQR LKKRFGL+P Q Sbjct: 1 MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
>Q9XVR8:NOLA3_CAEEL Putative H/ACA ribonucleoprotein complex subunit 3-like protein -| Caenorhabditis elegans Length = 64 Score = 74.3 bits (181), Expect = 2e-13 Identities = 32/59 (54%), Positives = 47/59 (79%) Frame = +2 Query: 86 MYLQYYINEKGIKVYTTKKESPLGVPTQSAHPARFSPDDKYARQRYLLKKRFGLLPTQQ 262 M+L+Y+++E +VYT K+ +P G T +AHPARFSP+DK ++ R ++KKRFGLLPTQ+ Sbjct: 1 MFLRYFLDENQQRVYTLKRTAPSGEQTLTAHPARFSPEDKNSKYRIIIKKRFGLLPTQK 59
>Q6FNL3:NOP10_CANGA H/ACA ribonucleoprotein complex subunit 3 - Candida glabrata| (Yeast) (Torulopsis glabrata) Length = 57 Score = 72.4 bits (176), Expect = 8e-13 Identities = 34/56 (60%), Positives = 43/56 (76%) Frame = +2 Query: 86 MYLQYYINEKGIKVYTTKKESPLGVPTQSAHPARFSPDDKYARQRYLLKKRFGLLP 253 M+L Y ++ +G +VYT KK + G T+SAHPARFSPDDKY+RQR LKKR+ LLP Sbjct: 1 MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
>Q74Z52:NOP10_ASHGO H/ACA ribonucleoprotein complex subunit 3 - Ashbya gossypii (Yeast)| (Eremothecium gossypii) Length = 57 Score = 71.6 bits (174), Expect = 1e-12 Identities = 33/56 (58%), Positives = 42/56 (75%) Frame = +2 Query: 86 MYLQYYINEKGIKVYTTKKESPLGVPTQSAHPARFSPDDKYARQRYLLKKRFGLLP 253 M+L Y + G +VYT +K +P G T+SAHPARFSPDDKY+RQR LK+RF +LP Sbjct: 1 MHLMYTLGPDGKRVYTLEKVTPSGEITKSAHPARFSPDDKYSRQRVTLKRRFDMLP 56
>Q6CSZ0:NOP10_KLULA H/ACA ribonucleoprotein complex subunit 3 - Kluyveromyces lactis| (Yeast) (Candida sphaerica) Length = 57 Score = 68.9 bits (167), Expect = 8e-12 Identities = 32/56 (57%), Positives = 42/56 (75%) Frame = +2 Query: 86 MYLQYYINEKGIKVYTTKKESPLGVPTQSAHPARFSPDDKYARQRYLLKKRFGLLP 253 M+L Y ++ +G ++YT KK + T+SAHPARFSPDDKY+RQR LKKR+ LLP Sbjct: 1 MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56
>Q6JZK2:NOLA3_TRYCR H/ACA ribonucleoprotein complex subunit 3-like protein -| Trypanosoma cruzi Length = 63 Score = 65.5 bits (158), Expect = 9e-11 Identities = 33/59 (55%), Positives = 41/59 (69%) Frame = +2 Query: 86 MYLQYYINEKGIKVYTTKKESPLGVPTQSAHPARFSPDDKYARQRYLLKKRFGLLPTQQ 262 M+LQ YI G + YT KK P G PT SAHPARFSPDDKY+R R +K+RF L +++ Sbjct: 1 MHLQVYI-VNGKRQYTLKKMDPEGKPTLSAHPARFSPDDKYSRHRITIKRRFKALKSEK 58
>Q973G1:NOP10_SULTO Ribosome biogenesis protein Nop10 - Sulfolobus tokodaii| Length = 56 Score = 39.3 bits (90), Expect = 0.007 Identities = 20/37 (54%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +2 Query: 128 YTTKKESPL-GVPTQSAHPARFSPDDKYARQRYLLKK 235 YT K P+ G PT HPARFSP DKY + R +KK Sbjct: 14 YTLKDICPICGTPTIIPHPARFSPVDKYVKYRIEIKK 50
>Q8ZTY6:NOP10_PYRAE Ribosome biogenesis protein Nop10 - Pyrobaculum aerophilum| Length = 72 Score = 36.6 bits (83), Expect = 0.047 Identities = 24/63 (38%), Positives = 31/63 (49%), Gaps = 2/63 (3%) Frame = +2 Query: 128 YTTKKES--PLGVPTQSAHPARFSPDDKYARQRYLLKKRFGLLPTQQPAQKY*STEWVLL 301 YT K+ G + HP +FSP+DKY + R L K G LP + T+ LL Sbjct: 14 YTLSKDKCPRCGGAVRVPHPPKFSPEDKYQKYRILQKLLMGKLPIRD------ETKERLL 67 Query: 302 RDL 310 RDL Sbjct: 68 RDL 70
>Q9V0E3:NOP10_PYRAB Ribosome biogenesis protein Nop10 - Pyrococcus abyssi| Length = 60 Score = 36.6 bits (83), Expect = 0.047 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +2 Query: 128 YTTKKESPL-GVPTQSAHPARFSPDDKYARQRYLLKK 235 YT K+ P+ G T+ AHP RFSP+D Y R LK+ Sbjct: 14 YTLKETCPVCGEKTKVAHPPRFSPEDPYGEYRRRLKR 50
>Q5JE48:NOP10_PYRKO Ribosome biogenesis protein Nop10 - Pyrococcus kodakaraensis| (Thermococcus kodakaraensis) Length = 59 Score = 36.2 bits (82), Expect = 0.061 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +2 Query: 128 YTTKKESPL-GVPTQSAHPARFSPDDKYARQRYLLKK 235 YT K+ P+ G T+ AHP RFSP+D Y R LK+ Sbjct: 14 YTLKEVCPVCGSETKVAHPPRFSPEDPYGEYRRRLKR 50
>Q97Z78:NOP10_SULSO Ribosome biogenesis protein Nop10 - Sulfolobus solfataricus| Length = 56 Score = 35.8 bits (81), Expect = 0.080 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +2 Query: 125 VYTTKKESPL-GVPTQSAHPARFSPDDKYARQRYLLKK 235 +YT K + G T HP+RFSP+DKY + R LKK Sbjct: 13 IYTFKDTCQICGSKTVIPHPSRFSPEDKYVKYRIELKK 50
>Q8U1R4:NOP10_PYRFU Ribosome biogenesis protein Nop10 - Pyrococcus furiosus| Length = 60 Score = 33.9 bits (76), Expect = 0.30 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +2 Query: 128 YTTKKESPL-GVPTQSAHPARFSPDDKYARQRYLLKK 235 YT K+ P+ G T+ AHP RFSP+D Y R K+ Sbjct: 14 YTLKEVCPVCGEKTKVAHPPRFSPEDPYGEYRRRWKR 50
>Q8TT00:NOP10_METAC Ribosome biogenesis protein Nop10 - Methanosarcina acetivorans| Length = 51 Score = 33.9 bits (76), Expect = 0.30 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +2 Query: 128 YTTKKESPL-GVPTQSAHPARFSPDDKYARQRYLLKK 235 YT +++ P+ G T A PARFSP D Y + R L KK Sbjct: 14 YTLREKCPVCGGVTLPAIPARFSPQDPYGKYRRLAKK 50
>Q8TY85:NOP10_METKA Ribosome biogenesis protein Nop10 - Methanopyrus kandleri| Length = 66 Score = 31.6 bits (70), Expect = 1.5 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +2 Query: 176 HPARFSPDDKYARQRYLLKKR 238 HP RFSP+D Y + R LKKR Sbjct: 32 HPHRFSPEDPYGKYRRKLKKR 52
>Q6LTX2:PROA_PHOPR Gamma-glutamyl phosphate reductase - Photobacterium profundum| (Photobacterium sp. (strain SS9)) Length = 418 Score = 30.4 bits (67), Expect = 3.3 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 1/65 (1%) Frame = -1 Query: 338 HSKQHSPK*TD-LLGGPIQCFSTFVLAAGLAAIQTSSSTGNADGRTCHPGRNELGGQTAS 162 H ++H+ +D +L IQ FV AAG AA+ ++ST DG G E+ T Sbjct: 333 HMRKHNASHSDAILTNDIQSAERFVNAAGSAAVYVNASTRFTDGAQFGLGA-EVAVSTQK 391 Query: 161 AHREG 147 H G Sbjct: 392 LHARG 396
>O27362:NOP10_METTH Ribosome biogenesis protein Nop10 - Methanobacterium| thermoautotrophicum Length = 59 Score = 30.0 bits (66), Expect = 4.4 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 128 YTTKKESP-LGVPTQSAHPARFSPDDKYARQRYLLKK 235 YT K+ P G T +P +FSP+DKY R LK+ Sbjct: 12 YTLKEVCPHCGGRTGVIYPPKFSPEDKYGAYRRKLKR 48
>Q9BY78:RNF26_HUMAN RING finger protein 26 - Homo sapiens (Human)| Length = 433 Score = 29.6 bits (65), Expect = 5.7 Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = +2 Query: 302 RDLFTLVNAVW-SVD*PCEERT-ITATYLAHYCSTSECNAMILW 427 ++LF+LV A+W +V P T + A +LAH S++ A++LW Sbjct: 160 QNLFSLVLALWDAVTGPLWRMTDVVAAFLAHISSSAVAMAILLW 203
>Q5UX23:NOP10_HALMA Ribosome biogenesis protein Nop10 - Haloarcula marismortui| (Halobacterium marismortui) Length = 60 Score = 29.6 bits (65), Expect = 5.7 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +2 Query: 125 VYTTKKESP-LGVPTQSAHPARFSPDDKYARQRYLLKKR 238 VYT P G ++ PA FSP+D Y R LK+R Sbjct: 19 VYTLDDTCPECGAEAVNSAPAPFSPEDSYGEYRRSLKRR 57
>O29724:NOP10_ARCFU Ribosome biogenesis protein Nop10 - Archaeoglobus fulgidus| Length = 59 Score = 29.6 bits (65), Expect = 5.7 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +2 Query: 128 YTTKKESPL-GVPTQSAHPARFSPDDKYARQRYLLKKRFG 244 YT K+ P+ G T P RFS +D Y + R L+K G Sbjct: 14 YTLKERCPVCGERTHMPIPPRFSIEDPYGKYRRKLRKEIG 53
>O80594:ERG28_ARATH Ergosterol biosynthetic protein 28 - Arabidopsis thaliana| (Mouse-ear cress) Length = 129 Score = 29.3 bits (64), Expect = 7.4 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 Query: 422 LWIVLLCTMCSLCDFHLGSK 481 +W +L CT+C LC F+L +K Sbjct: 49 VWTLLTCTLCFLCAFNLENK 68 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 85,276,117 Number of extensions: 1854122 Number of successful extensions: 4114 Number of sequences better than 10.0: 27 Number of HSP's gapped: 4112 Number of HSP's successfully gapped: 27 Length of query: 165 Length of database: 100,686,439 Length adjustment: 105 Effective length of query: 60 Effective length of database: 71,885,464 Effective search space: 4313127840 Effective search space used: 4313127840 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
