ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf48j15 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os11g24070:12011.t02028:unspliced-genomic nonspecific lipid-transfer protein 1 precursor, putative, expressed| Length = 1125 Score = 76.2 bits (160), Expect(2) = 3e-22 Identities = 27/54 (50%), Positives = 40/54 (74%) Frame = +2 / +2 Query: 215 ISCGQVSSALRPCISYASGNGGILPPACCSGVKRLAGAAQSTADKQAVCKCIKS 376 I+CGQV+SA+ PC++YA G G ACC+GV+ L AA++TAD++ C C+K+ Sbjct: 200 ITCGQVNSAVGPCLTYARGGGAGPSAACCNGVRSLKSAARTTADRRTACNCLKN 361 Score = 49.2 bits (101), Expect(2) = 3e-22 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = +1 / +1 Query: 391 KRWQGRRHPLQVRRQRPLLHQHFRRLL* 474 +R Q R+HPLQVRRQRPL HQ F RLL* Sbjct: 385 QRRQRRQHPLQVRRQRPLHHQRFHRLL* 468 Score = 45.5 bits (93), Expect(3) = 2e-16 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = -1 / -1 Query: 345 SAVLCAAPANLLTPLQQAGGRMPPLPLA*EMQGRKAELT*PQEM 214 SAV+ AA LLTPLQQA P P A* QG AE T PQ M Sbjct: 330 SAVVLAADLRLLTPLQQAAEGPAPPPRA*VRQGPTAEFTWPQVM 199 Score = 41.8 bits (85), Expect(3) = 2e-16 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 / -1 Query: 474 LEQSTEVLME*GTLTPHLEGM 412 LEQS E LM *GTLTPHLEGM Sbjct: 468 LEQSMEALMV*GTLTPHLEGM 406 Score = 35.4 bits (71), Expect(3) = 2e-16 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -3 / -3 Query: 220 GDGCVGGYEEHSGHHGDQHEL 158 G G V G EE S HHGDQH+L Sbjct: 199 GHGGVRGGEEQSCHHGDQHQL 137 Score = 53.3 bits (110), Expect(2) = 4e-15 Identities = 29/61 (47%), Positives = 35/61 (57%) Frame = +1 / +1 Query: 229 GELCLAPLHFLCQRQRRHPASGLLQRRQEIGRRSAEHR*QASGVQVHQERCRWVKRWQGR 408 GEL PL L R+RR P GLLQRR+E R HR* A +Q+ QER W + Q R Sbjct: 214 GELSRWPLPHLRPRRRRRPFRGLLQRREEPQVRCQNHR*PAHRLQLPQERRPWHQGAQRR 393 Query: 409 R 411 + Sbjct: 394 Q 396 Score = 47.8 bits (98), Expect(2) = 4e-15 Identities = 17/21 (80%), Positives = 20/21 (95%) Frame = +2 / +2 Query: 413 IPSKCGVSVPYSISTSVDCSK 475 IPSKCGVSVPY+IS S+DCS+ Sbjct: 407 IPSKCGVSVPYTISASIDCSR 469
>LOC_Os11g02369:12011.t004355:unspliced-genomic nonspecific lipid-transfer protein 2 precursor, putative, expressed| Length = 929 Score = 46.9 bits (96), Expect(3) = 6e-20 Identities = 16/21 (76%), Positives = 20/21 (95%) Frame = +2 / +1 Query: 413 IPSKCGVSVPYSISTSVDCSK 475 IPSKCGVS+PY+IS S+DCS+ Sbjct: 379 IPSKCGVSIPYTISPSIDCSR 441 Score = 45.1 bits (92), Expect(3) = 6e-20 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = +2 / +1 Query: 293 ACCSGVKRLAGAAQSTADKQAVCKCIKS 376 ACCSGV+ L AA +TAD++ C C+K+ Sbjct: 250 ACCSGVRSLNSAASTTADRRTACNCLKN 333 Score = 42.8 bits (87), Expect(3) = 6e-20 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +2 / +1 Query: 215 ISCGQVSSALRPCISYASGNGGILPPAC 298 ISCGQV+SA+ PC+SYA G G C Sbjct: 175 ISCGQVNSAVSPCLSYARGGSGPSAACC 258 Score = 42.3 bits (86), Expect(2) = 3e-09 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = +1 / +3 Query: 391 KRWQGRRHPLQVRRQRPLLHQHFRRLL 471 +R Q R+HPLQVRRQ PL HQ RLL Sbjct: 357 QRRQCRQHPLQVRRQHPLHHQPLHRLL 437 Score = 38.6 bits (78), Expect(2) = 3e-09 Identities = 21/47 (44%), Positives = 26/47 (55%) Frame = +1 / +3 Query: 271 QRRHPASGLLQRRQEIGRRSAEHR*QASGVQVHQERCRWVKRWQGRR 411 +R P GLLQRRQE R HR +Q+ QER R +R Q R+ Sbjct: 228 RRLRPVGGLLQRRQEPQLRRQHHRRPPHRLQLPQERGRQHQRPQRRQ 368 Score = 37.7 bits (76), Expect(3) = 2e-05 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 / -1 Query: 474 LEQSTEVLME*GTLTPHLEGM 412 LEQS E LM *G LTPHLEGM Sbjct: 440 LEQSMEGLMV*GMLTPHLEGM 378 Score = 29.0 bits (57), Expect(3) = 2e-05 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -1 / -1 Query: 345 SAVLCAAPANLLTPLQQAGGRMPP 274 SAV+ AA LLTPLQQA P Sbjct: 302 SAVVLAAELRLLTPLQQAADGPEP 231 Score = 21.7 bits (41), Expect(3) = 2e-05 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -3 / -3 Query: 196 EEHSGHHGDQHEL 158 E+ H GDQH+L Sbjct: 144 EQSRCHEGDQHQL 106
>LOC_Os12g02310:12012.t00127:unspliced-genomic nonspecific lipid-transfer protein 2 precursor, putative, expressed| Length = 1241 Score = 46.9 bits (96), Expect(3) = 8e-20 Identities = 16/21 (76%), Positives = 20/21 (95%) Frame = +2 / +2 Query: 413 IPSKCGVSVPYSISTSVDCSK 475 IPSKCGVS+PY+IS S+DCS+ Sbjct: 581 IPSKCGVSIPYTISPSIDCSR 643 Score = 44.6 bits (91), Expect(3) = 8e-20 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = +2 / +2 Query: 293 ACCSGVKRLAGAAQSTADKQAVCKCIKS 376 ACCSGV+ L AA +TAD++ C C+K+ Sbjct: 452 ACCSGVRSLNSAATTTADRRTACNCLKN 535 Score = 42.8 bits (87), Expect(3) = 8e-20 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +2 / +2 Query: 215 ISCGQVSSALRPCISYASGNGGILPPAC 298 ISCGQV+SA+ PC+SYA G G C Sbjct: 377 ISCGQVNSAVSPCLSYARGGSGPSAACC 460 Score = 42.3 bits (86), Expect(2) = 4e-09 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = +1 / +1 Query: 391 KRWQGRRHPLQVRRQRPLLHQHFRRLL 471 +R Q R+HPLQVRRQ PL HQ RLL Sbjct: 559 QRRQCRQHPLQVRRQHPLHHQPLHRLL 639 Score = 38.2 bits (77), Expect(2) = 4e-09 Identities = 21/47 (44%), Positives = 26/47 (55%) Frame = +1 / +1 Query: 271 QRRHPASGLLQRRQEIGRRSAEHR*QASGVQVHQERCRWVKRWQGRR 411 +R P GLLQRRQE R HR +Q+ QER R +R Q R+ Sbjct: 430 RRLRPVGGLLQRRQEPQLRRHHHRRPPHRLQLPQERGRQHQRPQRRQ 570 Score = 37.7 bits (76), Expect(3) = 2e-08 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 / -3 Query: 474 LEQSTEVLME*GTLTPHLEGM 412 LEQS E LM *G LTPHLEGM Sbjct: 642 LEQSMEGLMV*GMLTPHLEGM 580 Score = 29.0 bits (57), Expect(3) = 2e-08 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -1 / -3 Query: 345 SAVLCAAPANLLTPLQQAGGRMPP 274 SAV+ AA LLTPLQQA P Sbjct: 504 SAVVVAAELRLLTPLQQAADGPEP 433 Score = 28.1 bits (55), Expect(3) = 2e-08 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -3 / -2 Query: 220 GDGCVGGYEEHSGHHGDQHEL 158 G G V +E S H GDQH+L Sbjct: 373 GHGGVWARQEQSCHEGDQHQL 311
>LOC_Os12g02320:12012.t00128:unspliced-genomic nonspecific lipid-transfer protein 1 precursor, putative, expressed| Length = 1002 Score = 49.2 bits (101), Expect(3) = 8e-20 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = +1 / +3 Query: 376 RCRWVKRWQGRRHPLQVRRQRPLLHQHFRRLL 471 R + +R Q R+HPLQVRRQRPL HQ F RLL Sbjct: 336 RHQGAQRRQRRQHPLQVRRQRPLHHQRFHRLL 431 Score = 45.5 bits (93), Expect(3) = 8e-20 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = +2 / +1 Query: 293 ACCSGVKRLAGAAQSTADKQAVCKCIKS 376 ACCSGV+ L AA +TAD++ C C+K+ Sbjct: 244 ACCSGVRSLKAAASTTADRRTACNCLKN 327 Score = 39.6 bits (80), Expect(3) = 8e-20 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = +2 / +1 Query: 215 ISCGQVSSALRPCISYASGNGGILPPAC 298 I+CGQV+SA+ PC++YA G G C Sbjct: 169 ITCGQVNSAVGPCLTYARGGAGPSAACC 252 Score = 41.8 bits (85), Expect(3) = 1e-10 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 / -2 Query: 474 LEQSTEVLME*GTLTPHLEGM 412 LEQS E LM *GTLTPHLEGM Sbjct: 434 LEQSMEALMV*GTLTPHLEGM 372 Score = 31.8 bits (63), Expect(3) = 1e-10 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -3 / -1 Query: 220 GDGCVGGYEEHSGHHGDQHEL 158 G G V G EE S H GDQH+L Sbjct: 168 GHGGVRGGEEQSCHQGDQHQL 106 Score = 29.0 bits (57), Expect(3) = 1e-10 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -1 / -2 Query: 345 SAVLCAAPANLLTPLQQAGGRMPP 274 SAV+ AA LLTPLQQA P Sbjct: 296 SAVVLAAALRLLTPLQQAADGPAP 225 Score = 47.8 bits (98), Expect(2) = 2e-08 Identities = 17/21 (80%), Positives = 20/21 (95%) Frame = +2 / +1 Query: 413 IPSKCGVSVPYSISTSVDCSK 475 IPSKCGVSVPY+IS S+DCS+ Sbjct: 373 IPSKCGVSVPYTISASIDCSR 435 Score = 30.4 bits (60), Expect(2) = 2e-08 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +1 / +3 Query: 271 QRRHPASGLLQRRQEIGRRSAEHR*QASGVQVHQER 378 +RR GLLQRR+E S R A +Q+ QER Sbjct: 222 RRRRAVGGLLQRREEPQGGSKHDRRPAHRLQLPQER 329
>LOC_Os11g02389:12011.t00131:unspliced-genomic nonspecific lipid-transfer protein 1 precursor, putative, expressed| Length = 913 Score = 47.8 bits (98), Expect(3) = 8e-20 Identities = 17/21 (80%), Positives = 20/21 (95%) Frame = +2 / +1 Query: 413 IPSKCGVSVPYSISTSVDCSK 475 IPSKCGVSVPY+IS S+DCS+ Sbjct: 334 IPSKCGVSVPYTISASIDCSR 396 Score = 46.9 bits (96), Expect(3) = 8e-20 Identities = 16/28 (57%), Positives = 21/28 (75%) Frame = +2 / +1 Query: 293 ACCSGVKRLAGAAQSTADKQAVCKCIKS 376 ACCSGV+ L AA STAD++ C C+K+ Sbjct: 205 ACCSGVRSLKAAASSTADRRTACNCLKN 288 Score = 39.6 bits (80), Expect(3) = 8e-20 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = +2 / +1 Query: 215 ISCGQVSSALRPCISYASGNGGILPPAC 298 I+CGQV+SA+ PC++YA G G C Sbjct: 130 ITCGQVNSAVGPCLTYARGGAGPSAACC 213 Score = 48.7 bits (100), Expect(2) = 6e-13 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = +1 / +3 Query: 271 QRRHPASGLLQRRQEIGRRSAEHR*QASGVQVHQER 378 +RR P GLLQRR+E RS +HR*QA VQ+ QER Sbjct: 183 RRRRPVGGLLQRREEPQGRSQQHR*QAHRVQLPQER 290 Score = 45.1 bits (92), Expect(2) = 6e-13 Identities = 20/32 (62%), Positives = 23/32 (71%) Frame = +1 / +3 Query: 376 RCRWVKRWQGRRHPLQVRRQRPLLHQHFRRLL 471 R + +R Q R+HPL VRRQRPL HQ F RLL Sbjct: 297 RHQGAQRRQRRQHPL*VRRQRPLHHQRFHRLL 392 Score = 41.8 bits (85), Expect(3) = 7e-13 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 / -3 Query: 474 LEQSTEVLME*GTLTPHLEGM 412 LEQS E LM *GTLTPHLEGM Sbjct: 395 LEQSMEALMV*GTLTPHLEGM 333 Score = 36.3 bits (73), Expect(3) = 7e-13 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -1 / -3 Query: 363 LHTACLSAVLCAAPANLLTPLQQAGGRMPP 274 LH LSAVL AA LLTPLQQA P Sbjct: 275 LHAVRLSAVLLAAALRLLTPLQQAADGPAP 186 Score = 32.2 bits (64), Expect(3) = 7e-13 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 / -2 Query: 220 GDGCVGGYEEHSGHHGDQHEL 158 G G V G EE S H+GDQH+L Sbjct: 129 GHGGVRGGEEQSCHNGDQHQL 67
>LOC_Os12g02330:12012.t00129:unspliced-genomic nonspecific lipid-transfer protein precursor, putative, expressed| Length = 1146 Score = 49.6 bits (102), Expect(3) = 2e-19 Identities = 18/33 (54%), Positives = 25/33 (75%) Frame = +2 / +3 Query: 278 GILPPACCSGVKRLAGAAQSTADKQAVCKCIKS 376 G L CC+GVK L AA++TAD+QA C+C+K+ Sbjct: 231 GGLTQGCCNGVKGLNNAARTTADRQAACRCLKT 329 Score = 46.4 bits (95), Expect(3) = 2e-19 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = +2 / +3 Query: 215 ISCGQVSSALRPCISYASGNGGILPPAC 298 I+CGQV SA+ PCISY +G GG+ C Sbjct: 171 ITCGQVGSAIAPCISYVTGRGGLTQGCC 254 Score = 37.3 bits (75), Expect(3) = 2e-19 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +2 / +3 Query: 413 IPSKCGVSVPYSISTSVDCSK 475 IP KCGV+V + IS S DCSK Sbjct: 375 IPGKCGVNVGFPISLSTDCSK 437 Score = 28.6 bits (56), Expect(3) = 9e-04 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 / -3 Query: 474 LEQSTEVLME*GTLTPHLEGM 412 L QS E LM TLTPHL GM Sbjct: 436 LLQSVERLMGKPTLTPHLPGM 374 Score = 25.8 bits (50), Expect(3) = 9e-04 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 / -3 Query: 279 PPLPLA*EMQGRKAELT*P 223 PPLP+ *EM G A+ T P Sbjct: 235 PPLPVT*EMHGAIADPTCP 179 Score = 24.0 bits (46), Expect(3) = 9e-04 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 / -3 Query: 366 HLHTACLSAVLCAAPANLLTPLQQAGGRMP 277 H A SAV+ AA + LTPLQ R P Sbjct: 319 HRQAAWRSAVVRAALFSPLTPLQHPWVRPP 230 Score = 32.2 bits (64), Expect = 4.1 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = +1 / +2 Query: 406 RRHPLQVRRQRPLLHQ 453 RRHP QVRRQR L HQ Sbjct: 368 RRHPRQVRRQRRLPHQ 415
>LOC_Os11g02400:12011.t00134:unspliced-genomic nonspecific lipid-transfer protein precursor, putative, expressed| Length = 1143 Score = 49.6 bits (102), Expect(3) = 2e-19 Identities = 18/33 (54%), Positives = 25/33 (75%) Frame = +2 / +1 Query: 278 GILPPACCSGVKRLAGAAQSTADKQAVCKCIKS 376 G L CC+GVK L AA++TAD+QA C+C+K+ Sbjct: 274 GGLTQGCCNGVKGLNNAARTTADRQAACRCLKT 372 Score = 46.4 bits (95), Expect(3) = 2e-19 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = +2 / +1 Query: 215 ISCGQVSSALRPCISYASGNGGILPPAC 298 I+CGQV SA+ PCISY +G GG+ C Sbjct: 214 ITCGQVGSAIAPCISYVTGRGGLTQGCC 297 Score = 37.3 bits (75), Expect(3) = 2e-19 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +2 / +1 Query: 413 IPSKCGVSVPYSISTSVDCSK 475 IP KCGV+V + IS S DCSK Sbjct: 418 IPGKCGVNVGFPISLSTDCSK 480 Score = 28.6 bits (56), Expect(2) = 0.54 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 / -2 Query: 474 LEQSTEVLME*GTLTPHLEGM 412 L QS E LM TLTPHL GM Sbjct: 479 LLQSVERLMGKPTLTPHLPGM 417 Score = 24.0 bits (46), Expect(2) = 0.54 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 / -2 Query: 366 HLHTACLSAVLCAAPANLLTPLQQAGGRMP 277 H A SAV+ AA + LTPLQ R P Sbjct: 362 HRQAAWRSAVVRAALFSPLTPLQHPWVRPP 273 Score = 32.2 bits (64), Expect = 4.1 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = +1 / +3 Query: 406 RRHPLQVRRQRPLLHQ 453 RRHP QVRRQR L HQ Sbjct: 411 RRHPRQVRRQRRLPHQ 458
>LOC_Os11g02350:12011.t00129:unspliced-genomic nonspecific lipid-transfer protein 4 precursor, putative, expressed| Length = 1016 Score = 70.3 bits (147), Expect(2) = 2e-19 Identities = 24/54 (44%), Positives = 36/54 (66%) Frame = +2 / +2 Query: 215 ISCGQVSSALRPCISYASGNGGILPPACCSGVKRLAGAAQSTADKQAVCKCIKS 376 +SCG V+S++ PC+SY G +CCSGV+ L G A S+AD++ C C+K+ Sbjct: 344 VSCGDVTSSIAPCLSYVMGRESSPSSSCCSGVRTLNGKASSSADRRTACSCLKN 505 Score = 45.5 bits (93), Expect(2) = 2e-19 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +2 / +2 Query: 413 IPSKCGVSVPYSISTSVDCSK 475 IPSKCGVSV + ISTSVDCSK Sbjct: 551 IPSKCGVSVAFPISTSVDCSK 613 Score = 34.5 bits (69), Expect(2) = 0.004 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 / -3 Query: 474 LEQSTEVLME*GTLTPHLEGM 412 LEQSTEVLM T TPHL GM Sbjct: 612 LEQSTEVLMGKATETPHLLGM 550 Score = 25.4 bits (49), Expect(2) = 0.004 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -1 / -3 Query: 330 AAPANLLTPLQQAGGRMPPLPLA*EMQGRKAELT*PQ 220 A P +LTPLQ LP+ + G ++T PQ Sbjct: 459 ALPLRVLTPLQHDDDGELSLPITYDRHGAIDDVTSPQ 349 Score = 37.7 bits (76), Expect = 0.092 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = +1 / +1 Query: 400 QGRRHPLQVRRQRPLLHQHFRRLL 471 Q R HP Q+RR R L HQH RRLL Sbjct: 538 QRRLHPQQMRRLRRLPHQHLRRLL 609
>LOC_Os12g02300:12012.t00126:unspliced-genomic nonspecific lipid-transfer protein 4 precursor, putative, expressed| Length = 901 Score = 70.3 bits (147), Expect(2) = 2e-19 Identities = 24/54 (44%), Positives = 36/54 (66%) Frame = +2 / +3 Query: 215 ISCGQVSSALRPCISYASGNGGILPPACCSGVKRLAGAAQSTADKQAVCKCIKS 376 +SCG V+S++ PC+SY G +CCSGV+ L G A S+AD++ C C+K+ Sbjct: 180 VSCGDVTSSIAPCLSYVMGRESSPSSSCCSGVRTLNGKASSSADRRTACSCLKN 341 Score = 45.5 bits (93), Expect(2) = 2e-19 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +2 / +3 Query: 413 IPSKCGVSVPYSISTSVDCSK 475 IPSKCGVSV + ISTSVDCSK Sbjct: 387 IPSKCGVSVAFPISTSVDCSK 449 Score = 34.5 bits (69), Expect(2) = 0.004 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 / -1 Query: 474 LEQSTEVLME*GTLTPHLEGM 412 LEQSTEVLM T TPHL GM Sbjct: 448 LEQSTEVLMGKATETPHLLGM 386 Score = 25.4 bits (49), Expect(2) = 0.004 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -1 / -1 Query: 330 AAPANLLTPLQQAGGRMPPLPLA*EMQGRKAELT*PQ 220 A P +LTPLQ LP+ + G ++T PQ Sbjct: 295 ALPLRVLTPLQHDDDGELSLPITYDRHGAIDDVTSPQ 185 Score = 34.1 bits (68), Expect = 1.2 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = +1 / +2 Query: 400 QGRRHPLQVRRQRPLLHQHFRRLL 471 Q R HP Q+ R R L HQH RRLL Sbjct: 374 QRRLHPQQMWRLRRLPHQHLRRLL 445
>LOC_Os11g02330:12011.t00127:unspliced-genomic expressed protein| Length = 876 Score = 68.9 bits (144), Expect(2) = 6e-19 Identities = 26/53 (49%), Positives = 33/53 (62%) Frame = +2 / +1 Query: 215 ISCGQVSSALRPCISYASGNGGILPPACCSGVKRLAGAAQSTADKQAVCKCIK 373 ++CGQV S L PCI YA+G CC GV+ L AA +TAD+Q C C+K Sbjct: 169 VTCGQVVSMLAPCIMYATGRVSAPTGGCCDGVRTLNSAAATTADRQTTCACLK 327 Score = 45.1 bits (92), Expect(2) = 6e-19 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = +1 / +3 Query: 406 RRHPLQVRRQRPLLHQHFRRLL 471 RRHPLQVRRQ PL HQ F RLL Sbjct: 369 RRHPLQVRRQHPLRHQPFHRLL 434 Score = 35.0 bits (70), Expect(2) = 4e-04 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -1 / -2 Query: 474 LEQSTEVLME*GTLTPHLEGM 412 LEQS E LM *G LT HLEGM Sbjct: 437 LEQSVEGLMA*GMLTSHLEGM 375 Score = 28.6 bits (56), Expect(2) = 4e-04 Identities = 17/41 (41%), Positives = 20/41 (48%) Frame = -1 / -2 Query: 345 SAVLCAAPANLLTPLQQAGGRMPPLPLA*EMQGRKAELT*P 223 SAV+ AA +LTP QQ LP+A M G T P Sbjct: 299 SAVVAAAELRVLTPSQQPPVGADTLPVAYMMHGASMLTTCP 177 Score = 40.9 bits (83), Expect = 0.010 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = +2 / +1 Query: 413 IPSKCGVSVPYSISTSVDCSK 475 IPSKC V++PY+IS S DCS+ Sbjct: 376 IPSKCDVNIPYAISPSTDCSR 438
>LOC_Os12g02290:12012.t00125:unspliced-genomic nonspecific lipid-transfer protein 5 precursor, putative, expressed| Length = 1118 Score = 68.9 bits (144), Expect(2) = 1e-18 Identities = 26/53 (49%), Positives = 33/53 (62%) Frame = +2 / +3 Query: 215 ISCGQVSSALRPCISYASGNGGILPPACCSGVKRLAGAAQSTADKQAVCKCIK 373 ++CGQV S L PCI YA+G CC GV+ L AA +TAD+Q C C+K Sbjct: 330 VTCGQVVSMLAPCIMYATGRVSAPTGGCCDGVRTLNSAAATTADRQTTCACLK 488 Score = 44.1 bits (90), Expect(2) = 1e-18 Identities = 15/21 (71%), Positives = 19/21 (90%) Frame = +2 / +3 Query: 413 IPSKCGVSVPYSISTSVDCSK 475 IPSKCGV++PY+IS S DCS+ Sbjct: 537 IPSKCGVNIPYAISPSTDCSR 599 Score = 36.8 bits (74), Expect(2) = 1e-04 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -1 / -2 Query: 474 LEQSTEVLME*GTLTPHLEGM 412 LEQS E L+ *G LTPHLEGM Sbjct: 598 LEQSVEGLIA*GMLTPHLEGM 536 Score = 28.6 bits (56), Expect(2) = 1e-04 Identities = 17/41 (41%), Positives = 20/41 (48%) Frame = -1 / -2 Query: 345 SAVLCAAPANLLTPLQQAGGRMPPLPLA*EMQGRKAELT*P 223 SAV+ AA +LTP QQ LP+A M G T P Sbjct: 460 SAVVAAAELRVLTPSQQPPVGADTLPVAYMMHGASMLTTCP 338 Score = 42.3 bits (86), Expect = 0.004 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = +1 / +2 Query: 406 RRHPLQVRRQRPLLHQHFRRLL 471 RRHPLQVRRQ PL +Q F RLL Sbjct: 530 RRHPLQVRRQHPLRYQPFHRLL 595
>LOC_Os11g02424:12011.t00136:unspliced-genomic expressed protein| Length = 4044 Score = 50.1 bits (103), Expect(3) = 2e-18 Identities = 18/31 (58%), Positives = 24/31 (77%) Frame = +2 / +1 Query: 284 LPPACCSGVKRLAGAAQSTADKQAVCKCIKS 376 L CC+GVK L AA++TAD+QA C+C+KS Sbjct: 280 LTQGCCNGVKGLNNAARTTADRQAACRCLKS 372 Score = 43.7 bits (89), Expect(3) = 2e-18 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +2 / +1 Query: 215 ISCGQVSSALRPCISYASGNGGILPPAC 298 I+CGQV SA+ PCISY +G G+ C Sbjct: 214 ITCGQVGSAIAPCISYVTGRSGLTQGCC 297 Score = 35.4 bits (71), Expect(3) = 2e-18 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 / +1 Query: 413 IPSKCGVSVPYSISTSVDCSK 475 +P KCGV+V + IS S DC+K Sbjct: 418 VPGKCGVNVGFPISLSTDCNK 480 Score = 31.8 bits (63), Expect = 5.7 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +1 / +3 Query: 406 RRHPLQVRRQRPLLHQHFRRL 468 RR P QVRRQR L HQ RL Sbjct: 411 RRRPRQVRRQRRLPHQPLHRL 473
>LOC_Os12g02340:12012.t00130:unspliced-genomic nonspecific lipid-transfer protein 3 precursor, putative, expressed| Length = 1609 Score = 50.1 bits (103), Expect(3) = 2e-18 Identities = 18/31 (58%), Positives = 24/31 (77%) Frame = +2 / +1 Query: 284 LPPACCSGVKRLAGAAQSTADKQAVCKCIKS 376 L CC+GVK L AA++TAD+QA C+C+KS Sbjct: 265 LTQGCCNGVKGLNNAARTTADRQAACRCLKS 357 Score = 43.7 bits (89), Expect(3) = 2e-18 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +2 / +1 Query: 215 ISCGQVSSALRPCISYASGNGGILPPAC 298 I+CGQV SA+ PCISY +G G+ C Sbjct: 199 ITCGQVGSAIAPCISYVTGRSGLTQGCC 282 Score = 35.4 bits (71), Expect(3) = 2e-18 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 / +1 Query: 413 IPSKCGVSVPYSISTSVDCSK 475 +P KCGV+V + IS S DC+K Sbjct: 403 VPGKCGVNVGFPISLSTDCNK 465
>LOC_Os06g34840:12006.t03181:unspliced-genomic nonspecific lipid-transfer protein 3 precursor, putative| Length = 3184 Score = 57.0 bits (118), Expect(2) = 1e-12 Identities = 20/54 (37%), Positives = 31/54 (57%) Frame = +2 / +1 Query: 215 ISCGQVSSALRPCISYASGNGGILPPACCSGVKRLAGAAQSTADKQAVCKCIKS 376 +SC V + + PC+ + G+ CC G+ L AA +T D+QA C+C+KS Sbjct: 97 VSCSDVVADVTPCLGFLQGDDDHPSGECCDGLSGLVAAAATTEDRQAACECLKS 258 Score = 35.9 bits (72), Expect(2) = 1e-12 Identities = 11/21 (52%), Positives = 17/21 (80%) Frame = +2 / +1 Query: 413 IPSKCGVSVPYSISTSVDCSK 475 +P+ CG+S+PY+ S VDCS+ Sbjct: 307 LPADCGLSLPYTFSPDVDCSQ 369
>LOC_Os01g60740:12001.t05455:unspliced-genomic nonspecific lipid-transfer protein precursor, putative, expressed| Length = 1058 Score = 48.7 bits (100), Expect(2) = 1e-11 Identities = 15/34 (44%), Positives = 24/34 (70%) Frame = +2 / +1 Query: 275 GGILPPACCSGVKRLAGAAQSTADKQAVCKCIKS 376 GG +P ACC G++ L AA +T D++ +C C+K+ Sbjct: 244 GGTVPRACCGGIQSLLAAANNTPDRRTICGCLKN 345 Score = 40.5 bits (82), Expect(2) = 1e-11 Identities = 14/20 (70%), Positives = 18/20 (90%) Frame = +2 / +1 Query: 413 IPSKCGVSVPYSISTSVDCS 472 +PSKC VS+PY ISTSV+C+ Sbjct: 394 LPSKCNVSLPYKISTSVNCN 453
>LOC_Os05g40010:12005.t03541:unspliced-genomic nonspecific lipid-transfer protein precursor, putative, expressed| Length = 1666 Score = 52.8 bits (109), Expect(2) = 2e-11 Identities = 16/35 (45%), Positives = 27/35 (77%) Frame = +2 / +3 Query: 272 NGGILPPACCSGVKRLAGAAQSTADKQAVCKCIKS 376 +GG +P ACC G++ + AA++TAD++A C C+K+ Sbjct: 240 SGGAVPAACCGGIRSVVAAARTTADRRAACTCLKN 344 Score = 35.4 bits (71), Expect(2) = 2e-11 Identities = 11/20 (55%), Positives = 17/20 (85%) Frame = +2 / +3 Query: 413 IPSKCGVSVPYSISTSVDCS 472 +P +CGVSVP+ IS +V+C+ Sbjct: 393 LPGRCGVSVPFKISPNVNCN 452
>LOC_Os08g03690:12008.t00264:unspliced-genomic nonspecific lipid-transfer protein 1 precursor, putative, expressed| Length = 1163 Score = 56.1 bits (116), Expect(2) = 7e-10 Identities = 18/53 (33%), Positives = 31/53 (58%) Frame = +2 / +1 Query: 215 ISCGQVSSALRPCISYASGNGGILPPACCSGVKRLAGAAQSTADKQAVCKCIK 373 ++CG V ++L PC++Y +G CC+GV+ L TA+++ C C+K Sbjct: 130 VTCGDVDASLLPCVAYLTGKAAAPSGDCCAGVRHLRTLPVGTAERRFACDCVK 288 Score = 27.2 bits (53), Expect(2) = 7e-10 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +2 / +1 Query: 413 IPSKCGVSVPYSISTSVDCS 472 +P+KC +P+ +S DC+ Sbjct: 337 LPAKCAAPLPFPLSLDFDCN 396
>LOC_Os01g12020:12001.t01071:unspliced-genomic nonspecific lipid-transfer protein precursor, putative, expressed| Length = 2072 Score = 34.5 bits (69), Expect(3) = 3e-08 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 / +2 Query: 215 ISCGQVSSALRPCISYASGNGGILPPACC 301 + CGQV + PC+ Y +G G+ P C Sbjct: 119 VQCGQVMQLMAPCMPYLAGAPGMTPYGIC 205 Score = 30.4 bits (60), Expect(3) = 3e-08 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 / +2 Query: 296 CCSGVKRLAGAAQSTADKQAVCKCIK 373 CC + L A + AD+ AVC C+K Sbjct: 203 CCDSLGVLNRMAPAPADRVAVCNCVK 280 Score = 29.5 bits (58), Expect(3) = 3e-08 Identities = 7/21 (33%), Positives = 18/21 (85%) Frame = +2 / +2 Query: 413 IPSKCGVSVPYSISTSVDCSK 475 +P+ CG+S+ ++I+ ++DC++ Sbjct: 329 LPAACGLSISFTIAPNMDCNQ 391
>LOC_Os03g59380:12003.t05185:unspliced-genomic nonspecific lipid-transfer protein 4 precursor, putative, expressed| Length = 817 Score = 49.6 bits (102), Expect = 2e-05 Identities = 18/53 (33%), Positives = 28/53 (52%) Frame = +2 / +1 Query: 215 ISCGQVSSALRPCISYASGNGGILPPACCSGVKRLAGAAQSTADKQAVCKCIK 373 +SCG SAL PC + G CC G + L G A + ++A+C+C++ Sbjct: 157 VSCGDAVSALAPCGPFLLGGAARPGDRCCGGARALRGMAGTAEARRALCRCLE 315
>LOC_Os02g15760:12002.t01369:unspliced-genomic DNA binding protein, putative| Length = 3219 Score = 36.3 bits (73), Expect(2) = 7e-05 Identities = 23/69 (33%), Positives = 30/69 (43%) Frame = +1 / +3 Query: 265 QRQRRHPASGLLQRRQEIGRRSAEHR*QASGVQVHQERCRWVKRWQGRRHPLQVRRQRPL 444 +R RR P RR E G SG Q H+ + R R+H + RR RPL Sbjct: 1527 RRHRRRPRREGGVRRAEPGAEDGVAPRAGSGAQDHRRSGEPLARDPARQHLHRRRRHRPL 1706 Query: 445 LHQHFRRLL 471 LH + L+ Sbjct: 1707 LHHQGKILI 1733 Score = 34.1 bits (68), Expect(2) = 7e-05 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 2871 HTHTHTHTHTHIYI 2912 Score = 35.0 bits (70), Expect = 0.62 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWLC 562 +++IYMCVCVCV +C Sbjct: 2920 YIYIYMCVCVCVCVC 2876 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 2873 HTHTHTHTHTHIYI 2914 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / -1 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 2922 YIYIYICVCVCVCVC 2878 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 2918 YIYIYVCVCVCVCVC 2874 Score = 32.7 bits (65), Expect = 3.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 / +2 Query: 511 PIAPAIDAETLSTLRIFTQPHTHTHTH 591 PI+ +++ E L+ L HTHTHTH Sbjct: 2789 PISQSLNKEGLNLLASCMHTHTHTHTH 2869 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 + H HTHTHTH + + +HI Sbjct: 2847 HTHTHTHTHTHTHTHTHTHI 2906 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 + H HTHTHTH + + +HI Sbjct: 2849 HTHTHTHTHTHTHTHTHTHI 2908 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTH Y+ Sbjct: 2869 HTHTHTHTHTHTYI 2910 Score = 31.3 bits (62), Expect = 7.8 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 / +1 Query: 560 LHNHTHTHTHIYMNK*SH 613 LH HTHTHTH + + +H Sbjct: 2836 LHAHTHTHTHTHTHTHTH 2889 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 / +2 Query: 560 LHNHTHTHTHIYMNK*SH 613 +H HTHTHTH + + +H Sbjct: 2840 MHTHTHTHTHTHTHTHTH 2893 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 2875 HTHTHTHTHTYIYI 2916
>LOC_Os06g02370:12006.t00130:unspliced-genomic expressed protein| Length = 4497 Score = 35.0 bits (70), Expect(2) = 2e-04 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +1 / +2 Query: 496 LPSFLPIAPAIDAETLSTLRIFTQPHTHTHTH 591 LPS P P S + F PHTHTHTH Sbjct: 35 LPSSSPQNPISFQPFKSAITTFFSPHTHTHTH 130 Score = 29.5 bits (58), Expect(2) = 2e-04 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 / +3 Query: 569 HTHTHTHIYMNK*SHILSPC 628 HTHTHTH ++ +H S C Sbjct: 108 HTHTHTHTHIYTLTHSSSVC 167 Score = 33.1 bits (66), Expect = 2.2 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +2 / +3 Query: 563 HNHTHTHTHIY 595 H HTHTHTHIY Sbjct: 108 HTHTHTHTHIY 140 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = +2 / +2 Query: 563 HNHTHTHTHIYMN 601 H HTHTHTHI+++ Sbjct: 110 HTHTHTHTHIHID 148
>LOC_Os04g32940:12004.t02972:unspliced-genomic Leucine Rich Repeat family protein, expressed| Length = 3758 Score = 45.5 bits (93), Expect(2) = 4e-04 Identities = 18/46 (39%), Positives = 25/46 (54%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYMNK*SHILSPCGRKRERSTYVEPALHGQHSVVS 694 Y H HTHTHTH + + +H C KR S +E +L H V++ Sbjct: 3467 YTHTHTHTHTHTHTHTHTHTHIECLNKRLASLIMETSLLASHLVIA 3604 Score = 22.6 bits (43), Expect(2) = 4e-04 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 / +1 Query: 413 IPSKCGVSVPYSISTSVDCSKIH 481 I +K VSVP SIS + +K+H Sbjct: 1456 IENKLLVSVPRSISKASCLNKLH 1524 Score = 33.1 bits (66), Expect = 2.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYMNK*SH 613 Y H HTHTHTH + + +H Sbjct: 3469 YTHTHTHTHTHTHTHTHTH 3525 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 + H HTHTHTH + + +HI Sbjct: 3473 HTHTHTHTHTHTHTHTHTHI 3532 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 / +3 Query: 560 LHNHTHTHTHIYMNK*SH 613 +H HTHTHTH + + +H Sbjct: 3468 IHTHTHTHTHTHTHTHTH 3521
>LOC_Os02g24720:12002.t02169:unspliced-genomic nonspecific lipid-transfer protein 5 precursor, putative| Length = 1921 Score = 45.1 bits (92), Expect = 6e-04 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = +1 / +3 Query: 406 RRHPLQVRRQRPLLHQHFRRLL 471 RRHPLQVRRQ PL HQ F RLL Sbjct: 150 RRHPLQVRRQHPLRHQPFHRLL 215 Score = 44.1 bits (90), Expect = 0.001 Identities = 15/21 (71%), Positives = 19/21 (90%) Frame = +2 / +1 Query: 413 IPSKCGVSVPYSISTSVDCSK 475 IPSKCGV++PY+IS S DCS+ Sbjct: 157 IPSKCGVNIPYAISPSTDCSR 219 Score = 38.6 bits (78), Expect = 0.049 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 / -3 Query: 474 LEQSTEVLME*GTLTPHLEGM 412 LEQS E LM *G LTPHLEGM Sbjct: 218 LEQSVEGLMA*GMLTPHLEGM 156
>LOC_Os09g32210:12009.t02837:unspliced-genomic pumilio domain-containing protein PPD1, putative, expressed| Length = 7049 Score = 31.3 bits (62), Expect(2) = 0.002 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 / -1 Query: 569 HTHTHTHIYMNK*SHILS 622 HTHTHTHI+ +K + +L+ Sbjct: 533 HTHTHTHIHNHKPTRVLA 480 Score = 29.5 bits (58), Expect(2) = 0.002 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 / -3 Query: 532 AETLSTLRIFTQPHTHTHTH 591 +E L+T Q HTHTHTH Sbjct: 576 SEELAT*SSIAQNHTHTHTH 517
>LOC_Os06g06340:12006.t00520:unspliced-genomic nonspecific lipid-transfer protein precursor, putative| Length = 481 Score = 42.8 bits (87), Expect = 0.003 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +2 / +1 Query: 221 CGQVSSALRPCISYASGNGGILPPACCSGVKRLAGAAQSTADKQAVCKCIKS 376 CG +A C +Y +G + CC + + A + A+++AVC CI S Sbjct: 100 CGLAETAFGECTAYVAGGEPAVSRRCCRALGDIRDLAATAAERRAVCACILS 255
>LOC_Os11g01530:12011.t00052:unspliced-genomic ferritin-1, chloroplast precursor, putative, expressed| Length = 2965 Score = 40.5 bits (82), Expect = 0.014 Identities = 11/17 (64%), Positives = 16/17 (94%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IYMCVCVCV++C Y Sbjct: 1729 YIYIYMCVCVCVYICNY 1779 Score = 32.2 bits (64), Expect = 4.1 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 Y++ HTHTHT+IY+ Sbjct: 1774 YIYTHTHTHTYIYI 1733 Score = 32.2 bits (64), Expect = 4.1 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYM 598 Y+H HTHTH +IY+ Sbjct: 1770 YIHTHTHTHIYIYI 1729 Score = 31.3 bits (62), Expect = 7.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +2 / -3 Query: 560 LHNHTHTHTHIYM 598 LH +THTHTHIY+ Sbjct: 1775 LHIYTHTHTHIYI 1737 Score = 31.3 bits (62), Expect = 7.9 Identities = 8/14 (57%), Positives = 14/14 (100%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCVWL 565 +++IY+CVCVCV++ Sbjct: 1731 YIYIYVCVCVCVYM 1772
>LOC_Os05g32880:12005.t02883:unspliced-genomic response regulator receiver domain containing protein, expressed| Length = 4529 Score = 28.6 bits (56), Expect(2) = 0.033 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 / +3 Query: 572 THTHTHIYMNK*SHILSPC 628 THTHTH + +K ++L+ C Sbjct: 903 THTHTHTHTHKTQYLLNLC 959 Score = 28.1 bits (55), Expect(2) = 0.033 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = +1 / +2 Query: 499 PSFLPIAPAIDAETLSTLRIFTQPHTHTHTH 591 P P + LS + T H HTHTH Sbjct: 824 PLLFTPTPPLSDAPLSHTQTHTHKHNHTHTH 916 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +2 / +2 Query: 563 HNHTHTHTHIY 595 HNHTHTHTH + Sbjct: 896 HNHTHTHTHTH 928
>LOC_Os01g08710:12001.t00749:unspliced-genomic OsWRKY79 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 15620 Score = 39.1 bits (79), Expect = 0.036 Identities = 11/36 (30%), Positives = 23/36 (63%) Frame = -1 / -3 Query: 654 YVLLSLFLPHGDNI*DHLFIYMCVCVCVWLCKYPQR 547 Y+ + +++ + + * H++ CVC+CV +CK+ R Sbjct: 8808 YIYMQIYIHNHTHS*PHIYFSTCVCICVGVCKFALR 8701
>LOC_Os02g36000:12002.t03237:unspliced-genomic conserved hypothetical protein| Length = 704 Score = 38.6 bits (78), Expect = 0.049 Identities = 16/34 (47%), Positives = 21/34 (61%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYMNK*SHILSPCGRKRERSTYV 658 + H HTHTH +IY+ S +L GR R+RS V Sbjct: 227 HTHTHTHTHIYIYIYIRSKMLVDQGRDRDRSVVV 126 Score = 35.0 bits (70), Expect = 0.62 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCVWLC 562 +++IYMCVCVCV +C Sbjct: 186 YIYIYMCVCVCVCVC 230 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 235 HTHTHTHTHTHIYI 194 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 233 HTHTHTHTHTHIYI 192 Score = 33.6 bits (67), Expect = 1.6 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYMNK*SHILSPCGRKRERS 649 + H HTHTHTH Y+ + + R ERS Sbjct: 237 HTHTHTHTHTHTYIYIYIYSIKDACRSGERS 145 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 184 YIYIYICVCVCVCVC 228 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 188 YIYIYVCVCVCVCVC 232 Score = 32.7 bits (65), Expect = 3.0 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -1 / +1 Query: 633 LPHGDNI*DHLFIYMCVCVCVWLC 562 LP +I D ++IY+ +CVCV +C Sbjct: 151 LP*STSIFDRIYIYIYICVCVCVC 222 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 231 HTHTHTHTHTYIYI 190
>LOC_Os01g09590:12001.t00837:unspliced-genomic typical P-type R2R3 Myb protein, putative, expressed| Length = 1341 Score = 38.2 bits (77), Expect = 0.067 Identities = 21/55 (38%), Positives = 27/55 (49%) Frame = +1 / +1 Query: 247 PLHFLCQRQRRHPASGLLQRRQEIGRRSAEHR*QASGVQVHQERCRWVKRWQGRR 411 P R RRH A G L+RR+ GRR + GVQ+ R +RW+ RR Sbjct: 808 PAAAAADRHRRHGAPGSLRRRRRHGRRLDVRLRRVVGVQLVGGHRRRRRRWRRRR 972
>LOC_Os08g44350:12008.t04159:unspliced-genomic histidine-containing phosphotransfer protein 5, putative, expressed| Length = 4953 Score = 27.6 bits (54), Expect(2) = 0.081 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 / -3 Query: 502 SFLPIAPAIDAETLSTLRIFTQPHTHTHTH 591 + LP++ TLS HTHTHTH Sbjct: 874 ALLPLS*CTYESTLSKSTFGFSLHTHTHTH 785 Score = 27.6 bits (54), Expect(2) = 0.081 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +2 / -2 Query: 569 HTHTHTHIYMNK*SHILSPCGRKRERSTYVEP 664 HTHTHTH + + +H + + T ++P Sbjct: 803 HTHTHTHTHTHTHTHTHTHTRSNQISQTKIKP 708 Score = 32.7 bits (65), Expect = 3.0 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYMNK*SHILSPCGRKRERST 652 + H HTHTHTH + + + I SP + + T Sbjct: 793 HTHTHTHTHTHTHTHTHAAIKSPKPKSSQSPT 698 Score = 32.2 bits (64), Expect = 4.1 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 / -3 Query: 560 LHNHTHTHTHIYMNK*SH 613 LH HTHTHTH + + +H Sbjct: 808 LHTHTHTHTHTHTHTHTH 755 Score = 31.3 bits (62), Expect = 7.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYMNK*SHILS 622 + H HTHTHTH + + +H S Sbjct: 803 HTHTHTHTHTHTHTHTHTHTRS 738
>LOC_Os09g30210:12009.t02699:unspliced-genomic expressed protein| Length = 4214 Score = 29.9 bits (59), Expect(2) = 0.082 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +1 / -2 Query: 376 RCRWVKRWQGRRHPLQVRRQRPLLHQHFRRLL*DSLIDHLL 498 RCR + +G R PL+ RR+R L+H R + HLL Sbjct: 397 RCRRLPLRRGHRVPLRCRRRRILVHHRGDRAPLRCMRRHLL 275 Score = 25.4 bits (49), Expect(2) = 0.082 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 / -2 Query: 554 GYLHNHTHTHTHIYMNK*SHILSPCGRKRER 646 G+ H H H H+++ + +L+ C +R R Sbjct: 217 GHDRPHHHLHLHLHLLQRRLLLTLCHHRRSR 125
>LOC_Os08g26710:12008.t02435:unspliced-genomic expressed protein| Length = 11854 Score = 37.7 bits (76), Expect = 0.092 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYM 598 Y+H HTHTHTHIY+ Sbjct: 4953 YIHTHTHTHTHIYI 4912 Score = 36.8 bits (74), Expect = 0.17 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IYMCVCVCV +C Y Sbjct: 4904 YIYIYMCVCVCVCVCIY 4954 Score = 36.3 bits (73), Expect = 0.24 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 Y H HTHTHTHIY+ Sbjct: 4951 YTHTHTHTHTHIYI 4910 Score = 35.4 bits (71), Expect = 0.45 Identities = 10/17 (58%), Positives = 15/17 (88%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+CVCVCV +C Y Sbjct: 4902 YIYIYICVCVCVCVCVY 4952 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYM 598 Y H HTHTHT+IY+ Sbjct: 4949 YTHTHTHTHTYIYI 4908 Score = 33.1 bits (66), Expect = 2.2 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 Y H HTHTHTH +++ ++I Sbjct: 5135 YTHTHTHTHTHTHIHTYTYI 5076 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYMNK*SH 613 ++H HT+THTHIY + +H Sbjct: 5171 HIHIHTYTHTHIYTHTHTH 5115 Score = 32.7 bits (65), Expect = 3.0 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIY 595 Y+H HTHTHTH + Sbjct: 5137 YIHTHTHTHTHTH 5099 Score = 32.7 bits (65), Expect = 3.0 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYM 598 Y++ HTHTHTH Y+ Sbjct: 4955 YIYTHTHTHTHTYI 4914 Score = 32.2 bits (64), Expect = 4.1 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYMN 601 + H HTHTHTH Y++ Sbjct: 5131 HTHTHTHTHTHTYIH 5087 Score = 32.2 bits (64), Expect = 4.1 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 + H HTHTHTH Y+ HI Sbjct: 5127 HTHTHTHTHTHTYIYIYIHI 5068 Score = 31.8 bits (63), Expect = 5.7 Identities = 8/15 (53%), Positives = 14/15 (93%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCVWLC 562 ++++Y+CVCVCV +C Sbjct: 5078 YMYMYVCVCVCVCVC 5122 Score = 31.8 bits (63), Expect = 5.7 Identities = 6/14 (42%), Positives = 13/14 (92%) Frame = -1 / +1 Query: 597 IYMCVCVCVWLCKY 556 +Y+C+C+C+++C Y Sbjct: 5149 VYVCICICMYVCMY 5190 Score = 31.3 bits (62), Expect = 7.8 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 / -3 Query: 526 IDAETLSTLRIFTQPHTHTHTH 591 I T + I+T HTHTHTH Sbjct: 5168 IHIHTYTHTHIYTHTHTHTHTH 5103 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIY 595 Y H HTHTHTH + Sbjct: 5133 YTHTHTHTHTHTH 5095 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIY 595 + H HTHTHTHI+ Sbjct: 5129 HTHTHTHTHTHIH 5091 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 5121 HTHTHTHTHTYIYI 5080 Score = 31.3 bits (62), Expect = 7.9 Identities = 7/15 (46%), Positives = 14/15 (93%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLC 562 ++++Y+C+CVCV +C Sbjct: 5074 YIYVYVCMCVCVCVC 5118 Score = 31.3 bits (62), Expect = 7.9 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -1 / +3 Query: 597 IYMCVCVCVWLCKY 556 IYMCVC+CV++ Y Sbjct: 5133 IYMCVCICVYMYMY 5174
>LOC_Os08g01230:12008.t00023:unspliced-genomic hypothetical protein| Length = 1698 Score = 37.7 bits (76), Expect = 0.092 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYMNK*SHILS 622 Y H HTHTHTH +MN+ +L+ Sbjct: 1371 YTHTHTHTHTHTHMNRVCKLLT 1306 Score = 32.7 bits (65), Expect = 3.0 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIY 595 Y+H HTHTHTH + Sbjct: 1373 YIHTHTHTHTHTH 1335 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIY 595 Y H HTHTHTH + Sbjct: 1369 YTHTHTHTHTHTH 1331
>LOC_Os07g03250:12007.t00215:unspliced-genomic protein AINTEGUMENTA, putative, expressed| Length = 4702 Score = 37.7 bits (76), Expect = 0.092 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYMNK*SHILSPC 628 + H HTHTHTH + + +H LS C Sbjct: 923 HTHTHTHTHTHTHTHTHTHTLSQC 852 Score = 34.5 bits (69), Expect = 0.85 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYMNK*SH 613 Y+H HTHTHTH + + +H Sbjct: 959 YIHTHTHTHTHTHTHTHTH 903 Score = 33.6 bits (67), Expect = 1.6 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYMNK*SHILSPC 628 + H HTHTHTH + + I+S C Sbjct: 901 HTHTHTHTHTHTHFHNVQLIISYC 830 Score = 33.1 bits (66), Expect = 2.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYMNK*SH 613 Y H HTHTHTH + + +H Sbjct: 957 YTHTHTHTHTHTHTHTHTH 901 Score = 33.1 bits (66), Expect = 2.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYMNK*SH 613 Y H HTHTHTH + + +H Sbjct: 955 YTHTHTHTHTHTHTHTHTH 899 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYMNK*SH 613 Y++ HTHTHTH + + +H Sbjct: 963 YIYTHTHTHTHTHTHTHTH 907 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYMNK*SH 613 Y++ HTHTHTH + + +H Sbjct: 961 YIYTHTHTHTHTHTHTHTH 905
>LOC_Os03g38490:12003.t03291:unspliced-genomic DAG protein, chloroplast precursor, putative, expressed| Length = 5022 Score = 37.7 bits (76), Expect = 0.092 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYMNK*SHILSP 625 + H HTHTHTH + +K +H SP Sbjct: 1713 HTHTHTHTHTHTHSHKRTHACSP 1645 Score = 33.1 bits (66), Expect = 2.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYMNK*SH 613 + H HTHTHTH + N +H Sbjct: 1709 HTHTHTHTHTHTHTNARTH 1653 Score = 31.8 bits (63), Expect = 5.7 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +2 / -1 Query: 563 HNHTHTHTHIYMNK*SH 613 H HTHTHTH + + SH Sbjct: 1719 HTHTHTHTHTHTHTHSH 1669
>LOC_Os04g58220:12004.t05285:unspliced-genomic arabinose-proton symporter, putative| Length = 2251 Score = 37.7 bits (76), Expect = 0.092 Identities = 18/38 (47%), Positives = 23/38 (60%) Frame = +1 / +1 Query: 391 KRWQGRRHPLQVRRQRPLLHQHFRRLL*DSLIDHLLPS 504 +RW RRHP +VRR+R LL + LL D L D P+ Sbjct: 1849 ERWHRRRHPDRVRRRRVLLRRDRAHLLGDELGDLPAPA 1962
>LOC_Os06g42910:12006.t03981:unspliced-genomic expressed protein| Length = 2110 Score = 32.7 bits (65), Expect(2) = 0.12 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +1 / +3 Query: 385 WVKRWQGRRHPLQVRRQRPLLHQHFRRLL* 474 WV + R H LQ+RR+R H H R+L* Sbjct: 360 WVLHRRRRAHLLQLRRRRSYQHLHLHRVL* 449 Score = 22.1 bits (42), Expect(2) = 0.12 Identities = 8/25 (32%), Positives = 10/25 (40%) Frame = +2 / +1 Query: 296 CCSGVKRLAGAAQSTADKQAVCKCI 370 CC+G G + S C CI Sbjct: 172 CCAGAGSSTGGS*SARAAATCCTCI 246
>LOC_Os03g46150:12003.t03985:unspliced-genomic protease inhibitor/seed storage/LTP family protein, expressed| Length = 961 Score = 37.3 bits (75), Expect = 0.13 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 / +1 Query: 218 SCGQVSSALRPCISYASGNGGILPPACCSGVKRL 319 SC V ++L PC+SY GN ACC ++ + Sbjct: 184 SCPPVQASLSPCVSYFIGNSSTPSDACCEQMRAM 285
>LOC_Os03g42760:12003.t03677:unspliced-genomic ubiquitin-protein ligase/ zinc ion binding protein, putative,| expressed Length = 4018 Score = 37.3 bits (75), Expect = 0.13 Identities = 15/33 (45%), Positives = 23/33 (69%) Frame = +2 / -1 Query: 518 LQLSMLRR*VR*GYLHNHTHTHTHIYMNK*SHI 616 L+ S+ R+*V+ Y H HTHTHTH + + ++I Sbjct: 3886 LRPSLRRK*VKSTY*HTHTHTHTHTHTHTHTYI 3788 Score = 35.0 bits (70), Expect = 0.62 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -1 / +1 Query: 603 LFIYMCVCVCVWLC 562 L+IYMCVCVCV +C Sbjct: 3781 LYIYMCVCVCVCVC 3822 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 3827 HTHTHTHTHTHIYI 3786 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 3825 HTHTHTHTHTHIYI 3784 Score = 32.2 bits (64), Expect = 4.2 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = -1 / +3 Query: 603 LFIYMCVCVCVWLC 562 ++IY+CVCVCV +C Sbjct: 3783 IYIYVCVCVCVCVC 3824 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTH Y+ Sbjct: 3829 HTHTHTHTHTHTYI 3788 Score = 31.3 bits (62), Expect = 7.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 Y+ HTHTHTH + + +HI Sbjct: 3851 YILTHTHTHTHTHTHTHTHI 3792 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 3823 HTHTHTHTHTYIYI 3782 Score = 31.3 bits (62), Expect = 7.9 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -1 / +2 Query: 600 FIYMCVCVCVWLC 562 +IY+CVCVCV +C Sbjct: 3782 YIYICVCVCVCVC 3820
>LOC_Os11g47110:12011.t04186:unspliced-genomic OsWAK121 - OsWAK receptor-like protein kinase| Length = 6253 Score = 37.3 bits (75), Expect = 0.13 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IYMCVCVCV +C Y Sbjct: 1236 YIYIYMCVCVCVCVCVY 1186 Score = 36.3 bits (73), Expect = 0.24 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYM 598 Y H HTHTHTHIY+ Sbjct: 1187 YTHTHTHTHTHIYI 1228 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 1189 HTHTHTHTHTHIYI 1230 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 Y+H HTHTHTH + + ++I Sbjct: 1167 YIHTHTHTHTHTHTHTHTYI 1226 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 1238 YIYIYICVCVCVCVC 1194 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / -1 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 1234 YIYIYVCVCVCVCVC 1190 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTH Y+ Sbjct: 1185 HTHTHTHTHTHTYI 1226 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 1191 HTHTHTHTHTYIYI 1232
>LOC_Os04g01354:12004.t00035:unspliced-genomic chalcone synthase 1, putative, expressed| Length = 4683 Score = 37.3 bits (75), Expect = 0.13 Identities = 9/24 (37%), Positives = 19/24 (79%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCVWLCKYPQRTQRL 535 ++++Y+C+CVC+++C Y R R+ Sbjct: 1979 YIYMYVCMCVCMYVCMYGARVPRI 1908 Score = 32.2 bits (64), Expect = 4.2 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWLCKYPQRTQRLSIDSWS 517 +++IY+C+ VCV++C Y Q + S S Sbjct: 1987 YIYIYICMYVCVYVCMYVCMAQEFLVLSLS 1898
>LOC_Os06g32944:12006.t02991:unspliced-genomic transposon protein, putative, Pong sub-class, expressed| Length = 5400 Score = 36.8 bits (74), Expect = 0.17 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 / -3 Query: 16 VGYYLSSCIPHDPPVQSLSKSSYLIICGLAHHHYYC* 126 + Y L + PP+ ++S +S CGL HHHY C* Sbjct: 2092 IAYILIYLLVLCPPLLTMSTASQS*QCGLLHHHYQC* 1982
>LOC_Os01g40030:12001.t03529:unspliced-genomic hypothetical protein| Length = 2339 Score = 36.8 bits (74), Expect = 0.17 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -1 / -2 Query: 615 I*DHLFIYMCVCVCVWLC 562 I* +++IYMCVCVCV +C Sbjct: 862 I*TYIYIYMCVCVCVCVC 809 Score = 35.9 bits (72), Expect = 0.33 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWLC 562 H++IY+CVCVCV +C Sbjct: 855 HIYIYICVCVCVCVC 811 Score = 34.5 bits (69), Expect = 0.85 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +2 / +3 Query: 560 LHNHTHTHTHIYM 598 +H HTHTHTHIY+ Sbjct: 807 IHTHTHTHTHIYI 845 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 806 HTHTHTHTHTHIYI 847 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYM 598 Y H HTHTHT+IY+ Sbjct: 808 YTHTHTHTHTYIYI 849 Score = 32.7 bits (65), Expect = 3.0 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = -1 / -1 Query: 654 YVLLSLFLPHGDNI*DHLFIYMCVCVCVWLCKYPQRTQRLSIDSW 520 ++ L +F+ N+ +++IY+CVCVCV + + SI W Sbjct: 899 FLALPIFIYMLMNLDIYIYIYVCVCVCVCVYARARLDSLTSI*MW 765
>LOC_Os09g13890:12009.t01178:unspliced-genomic calmodulin binding protein, putative, expressed| Length = 4282 Score = 27.6 bits (54), Expect(2) = 0.20 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 / -1 Query: 541 LSTLRIFTQPHTHTHT 588 ++ + I+ PHTHTHT Sbjct: 433 MNRVHIYPPPHTHTHT 386 Score = 26.3 bits (51), Expect(2) = 0.20 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 / -3 Query: 575 HTHTHIYMNK*SHILSP 625 HTHTHI+ K S I P Sbjct: 401 HTHTHIFHGKPSIITQP 351
>LOC_Os09g27310:12009.t02410:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3216 Score = 30.4 bits (60), Expect(2) = 0.20 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -1 / -1 Query: 591 MCVCVCVWLCKYPQRTQRLSI 529 +CVCVCV +C+ QR+ S+ Sbjct: 645 VCVCVCVCVCERRQRSMASSV 583 Score = 23.5 bits (45), Expect(2) = 0.20 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 / -3 Query: 636 FLPHGDNI*DHLFIYMCVCVCV 571 F HG + + + +CVCVCV Sbjct: 682 FFMHGCDDDIDVCVCVCVCVCV 617 Score = 34.5 bits (69), Expect = 0.85 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +2 / +2 Query: 548 R*GYLHNHTHTHTHIYM 598 R + H HTHTHTHIY+ Sbjct: 608 RRSHTHTHTHTHTHIYI 658 Score = 32.7 bits (65), Expect = 3.0 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIY 595 + H HTHTHTH+Y Sbjct: 619 HTHTHTHTHTHLY 657
>LOC_Os11g13630:12011.t01197:unspliced-genomic gibberellin receptor GID1L2, putative| Length = 1095 Score = 30.4 bits (60), Expect(2) = 0.22 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 / -3 Query: 263 ASGNGGILPPACCSGVKRLAGAAQSTADK 349 ASGN PP+ C G R +GAA A + Sbjct: 937 ASGNPARAPPSPCHGASRSSGAASPGAGR 851 Score = 23.5 bits (45), Expect(2) = 0.22 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +1 / -3 Query: 340 R*QASGVQVHQERCRWVKRWQGRR 411 R +A G + RC +RW RR Sbjct: 754 RRRAGGTRARASRCAGRRRWARRR 683
>LOC_Os08g01320:12008.t00032:unspliced-genomic maternal Effect Lethal family member, putative, expressed| Length = 2478 Score = 36.3 bits (73), Expect = 0.24 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYMN 601 Y H HTHTHT+IY+N Sbjct: 1446 YTHTHTHTHTYIYIN 1402 Score = 35.9 bits (72), Expect = 0.33 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYMNK 604 Y++ HTHTHTHIY+ K Sbjct: 1450 YVYTHTHTHTHIYIYK 1403 Score = 34.5 bits (69), Expect = 0.85 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +2 / -2 Query: 560 LHNHTHTHTHIYM 598 +H HTHTHTHIY+ Sbjct: 1445 IHTHTHTHTHIYI 1407 Score = 32.7 bits (65), Expect = 3.0 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 Y++ HTHTHTH Y+ Sbjct: 1452 YMYTHTHTHTHTYI 1411 Score = 32.7 bits (65), Expect = 3.0 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 / +3 Query: 603 LFIYMCVCVCVWLCKY 556 L+IYMCVCVCV + Y Sbjct: 1404 LYIYMCVCVCVCVYTY 1451 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = -1 / +1 Query: 603 LFIYMCVCVCVWLC 562 ++IY+CVCVCV +C Sbjct: 1402 VYIYICVCVCVCVC 1443
>LOC_Os09g04200:12009.t00316:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2456 Score = 36.3 bits (73), Expect = 0.24 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = -1 / -1 Query: 618 NI*DHLFIYMCVCVCVW 568 NI* +++IYMCVCVCV+ Sbjct: 1238 NI*AYIYIYMCVCVCVY 1188 Score = 32.2 bits (64), Expect = 4.2 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCV 571 H++IY+CVCVCV Sbjct: 1228 HIYIYICVCVCV 1193
>LOC_Os07g40790:12007.t03738:unspliced-genomic dopamine responsive protein, putative, expressed| Length = 5062 Score = 36.3 bits (73), Expect = 0.24 Identities = 9/17 (52%), Positives = 16/17 (94%) Frame = -1 / -1 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+CVCVC+++C Y Sbjct: 4045 YIYIYICVCVCMYVCMY 3995 Score = 32.2 bits (64), Expect = 4.1 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYM 598 Y+H + HTHTHIY+ Sbjct: 3996 YIHTYIHTHTHIYI 4037 Score = 31.3 bits (62), Expect = 7.9 Identities = 8/17 (47%), Positives = 15/17 (88%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+CV VC+++C Y Sbjct: 4041 YIYIYVCVYVCMYVCMY 3991
>LOC_Os02g11830:12002.t00982:unspliced-genomic coatomer subunit beta, putative, expressed| Length = 10179 Score = 29.9 bits (59), Expect(2) = 0.26 Identities = 10/17 (58%), Positives = 15/17 (88%) Frame = +2 / +3 Query: 569 HTHTHTHIYMNK*SHIL 619 HTHTHT+IY++ ++IL Sbjct: 6546 HTHTHTYIYIDLLTYIL 6596 Score = 23.5 bits (45), Expect(2) = 0.26 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +1 / +1 Query: 508 LPIAPAIDAETLSTLRIFTQPHTHTHTH 591 LP+ I +++ + I HTHTH Sbjct: 6475 LPLFHIIRLSSIAHIHIDVNESRHTHTH 6558 Score = 31.8 bits (63), Expect = 5.7 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 / -1 Query: 606 HLFIYMCVCVCV 571 +L+IYMCVCVCV Sbjct: 6579 NLYIYMCVCVCV 6544
>LOC_Os01g50934:12001.t006891:unspliced-genomic fiber protein Fb11, putative, expressed| Length = 3091 Score = 27.2 bits (53), Expect(2) = 0.28 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 / +2 Query: 633 LPHGDNI*DHLFIYMCVCV 577 L H N * +++IY+CVCV Sbjct: 1610 LAHNLNS*MNIYIYVCVCV 1666 Score = 26.3 bits (51), Expect(2) = 0.28 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -1 / +2 Query: 591 MCVCVCVW 568 +CVCVCVW Sbjct: 1667 VCVCVCVW 1690 Score = 31.3 bits (62), Expect = 7.8 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +2 / -1 Query: 566 NHTHTHTHIYMNK*SHILSPCGRKRERSTYVEPALH 673 +HTHTH +IY++ * I+ +R + P +H Sbjct: 1669 HHTHTHIYIYIHL*IQIMC*VSSQRNNTQERNPIMH 1562
>LOC_Os09g20980:12009.t01832:unspliced-genomic RING-H2 finger protein ATL5I, putative, expressed| Length = 1631 Score = 31.3 bits (62), Expect(2) = 0.32 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 / +2 Query: 548 R*GYLHNHTHTHTHIY 595 R Y H HTHTHTH + Sbjct: 1331 RYSYQHTHTHTHTHTH 1378 Score = 25.4 bits (49), Expect(2) = 0.32 Identities = 18/55 (32%), Positives = 23/55 (41%) Frame = +1 / +3 Query: 301 QRRQEIGRRSAEHR*QASGVQVHQERCRWVKRWQGRRHPLQVRRQRPLLHQHFRR 465 +RR+ G RS HR A R R +W+ R VR +R L RR Sbjct: 474 RRRRGAGARSGRHRRAAGVHLRRAARRRRRAQWRRREREEAVRLRRLPLRVRRRR 638 Score = 29.5 bits (58), Expect(2) = 2.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTH M Sbjct: 1346 HTHTHTHTHTHTKM 1387 Score = 24.0 bits (46), Expect(2) = 2.6 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +1 / +3 Query: 406 RRHPLQVRRQRP 441 RR PL+VRR+RP Sbjct: 606 RRLPLRVRRRRP 641
>LOC_Os08g11480:12008.t01030:unspliced-genomic expressed protein| Length = 5279 Score = 35.9 bits (72), Expect = 0.33 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 Y+H HTHTHTHI++ HI Sbjct: 3237 YIHTHTHTHTHIHIYIYIHI 3296 Score = 35.0 bits (70), Expect = 0.62 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYM 598 Y++ HTHTHTHIY+ Sbjct: 3235 YIYTHTHTHTHIYI 3276 Score = 32.2 bits (64), Expect = 4.1 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIY 595 Y++ HTHTHTH Y Sbjct: 3233 YIYTHTHTHTHTY 3271 Score = 31.8 bits (63), Expect = 5.7 Identities = 8/14 (57%), Positives = 13/14 (92%) Frame = -1 / -2 Query: 603 LFIYMCVCVCVWLC 562 ++IY+C+CVCV +C Sbjct: 3289 MYIYICICVCVCVC 3248 Score = 31.3 bits (62), Expect = 7.8 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 / +1 Query: 527 SMLRR*VR*GYLHNHTHTHTHIYM 598 + LR *+ Y H HTHTH +IY+ Sbjct: 3211 NQLRN*LIYIYTHTHTHTHIYIYI 3282 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYM 598 Y H HTHTHT+ Y+ Sbjct: 3239 YTHTHTHTHTYTYI 3280 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTH HIY+ Sbjct: 3243 HTHTHTHTHIHIYI 3284 Score = 31.3 bits (62), Expect = 7.8 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 + H HTHT+T+IY++ HI Sbjct: 3245 HTHTHTHTYTYIYIHTYIHI 3304
>LOC_Os03g62974:12003.t05520:unspliced-genomic hypothetical protein| Length = 4620 Score = 35.9 bits (72), Expect = 0.33 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 / -2 Query: 548 R*GYLHNHTHTHTHIYM 598 R* + H HTHTHTHIY+ Sbjct: 3002 R*KHTHTHTHTHTHIYI 2952 Score = 35.0 bits (70), Expect = 0.62 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLC 562 +++IYMCVCVCV +C Sbjct: 2944 YIYIYMCVCVCVCVC 2988 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 2991 HTHTHTHTHTHIYI 2950 Score = 33.6 bits (67), Expect = 1.6 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+CVCVCV +C + Sbjct: 2946 YIYIYVCVCVCVCVCVF 2996 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 2942 YIYIYICVCVCVCVC 2986 Score = 33.1 bits (66), Expect = 2.2 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCVWLCKYPQRTQRLSIDSWSY 514 +++I +CVCVCV +C + T L + SY Sbjct: 2948 YIYICVCVCVCVCVCVFIYTTDLLQMTC*SY 3040 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 2989 HTHTHTHTHTYIYI 2948 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 / -3 Query: 563 HNHTHTHTHIYM 598 H HTHTHTH Y+ Sbjct: 2989 HTHTHTHTHTYI 2954
>LOC_Os01g17279:12001.t01573:unspliced-genomic histone mRNA exonuclease 1, putative, expressed| Length = 11188 Score = 35.9 bits (72), Expect = 0.33 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIY 595 Y H HTHTHTHIY Sbjct: 8202 YTHTHTHTHTHIY 8164 Score = 35.9 bits (72), Expect = 0.33 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = -1 / +2 Query: 621 DNI*DHLFIYMCVCVCVWLCKY 556 D++ + ++YMCVCVCV +C Y Sbjct: 8138 DDLLVYRYVYMCVCVCVCVCVY 8203 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 8200 HTHTHTHTHTHIYI 8159 Score = 32.2 bits (64), Expect = 4.1 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYMN 601 + H HTHTHTH Y++ Sbjct: 8204 HTHTHTHTHTHTYIH 8160 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIY 595 Y+H HTHTHTH + Sbjct: 8212 YIHIHTHTHTHTH 8174 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIY 595 Y H HTHTHTH + Sbjct: 8210 YTHTHTHTHTHTH 8172
>LOC_Os02g07430:12002.t00640:unspliced-genomic MADS-box transcription factor 29, putative, expressed| Length = 4007 Score = 35.9 bits (72), Expect = 0.33 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLC 562 H++IY+CVCVCV +C Sbjct: 3772 HIYIYICVCVCVCVC 3816 Score = 35.0 bits (70), Expect = 0.62 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCVWLC 562 +++IYMCVCVCV +C Sbjct: 3774 YIYIYMCVCVCVCVC 3818 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 3823 HTHTHTHTHTHIYI 3782 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 3821 HTHTHTHTHTHIYI 3780 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 3776 YIYIYVCVCVCVCVC 3820 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTH Y+ Sbjct: 3825 HTHTHTHTHTHTYI 3784 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 3819 HTHTHTHTHTYIYI 3778
>LOC_Os01g28370:12001.t02533:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 14121 Score = 35.9 bits (72), Expect = 0.33 Identities = 10/14 (71%), Positives = 14/14 (100%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWL 565 H++IYMCVCVCV++ Sbjct: 12175 HIYIYMCVCVCVYI 12216 Score = 35.0 bits (70), Expect = 0.62 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = -1 / +1 Query: 672 CRAGSTYVLLSLFLPHGDNI*DHLFIYMCVCVCVWLCKY 556 C Y+ +++ +I +++IYMCVCVC+++ Y Sbjct: 11959 CAHTHIYIYTYIYIYIYIHIYIYIYIYMCVCVCIYIYMY 12075 Score = 32.7 bits (65), Expect = 3.0 Identities = 8/17 (47%), Positives = 15/17 (88%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+CVCVC+++ Y Sbjct: 12177 YIYIYVCVCVCIYIYMY 12227 Score = 32.2 bits (64), Expect = 4.2 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+CVCVCV++ Y Sbjct: 12173 YIYIYICVCVCVYIYIY 12223 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 Y++ HTHTH +IYM Sbjct: 12216 YIYTHTHTHIYIYM 12175
>LOC_Os10g28330:12010.t02185:unspliced-genomic zinc finger protein ID1, putative, expressed| Length = 3177 Score = 35.4 bits (71), Expect = 0.45 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +2 / +3 Query: 545 VR*GYLHNHTHTHTHIYM 598 VR + H HTHTHTHIY+ Sbjct: 1248 VRHTHTHTHTHTHTHIYI 1301 Score = 35.0 bits (70), Expect = 0.62 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYMNK*SHIL 619 + H HTHTHTHIY+ S +L Sbjct: 1258 HTHTHTHTHTHIYI*SYSKVL 1320 Score = 33.1 bits (66), Expect = 2.2 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -1 / -1 Query: 603 LFIYMCVCVCVWLC 562 L+IY+CVCVCV +C Sbjct: 1302 LYIYVCVCVCVCVC 1261 Score = 33.1 bits (66), Expect = 2.2 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 / -2 Query: 600 FIYMCVCVCVWLC 562 +IYMCVCVCV +C Sbjct: 1301 YIYMCVCVCVCVC 1263 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTH Y+ Sbjct: 1256 HTHTHTHTHTHTYI 1297
>LOC_Os07g39640:12007.t03625:unspliced-genomic RNA-binding protein 12, putative, expressed| Length = 1005 Score = 35.4 bits (71), Expect = 0.45 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 / +2 Query: 242 LRPCISYASGNGGILPPACCSGVKRLAGAA 331 L PC+ Y + + P ACC G + L G+A Sbjct: 371 LLPCVDYLTNDATAPPGACCDGFRSLVGSA 460
>LOC_Os02g05760:12002.t00474:unspliced-genomic hypothetical protein| Length = 3408 Score = 35.4 bits (71), Expect = 0.45 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 / -2 Query: 560 LHNHTHTHTHIYM 598 LH HTHTHTHIY+ Sbjct: 2318 LHTHTHTHTHIYI 2280 Score = 34.5 bits (69), Expect = 0.85 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+CVCVCV +C + Sbjct: 2272 YIYIYICVCVCVCVCSF 2322 Score = 34.1 bits (68), Expect = 1.2 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +2 / -1 Query: 500 RRFCL*LQLSMLRR*VR*GYLHNHTHTHTHIYM 598 R + +*L +S + R + H HTHTHT+IY+ Sbjct: 2376 RCYII*LYISYI*REISHKTTHTHTHTHTYIYI 2278 Score = 31.3 bits (62), Expect = 7.9 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCV 571 +++IYMCVCVCV Sbjct: 2274 YIYIYMCVCVCV 2309
>LOC_Os10g38820:12010.t03121:unspliced-genomic transcription factor RF2a, putative, expressed| Length = 2551 Score = 35.4 bits (71), Expect = 0.45 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +1 / -3 Query: 283 PASGLLQRRQEIGRRSAEHR*QASGVQVHQERCRWVKRWQGRR 411 P L +R+Q RR GV + R RW +RWQ RR Sbjct: 329 PPVRLARRQQPAARRVVHAHVAVRGVGARRRRWRWRRRWQPRR 201
>LOC_Os02g01150:12002.t00015:unspliced-genomic hydroxypyruvate reductase, putative, expressed| Length = 4470 Score = 35.4 bits (71), Expect = 0.45 Identities = 10/16 (62%), Positives = 15/16 (93%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWLCK 559 +++IYMCVCVCV +C+ Sbjct: 3058 YIYIYMCVCVCVCVCE 3011 Score = 34.5 bits (69), Expect = 0.85 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 3011 FTHTHTHTHTHIYI 3052 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +2 / +3 Query: 563 HNHTHTHTHIYM 598 H HTHTHTHIY+ Sbjct: 3015 HTHTHTHTHIYI 3050 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / -1 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 3060 YIYIYICVCVCVCVC 3016 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 3013 HTHTHTHTHTYIYI 3054 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 / +1 Query: 563 HNHTHTHTHIYM 598 H HTHTHTH Y+ Sbjct: 3013 HTHTHTHTHTYI 3048
>LOC_Os01g43844:12001.t03897:unspliced-genomic cytochrome P450 72A1, putative, expressed| Length = 4288 Score = 35.4 bits (71), Expect = 0.45 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCVWLCKYP 553 +++IY+CVCVCV +C P Sbjct: 1533 YIYIYICVCVCVCVCALP 1586 Score = 35.0 bits (70), Expect = 0.62 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +2 / -1 Query: 554 GYLHNHTHTHTHIYM 598 G H HTHTHTHIY+ Sbjct: 1585 GSAHTHTHTHTHIYI 1541 Score = 35.0 bits (70), Expect = 0.62 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCVWLC 562 +++IYMCVCVCV +C Sbjct: 1535 YIYIYMCVCVCVCVC 1579 Score = 34.5 bits (69), Expect = 0.85 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYMNK*SH 613 Y+H HTHTHTH + + +H Sbjct: 1496 YIHTHTHTHTHTHTHTHTH 1440 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +2 / -2 Query: 560 LHNHTHTHTHIYM 598 +H HTHTHTHIY+ Sbjct: 1581 VHTHTHTHTHIYI 1543 Score = 33.1 bits (66), Expect = 2.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYMNK*SH 613 Y H HTHTHTH + + +H Sbjct: 1494 YTHTHTHTHTHTHTHTHTH 1438 Score = 33.1 bits (66), Expect = 2.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYMNK*SH 613 Y H HTHTHTH + + +H Sbjct: 1492 YTHTHTHTHTHTHTHTHTH 1436 Score = 32.2 bits (64), Expect = 4.1 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYMNK*SHIL 619 + H HTHTHTH + + +H L Sbjct: 1490 HTHTHTHTHTHTHTHTHTHTL 1428 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYMNK*SH 613 Y++ HTHTHTH + + +H Sbjct: 1500 YIYTHTHTHTHTHTHTHTH 1444 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYMNK*SH 613 Y++ HTHTHTH + + +H Sbjct: 1498 YIYTHTHTHTHTHTHTHTH 1442
>LOC_Os08g14640:12008.t01339:unspliced-genomic expressed protein| Length = 4065 Score = 26.7 bits (52), Expect(2) = 0.49 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 / -1 Query: 569 HTHTHTHIYMNK 604 HTHTHTH +N+ Sbjct: 681 HTHTHTHTKINQ 646 Score = 25.8 bits (50), Expect(2) = 0.49 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 / -2 Query: 511 PIAPAIDAETLSTLRIFTQPHTHTHT 588 P PA+ S L HTHTHT Sbjct: 737 PNTPAVTR*NQSNLPKVNNTHTHTHT 660
>LOC_Os01g40430:12001.t03568:unspliced-genomic OsWRKY27 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 2308 Score = 29.0 bits (57), Expect(2) = 0.60 Identities = 20/64 (31%), Positives = 27/64 (42%) Frame = +1 / +2 Query: 265 QRQRRHPASGLLQRRQEIGRRSAEHR*QASGVQVHQERCRWVKRWQGRRHPLQVRRQRPL 444 +R+ P + L RR+ S E Q Q R R + RR RR+RP+ Sbjct: 860 RRRVPRPRAALRPRRRRANGASQEAEGHHQQQQ*QQHLRRIRGRRRRRRRAGGPRRRRPV 1039 Query: 445 LHQH 456 LH H Sbjct: 1040 LHDH 1051 Score = 27.2 bits (53), Expect(2) = 0.60 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 / +1 Query: 235 LCLAPLHFLCQRQRRHPA 288 LC PLHFLC+ +H A Sbjct: 202 LCDTPLHFLCKFHFQHVA 255
>LOC_Os01g53570:12001.t04776:unspliced-genomic ALMT1, putative, expressed| Length = 2500 Score = 35.0 bits (70), Expect = 0.62 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +2 / +3 Query: 563 HNHTHTHTHIYMNK*SHILSPCGRKRERSTYVEP 664 H HTHTHTH +N+ S C R+ + P Sbjct: 1287 HTHTHTHTHTPINQSSFARLQCERRHKAHRLTNP 1388 Score = 27.2 bits (53), Expect(2) = 4.0 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 / -2 Query: 591 MCVCVCVWLCKYPQRTQR 538 +CVCVCV +C+ + +R Sbjct: 1317 VCVCVCVCVCERERERER 1264 Score = 22.1 bits (42), Expect(2) = 4.0 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 / -1 Query: 633 LPHGDNI*DHLFIYMCVCVCV 571 L H + + I +CVCVCV Sbjct: 1357 LSHCNRAKED*LIGVCVCVCV 1295
>LOC_Os11g40690:12011.t03611:unspliced-genomic mannitol dehydrogenase, putative| Length = 5318 Score = 35.0 bits (70), Expect = 0.62 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCVWLC 562 +++IYMCVCVCV +C Sbjct: 4995 YIYIYMCVCVCVCVC 5039 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 5044 HTHTHTHTHTHIYI 5003 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 5042 HTHTHTHTHTHIYI 5001 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 4993 YIYIYICVCVCVCVC 5037 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 4997 YIYIYVCVCVCVCVC 5041 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTH Y+ Sbjct: 5046 HTHTHTHTHTHTYI 5005 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 5040 HTHTHTHTHTYIYI 4999
>LOC_Os11g17770:12011.t01553:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6635 Score = 35.0 bits (70), Expect = 0.62 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / -1 Query: 606 HLFIYMCVCVCVWLC 562 +++IYMCVCVCV +C Sbjct: 2171 YIYIYMCVCVCVCVC 2127 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 2122 HTHTHTHTHTHIYI 2163 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 2124 HTHTHTHTHTHIYI 2165 Score = 34.1 bits (68), Expect = 1.2 Identities = 9/31 (29%), Positives = 23/31 (74%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCVWLCKYPQRTQRLSIDSWSY 514 +++IY+C+ VC+++C Y ++ R+++ +Y Sbjct: 2192 YIYIYVCMYVCMYVCMYVDQSIRIALRCETY 2284 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 2173 YIYIYICVCVCVCVC 2129 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 2169 YIYIYVCVCVCVCVC 2125 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 + H HTHTHTH + + +HI Sbjct: 2100 HTHTHTHTHTHTHTHTHTHI 2159 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTH Y+ Sbjct: 2120 HTHTHTHTHTHTYI 2161 Score = 31.3 bits (62), Expect = 7.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 + H HTHTHTH + + +HI Sbjct: 2098 HTHIHTHTHTHTHTHTHTHI 2157 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIY 595 Y H HTHTHTH + Sbjct: 2108 YTHTHTHTHTHTH 2146 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 2126 HTHTHTHTHTYIYI 2167
>LOC_Os09g18360:12009.t01621:unspliced-genomic senescence-induced receptor-like serine/threonine-protein kinase| precursor, putative, expressed Length = 9388 Score = 35.0 bits (70), Expect = 0.62 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLC 562 +++IYMCVCVCV +C Sbjct: 3949 YIYIYMCVCVCVCVC 3993 Score = 34.5 bits (69), Expect = 0.85 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCVWLCKYPQRTQRLSID 526 +++IY+CVCVCV +C +R ID Sbjct: 3947 YIYIYICVCVCVCVCVCVSPKRRGKID 4027 Score = 34.5 bits (69), Expect = 0.85 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCVWLCKYPQRTQRLSI 529 +++I +CVCVCV +C P+R ++ + Sbjct: 3953 YIYICVCVCVCVCVCVSPKRRGKIDL 4030 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 3998 HTHTHTHTHTHIYI 3957 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 3996 HTHTHTHTHTHIYI 3955 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCVWLCKYPQR 547 +++IY+CVCVCV +C Q+ Sbjct: 3951 YIYIYVCVCVCVCVCVSAQK 4010 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 3994 HTHTHTHTHTYIYI 3953 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 / -1 Query: 563 HNHTHTHTHIYM 598 H HTHTHTH Y+ Sbjct: 3994 HTHTHTHTHTYI 3959
>LOC_Os06g34960:12006.t03193:unspliced-genomic protein kinase, putative, expressed| Length = 7893 Score = 35.0 bits (70), Expect = 0.62 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWLC 562 +++IYMCVCVCV +C Sbjct: 1282 YIYIYMCVCVCVCVC 1238 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +2 / +3 Query: 563 HNHTHTHTHIYM 598 H HTHTHTHIY+ Sbjct: 1239 HTHTHTHTHIYI 1274 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +2 / +2 Query: 563 HNHTHTHTHIYM 598 H HTHTHTHIY+ Sbjct: 1241 HTHTHTHTHIYI 1276 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / -1 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 1284 YIYIYICVCVCVCVC 1240 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 1280 YIYIYVCVCVCVCVC 1236 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 1237 HTHTHTHTHTYIYI 1278 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 / +1 Query: 563 HNHTHTHTHIYM 598 H HTHTHTH Y+ Sbjct: 1237 HTHTHTHTHTYI 1272
>LOC_Os06g21330:12006.t01950:unspliced-genomic protein binding protein, putative, expressed| Length = 4442 Score = 35.0 bits (70), Expect = 0.62 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCVWLC 562 +++IYMCVCVCV +C Sbjct: 3014 YIYIYMCVCVCVCVC 3058 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 3063 HTHTHTHTHTHIYI 3022 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 3061 HTHTHTHTHTHIYI 3020 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 3012 YIYIYICVCVCVCVC 3056 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 3016 YIYIYVCVCVCVCVC 3060 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTH Y+ Sbjct: 3065 HTHTHTHTHTHTYI 3024 Score = 31.3 bits (62), Expect = 7.8 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +2 / -3 Query: 548 R*GYLHNHTHTHTHIYM 598 R* + H HTHTHTH ++ Sbjct: 3078 R*KHTHTHTHTHTHTHI 3028 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 3059 HTHTHTHTHTYIYI 3018
>LOC_Os05g48790:12005.t04313:unspliced-genomic expressed protein| Length = 6301 Score = 35.0 bits (70), Expect = 0.62 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / -1 Query: 606 HLFIYMCVCVCVWLC 562 +++IYMCVCVCV +C Sbjct: 4048 YIYIYMCVCVCVCVC 4004 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 3999 HTHTHTHTHTHIYI 4040 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 4001 HTHTHTHTHTHIYI 4042 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 4050 YIYIYICVCVCVCVC 4006 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 4046 YIYIYVCVCVCVCVC 4002 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTH Y+ Sbjct: 3997 HTHTHTHTHTHTYI 4038 Score = 31.3 bits (62), Expect = 7.8 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 / +2 Query: 527 SMLRR*VR*GYLHNHTHTHTHIY 595 S+L +R + H HTHTHTH + Sbjct: 3959 SLLPTPIRGTHTHTHTHTHTHTH 4027 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIY 595 Y H HTHTHTH + Sbjct: 3985 YTHTHTHTHTHTH 4023 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 4003 HTHTHTHTHTYIYI 4044
>LOC_Os05g48100:12005.t04244:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2486 Score = 35.0 bits (70), Expect = 0.62 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCVWLC 562 +++IYMCVCVCV +C Sbjct: 372 YIYIYMCVCVCVCVC 416 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 421 HTHTHTHTHTHIYI 380 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 419 HTHTHTHTHTHIYI 378 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 370 YIYIYICVCVCVCVC 414 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 374 YIYIYVCVCVCVCVC 418 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 + H HTHTHTH + + +HI Sbjct: 445 HTHTHTHTHTHTHTHTHTHI 386 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 + H HTHTHTH + + +HI Sbjct: 443 HTHTHTHTHTHTHTHTHTHI 384 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTH Y+ Sbjct: 423 HTHTHTHTHTHTYI 382 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 417 HTHTHTHTHTYIYI 376
>LOC_Os05g33950:12005.t02990:unspliced-genomic hypothetical protein| Length = 1448 Score = 35.0 bits (70), Expect = 0.62 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCVWLC 562 +++IYMCVCVCV +C Sbjct: 277 YIYIYMCVCVCVCVC 233 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 228 HTHTHTHTHTHIYI 269 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 230 HTHTHTHTHTHIYI 271 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 279 YIYIYICVCVCVCVC 235 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / -1 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 275 YIYIYVCVCVCVCVC 231 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 + H HTHTHTH + + +HI Sbjct: 204 HTHTHTHTHTHTHTHTHTHI 263 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 + H HTHTHTH + + +HI Sbjct: 206 HTHTHTHTHTHTHTHTHTHI 265 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTH Y+ Sbjct: 226 HTHTHTHTHTHTYI 267 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 232 HTHTHTHTHTYIYI 273
>LOC_Os04g02900:12004.t00184:unspliced-genomic pyruvate dehydrogenase E1 component alpha subunit, putative,| expressed Length = 4061 Score = 35.0 bits (70), Expect = 0.62 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCVWLC 562 +++IYMCVCVCV +C Sbjct: 600 YIYIYMCVCVCVCVC 644 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +2 / -2 Query: 563 HNHTHTHTHIYM 598 H HTHTHTHIY+ Sbjct: 643 HTHTHTHTHIYI 608 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +2 / -1 Query: 563 HNHTHTHTHIYM 598 H HTHTHTHIY+ Sbjct: 641 HTHTHTHTHIYI 606 Score = 33.1 bits (66), Expect = 2.2 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 / -3 Query: 521 QLSMLRR*VR*GYLHNHTHTHTHIYM 598 Q++ LRR H HTHTHT+IY+ Sbjct: 681 QVAKLRRRPARSDTHTHTHTHTYIYI 604 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 598 YIYIYICVCVCVCVC 642 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +2 / -2 Query: 554 GYLHNHTHTHTHIYM 598 G+ H HTHTH +IY+ Sbjct: 646 GHTHTHTHTHIYIYI 602
>LOC_Os03g57140:12003.t04983:unspliced-genomic expressed protein| Length = 2609 Score = 35.0 bits (70), Expect = 0.62 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCVWLC 562 +++IYMCVCVCV +C Sbjct: 967 YIYIYMCVCVCVCVC 923 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 920 HTHTHTHTHTHIYI 961 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +2 / +3 Query: 563 HNHTHTHTHIYM 598 H HTHTHTHIY+ Sbjct: 924 HTHTHTHTHIYI 959 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 969 YIYIYICVCVCVCVC 925 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / -1 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 965 YIYIYVCVCVCVCVC 921 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 922 HTHTHTHTHTYIYI 963 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 / +1 Query: 563 HNHTHTHTHIYM 598 H HTHTHTH Y+ Sbjct: 922 HTHTHTHTHTYI 957
>LOC_Os03g31430:12003.t02738:unspliced-genomic sesquiterpene synthase, putative| Length = 9817 Score = 35.0 bits (70), Expect = 0.62 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLC 562 +++IYMCVCVCV +C Sbjct: 4213 YIYIYMCVCVCVCVC 4257 Score = 34.1 bits (68), Expect(2) = 0.86 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 4262 HTHTHTHTHTHIYI 4221 Score = 23.5 bits (45), Expect(2) = 0.86 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 / -3 Query: 94 CGLAHHHYYC*LDRNG 141 CG+AH Y+C L G Sbjct: 7175 CGVAHRLYFCSLCLKG 7128 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 4260 HTHTHTHTHTHIYI 4219 Score = 33.1 bits (66), Expect = 2.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYMNK*SH 613 Y H HTHTHTH + + +H Sbjct: 4322 YTHTHTHTHTHTHTHTHTH 4266 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 4211 YIYIYICVCVCVCVC 4255 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 4215 YIYIYVCVCVCVCVC 4259 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 + H HTHTHTH + + +HI Sbjct: 4286 HTHTHTHTHTHTHTHTHTHI 4227 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 + H HTHTHTH + + +HI Sbjct: 4284 HTHTHTHTHTHTHTHTHTHI 4225 Score = 32.2 bits (64), Expect = 4.1 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 / -2 Query: 560 LHNHTHTHTHIYMNK*SH 613 LH HTHTHTH + + +H Sbjct: 4323 LHTHTHTHTHTHTHTHTH 4270 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTH Y+ Sbjct: 4264 HTHTHTHTHTHTYI 4223 Score = 31.3 bits (62), Expect = 7.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 / -1 Query: 563 HNHTHTHTHIYMNK*SHILSPCGRKRERSTYV 658 H HTHTHTH + + +H + TY+ Sbjct: 4318 HTHTHTHTHTHTHTHTHTHTHTHTHTHTHTYI 4223 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 4258 HTHTHTHTHTYIYI 4217
>LOC_Os02g19180:12002.t01711:unspliced-genomic nucleic acid binding protein, putative| Length = 1444 Score = 35.0 bits (70), Expect = 0.62 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCVWLC 562 +++IYMCVCVCV +C Sbjct: 842 YIYIYMCVCVCVCVC 886 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 891 HTHTHTHTHTHIYI 850 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 889 HTHTHTHTHTHIYI 848 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 840 YIYIYICVCVCVCVC 884 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 844 YIYIYVCVCVCVCVC 888 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 / -3 Query: 554 GYLHNHTHTHTHIYMNK*SHI 616 G+ H HTHTHTH + + ++I Sbjct: 914 GHTHTHTHTHTHTHTHTHTYI 852 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 + H HTHTHTH + + +HI Sbjct: 915 WTHTHTHTHTHTHTHTHTHI 856 Score = 32.2 bits (64), Expect = 4.1 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 / -1 Query: 563 HNHTHTHTHIYMNK*SHI 616 H HTHTHTH + + +HI Sbjct: 907 HTHTHTHTHTHTHTHTHI 854 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTH Y+ Sbjct: 893 HTHTHTHTHTHTYI 852 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 887 HTHTHTHTHTYIYI 846
>LOC_Os01g41170:12001.t03637:unspliced-genomic membrane protein, putative, expressed| Length = 1411 Score = 35.0 bits (70), Expect = 0.62 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCVWLC 562 +++IYMCVCVCV +C Sbjct: 717 YIYIYMCVCVCVCVC 673 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 668 HTHTHTHTHTHIYI 709 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 670 HTHTHTHTHTHIYI 711 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 719 YIYIYICVCVCVCVC 675 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / -1 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 715 YIYIYVCVCVCVCVC 671 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 + H HTHTHTH + + +HI Sbjct: 644 HTHTHTHTHTHTHTHTHTHI 703 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 + H HTHTHTH + + +HI Sbjct: 646 HTHTHTHTHTHTHTHTHTHI 705 Score = 31.8 bits (63), Expect = 5.7 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYMNK*SHILSPCGRKRERSTYV 658 + H HTHTHTH + + +H + TY+ Sbjct: 606 HTHTHTHTHTHTHTHTHTHTHTHTHTHTHTHTYI 707 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTH Y+ Sbjct: 666 HTHTHTHTHTHTYI 707 Score = 31.3 bits (62), Expect = 7.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 / +1 Query: 551 *GYLHNHTHTHTHIYMNK*SH 613 * + H HTHTHTH + + +H Sbjct: 586 *SHTHTHTHTHTHTHTHTHTH 648 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 672 HTHTHTHTHTYIYI 713
>LOC_Os01g17990:12001.t01594:unspliced-genomic conserved hypothetical protein| Length = 3661 Score = 35.0 bits (70), Expect = 0.62 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCVWLC 562 +++IYMCVCVCV +C Sbjct: 2102 YIYIYMCVCVCVCVC 2146 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 2151 HTHTHTHTHTHIYI 2110 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTHIY+ Sbjct: 2149 HTHTHTHTHTHIYI 2108 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 2100 YIYIYICVCVCVCVC 2144 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 2104 YIYIYVCVCVCVCVC 2148 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTH Y+ Sbjct: 2153 HTHTHTHTHTHTYI 2112 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 2147 HTHTHTHTHTYIYI 2106
>LOC_Os06g20500:12006.t01867:unspliced-genomic conserved hypothetical protein| Length = 5652 Score = 26.3 bits (51), Expect(2) = 0.65 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 / -3 Query: 569 HTHTHTHIYMNK 604 HTHTHTH +N+ Sbjct: 463 HTHTHTHC*INR 428 Score = 25.8 bits (50), Expect(2) = 0.65 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +1 / -3 Query: 508 LPIAPAIDAETLSTLRIFTQPHTHTH 585 LP+ P++ + R T HTHTH Sbjct: 520 LPVLPSLCPHRNARERKTTHTHTHTH 443
>LOC_Os02g58320:12002.t05403:unspliced-genomic protein BRICK1, putative, expressed| Length = 1510 Score = 28.6 bits (56), Expect(2) = 0.74 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 / +3 Query: 603 LFIYMCVCVCVWLC 562 +F+ +CVCVCV +C Sbjct: 1446 VFLCLCVCVCVCVC 1487 Score = 26.7 bits (52), Expect(2) = 0.74 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 / +2 Query: 681 CWPCRAGSTYVLLSL 637 CWP S YVL+SL Sbjct: 719 CWPANYSSDYVLVSL 763
>LOC_Os06g07250:12006.t00608:unspliced-genomic protein GOS9, putative, expressed| Length = 5169 Score = 34.5 bits (69), Expect = 0.85 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 Y++ HTHTHTHI+++ HI Sbjct: 1909 YIYTHTHTHTHIHIHIYIHI 1968 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYM 598 Y++ HTHTHTHIY+ Sbjct: 1907 YIYIHTHTHTHIYI 1948 Score = 32.2 bits (64), Expect = 4.1 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYM 598 Y+H HTHTH +IY+ Sbjct: 1913 YIHTHTHTHIYIYI 1954 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYM 598 Y H HTHTH HI++ Sbjct: 1915 YTHTHTHTHIHIHI 1956 Score = 31.3 bits (62), Expect = 7.9 Identities = 8/17 (47%), Positives = 15/17 (88%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWLCKY 556 ++++Y+CVCVCV++ Y Sbjct: 1954 YVYVYVCVCVCVYIYIY 1904
>LOC_Os05g31730:12005.t02770:unspliced-genomic transporter, monovalent cation proton antiporter-2, putative,| expressed Length = 3958 Score = 34.5 bits (69), Expect = 0.85 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 / +3 Query: 359 TPLACQRCSALXXXXXXXXXXXPEAGCRRCRWHRKCRG 246 TP AC RCSA R RWHR C G Sbjct: 3342 TPSACTRCSARSCSGWPCRGRAASRSARARRWHRWCPG 3455
>LOC_Os03g07100:12003.t00576:unspliced-genomic lipid transfer protein, putative, expressed| Length = 2219 Score = 34.5 bits (69), Expect = 0.85 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +2 / +3 Query: 221 CGQVSSALRPCISYASGNGGILPPACCSGVKRLAG 325 C L PC+ Y G P CC G++++ G Sbjct: 123 CADQLVGLAPCLQYVQGEAKAPAPDCCGGLRQVLG 227
>LOC_Os02g03280:12002.t00228:unspliced-genomic bax inhibitor 1, putative, expressed| Length = 3386 Score = 34.5 bits (69), Expect = 0.85 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +3 / -1 Query: 309 SRDWPAQRRAPLTSKRCASASRA 377 SRD P QR+AP T++RC+ +RA Sbjct: 1295 SRDEPPQRQAPRTTRRCSPRTRA 1227
>LOC_Os11g20239:12011.t01793:unspliced-genomic expressed protein| Length = 20374 Score = 34.5 bits (69), Expect = 0.85 Identities = 9/13 (69%), Positives = 13/13 (100%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVW 568 +++IY+CVCVCVW Sbjct: 17002 YIYIYVCVCVCVW 17040 Score = 31.3 bits (62), Expect = 7.8 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 Y HTHTHTHIY+ Sbjct: 17047 YRTTHTHTHTHIYI 17006 Score = 31.3 bits (62), Expect = 7.9 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCV 571 +++IYMCVCVCV Sbjct: 17000 YIYIYMCVCVCV 17035
>LOC_Os04g28520:12004.t02548:unspliced-genomic fatty acyl coA reductase, putative, expressed| Length = 9326 Score = 34.5 bits (69), Expect = 0.85 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWLC 562 +++IYMCVCVC+ +C Sbjct: 4416 YIYIYMCVCVCICVC 4372 Score = 32.7 bits (65), Expect = 3.0 Identities = 8/15 (53%), Positives = 14/15 (93%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWLC 562 ++++Y+CVCVCV +C Sbjct: 4590 YVYVYVCVCVCVCIC 4546 Score = 32.7 bits (65), Expect = 3.0 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / -1 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 4418 YIYIYICVCVCVSVC 4374 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIY 595 ++H HTHTHTH Y Sbjct: 4541 HIHIHTHTHTHTY 4579
>LOC_Os03g22510:12003.t02002:unspliced-genomic expressed protein| Length = 861 Score = 34.5 bits (69), Expect = 0.85 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 / -1 Query: 603 LFIYMCVCVCVWLCKYPQRTQR 538 + IY+CVCVCV +C + R R Sbjct: 654 MLIYVCVCVCVCVCSFSTRHTR 589 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 / +1 Query: 563 HNHTHTHTHIYMN 601 H HTHTHTHIY + Sbjct: 616 HTHTHTHTHIYQH 654 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 / +2 Query: 563 HNHTHTHTHIYMN 601 H HTHTHTH Y++ Sbjct: 614 HTHTHTHTHTYIS 652
>LOC_Os03g01110:12003.t00011:unspliced-genomic RNA methyltransferase, TrmH family protein, expressed| Length = 13313 Score = 34.5 bits (69), Expect = 0.85 Identities = 7/17 (41%), Positives = 15/17 (88%) Frame = -1 / -1 Query: 606 HLFIYMCVCVCVWLCKY 556 ++++YMC+C+C+ +C Y Sbjct: 8150 YMYMYMCICICICICIY 8100
>LOC_Os01g46420:12001.t04093:unspliced-genomic hypothetical protein| Length = 1017 Score = 34.5 bits (69), Expect = 0.85 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 / +2 Query: 385 WVKRWQGRRHPLQVRRQR 438 W RW+GRRHP RR+R Sbjct: 740 WRGRWRGRRHPFSFRRRR 793
>LOC_Os10g28420:12010.t02194:unspliced-genomic IQ calmodulin-binding motif family protein| Length = 1542 Score = 31.3 bits (62), Expect(2) = 1.0 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +2 / +3 Query: 611 HILSPCGRKRERSTYVEPALHGQHSVV 691 H P R+R R V P LHGQH+V+ Sbjct: 1095 HSAIPRRRRRRRRRRVLPQLHGQHAVL 1175 Score = 23.5 bits (45), Expect(2) = 1.0 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +1 / +2 Query: 274 RRHPASGLLQRRQEIGRRSAEHR*QASGVQVHQERCRWVKRWQGRR 411 RR G R + +G + R ++ + R RW +R GRR Sbjct: 8 RRGGG*GASWRGRRMGVGGDQGRGSSTAAATRRRRWRWRRRVPGRR 145
>LOC_Os05g02980:12005.t00195:unspliced-genomic expressed protein| Length = 1246 Score = 27.2 bits (53), Expect(3) = 1.0 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +3 / -2 Query: 309 SRDWPAQRRAPLTSKRCASASRALPLG 389 S W R P T++RC SAS P G Sbjct: 780 SAQWRPGWRPPPTTRRCYSASAPAPPG 700 Score = 23.1 bits (44), Expect(3) = 1.0 Identities = 7/25 (28%), Positives = 14/25 (56%) Frame = +1 / -2 Query: 22 YYLSSCIPHDPPVQSLSKSSYLIIC 96 ++ SC PH+P + ++ +I C Sbjct: 1002 FFFCSCQPHEP*RSNQEENEIIIPC 928 Score = 21.7 bits (41), Expect(3) = 1.0 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 / -1 Query: 394 RWQGRRHPL 420 RW+GRR PL Sbjct: 274 RWRGRRLPL 248
>LOC_Os10g39930:12010.t03236:unspliced-genomic cytochrome P450 97B2, putative, expressed| Length = 4978 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 / +2 Query: 554 GYLHNHTHTHTHIYMN 601 G+ H HTHTHTH + N Sbjct: 3536 GHTHTHTHTHTHTHTN 3583 Score = 31.3 bits (62), Expect = 7.8 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 / +3 Query: 520 PAIDAETLSTLRIFTQPHTHTHTH 591 P I TL+ L T HTHTHTH Sbjct: 3504 PLIIELTLNHLDTHTHTHTHTHTH 3575 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYMNK 604 + H HTHTHTH + +K Sbjct: 3535 WTHTHTHTHTHTHTHK 3582
>LOC_Os07g49370:12007.t04565:unspliced-genomic beta3-glucuronyltransferase, putative, expressed| Length = 5891 Score = 34.1 bits (68), Expect = 1.2 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +2 / +2 Query: 566 NHTHTHTHIYMNK*SHILSPCGRKRE 643 +HTHTHTHIY+ +I S C K E Sbjct: 4844 SHTHTHTHIYIYIYIYIYSVCVSKVE 4921 Score = 31.3 bits (62), Expect = 7.9 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -1 / -3 Query: 645 LSLFLPHGDNI*DHLFIYMCVCVCV 571 +S L H I +++IY+CVCVCV Sbjct: 4923 VSTLLTHTLYIYIYIYIYICVCVCV 4849 Score = 31.3 bits (62), Expect = 7.9 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCV 571 +++IYMCVCVCV Sbjct: 4882 YIYIYMCVCVCV 4847
>LOC_Os07g48350:12007.t04584:unspliced-genomic expressed protein| Length = 7866 Score = 34.1 bits (68), Expect = 1.2 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 Y H HTHTHTH + SH+ Sbjct: 2108 YTHTHTHTHTHTHFYCVSHV 2167 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIY 595 + H HTHTHTH Y Sbjct: 2114 HTHTHTHTHTHFY 2152 Score = 31.3 bits (62), Expect = 7.8 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 / +3 Query: 563 HNHTHTHTHIYMNK*SHI 616 H HTHTHTH + + SH+ Sbjct: 2112 HTHTHTHTHTHTSIVSHM 2165
>LOC_Os05g51400:12005.t04568:unspliced-genomic protein kinase APK1B, chloroplast precursor, putative| Length = 4166 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIY 595 + HNHTHTHTH Y Sbjct: 1419 HTHNHTHTHTHTY 1381
>LOC_Os01g63400:12001.t05709:unspliced-genomic rf1 protein, mitochondrial precursor, putative, expressed| Length = 4568 Score = 34.1 bits (68), Expect = 1.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 / +2 Query: 518 LQLSMLRR*VR*GYLHNHTHTHTHIYM 598 L ++ R+ H HTHTHTHIY+ Sbjct: 2321 LSCTLRRKSAHCAVAHTHTHTHTHIYI 2401 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +2 / +1 Query: 563 HNHTHTHTHIYM 598 H HTHTHTHIY+ Sbjct: 2368 HTHTHTHTHIYI 2403 Score = 33.6 bits (67), Expect = 1.6 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 / -3 Query: 600 FIYMCVCVCVWLCKYPQ 550 +IYMCVCVCV +C Q Sbjct: 2403 YIYMCVCVCVCVCATAQ 2353 Score = 33.1 bits (66), Expect = 2.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IYM Sbjct: 2364 HTHTHTHTHTYIYM 2405 Score = 32.2 bits (64), Expect = 4.2 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = -1 / -2 Query: 603 LFIYMCVCVCVWLC 562 ++IY+CVCVCV +C Sbjct: 2404 IYIYVCVCVCVCVC 2363 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 / +3 Query: 563 HNHTHTHTHIYM 598 H HTHTHTH Y+ Sbjct: 2364 HTHTHTHTHTYI 2399
>LOC_Os12g21600:12012.t01902:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 7010 Score = 34.1 bits (68), Expect = 1.2 Identities = 7/17 (41%), Positives = 15/17 (88%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+C+C+C+ +C Y Sbjct: 4871 YMYIYICICICICICIY 4921
>LOC_Os11g05010:12011.t00394:unspliced-genomic metal ion binding protein, putative, expressed| Length = 3036 Score = 34.1 bits (68), Expect = 1.2 Identities = 23/67 (34%), Positives = 32/67 (47%) Frame = +1 / +1 Query: 265 QRQRRHPASGLLQRRQEIGRRSAEHR*QASGVQVHQERCRWVKRWQGRRHPLQVRRQRPL 444 +R +R P + +R+Q RR R QA QER R ++ QG R + RRQ P Sbjct: 1756 RRWQRDPRADQGERQQRRWRRQERLRCQAEPRWRRQERRRAAEQRQGGRRRPERRRQPPC 1935 Query: 445 LHQHFRR 465 + RR Sbjct: 1936 SGEEGRR 1956
>LOC_Os07g33730:12007.t03051:unspliced-genomic NB-ARC domain containing protein, expressed| Length = 5913 Score = 34.1 bits (68), Expect = 1.2 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -1 / +3 Query: 609 DHLFIYMCVCVCVWLCKYPQRTQRLSID 526 D LF +CVCVCV +C T +LS D Sbjct: 4737 DDLFTSLCVCVCVCVCVCIPMTIKLSSD 4820 Score = 31.3 bits (62), Expect = 7.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 / +2 Query: 603 LFIYMCVCVCVWLCKYPQRTQ 541 ++I +CVCVCV +C Y Q Sbjct: 4745 VYISLCVCVCVCVCVYSNDNQ 4807
>LOC_Os06g19800:12006.t01798:unspliced-genomic BURP domain containing protein, expressed| Length = 8872 Score = 34.1 bits (68), Expect = 1.2 Identities = 7/17 (41%), Positives = 15/17 (88%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+C+C+C+ +C Y Sbjct: 3501 YMYIYICICICICICIY 3451
>LOC_Os06g04169:12006.t00307:unspliced-genomic catalytic/ hydrolase, putative, expressed| Length = 6329 Score = 34.1 bits (68), Expect = 1.2 Identities = 19/56 (33%), Positives = 25/56 (44%) Frame = +1 / +1 Query: 271 QRRHPASGLLQRRQEIGRRSAEHR*QASGVQVHQERCRWVKRWQGRRHPLQVRRQR 438 +RR P + RR+ G A HR + G H R R + RRH RR+R Sbjct: 5008 RRRAPPRRVHPRRRRQGAPGARHRLRPQGPHHHHRRPGEALRHRARRHLAPERRRR 5175
>LOC_Os03g06700:12003.t00537:unspliced-genomic fatty acid elongase, putative, expressed| Length = 4195 Score = 34.1 bits (68), Expect = 1.2 Identities = 8/15 (53%), Positives = 14/15 (93%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCVWLC 562 H++IYMCVC+ +++C Sbjct: 1266 HIYIYMCVCIYIYIC 1222
>LOC_Os02g09100:12002.t00757:unspliced-genomic isoleucine-tRNA ligase-like protein, putative, expressed| Length = 10767 Score = 34.1 bits (68), Expect = 1.2 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -1 / +1 Query: 603 LFIYMCVCVCVWLC 562 ++IYMCVCVCV +C Sbjct: 1861 IYIYMCVCVCVCVC 1902 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +2 / -2 Query: 563 HNHTHTHTHIYM 598 H HTHTHTHIY+ Sbjct: 1901 HTHTHTHTHIYI 1866 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +2 / -1 Query: 563 HNHTHTHTHIYM 598 H HTHTHTHIY+ Sbjct: 1899 HTHTHTHTHIYI 1864 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 1860 YIYIYVCVCVCVCVC 1904 Score = 33.1 bits (66), Expect = 2.2 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -1 / +2 Query: 603 LFIYMCVCVCVWLC 562 L+IY+CVCVCV +C Sbjct: 1859 LYIYICVCVCVCVC 1900 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHT+IY+ Sbjct: 1903 HTHTHTHTHTYIYI 1862 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 / -3 Query: 563 HNHTHTHTHIYM 598 H HTHTHTH Y+ Sbjct: 1903 HTHTHTHTHTYI 1868
>LOC_Os02g06360:12002.t00534:unspliced-genomic expressed protein| Length = 3162 Score = 34.1 bits (68), Expect = 1.2 Identities = 21/64 (32%), Positives = 29/64 (45%) Frame = +1 / +3 Query: 277 RHPASGLLQRRQEIGRRSAEHR*QASGVQVHQERCRWVKRWQGRRHPLQVRRQRPLLHQH 456 R P G+L R+++ R AE A +VH +R RRH L + R+ P Sbjct: 165 RRPRRGVLHGRRQVRDRGAEAGADAGVARVHPRGVPVPRRRAPRRHRLGLPRRPPRPALQ 344 Query: 457 FRRL 468 RRL Sbjct: 345 VRRL 356
>LOC_Os01g10110:12001.t00886:unspliced-genomic cytokinin dehydrogenase 1 precursor, putative, expressed| Length = 5576 Score = 34.1 bits (68), Expect = 1.2 Identities = 7/15 (46%), Positives = 14/15 (93%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCVWLC 562 ++++YMCVC+C+ +C Sbjct: 5487 YIYVYMCVCICICIC 5531 Score = 31.3 bits (62), Expect = 7.9 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLCKY 556 H++IYM +CVCV++ Y Sbjct: 5479 HIYIYMYICVCVYVYVY 5529
>LOC_Os09g08730:12009.t00667:unspliced-genomic nucleic acid binding NABP, putative| Length = 4689 Score = 28.1 bits (55), Expect(2) = 1.2 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 / +2 Query: 520 PAIDAETLSTLRIFTQPHTHTHTH 591 PA L +F HTHTHTH Sbjct: 3365 PARTKSLLVLTTMFVVDHTHTHTH 3436 Score = 23.1 bits (44), Expect(2) = 1.2 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 / +1 Query: 572 THTHTHIYMNK*SH 613 THTHTH+ + +H Sbjct: 3442 THTHTHVSAHTKTH 3483
>LOC_Os11g42000:12011.t03731:unspliced-genomic protein FRA10AC1, putative, expressed| Length = 4690 Score = 30.9 bits (61), Expect(2) = 1.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 / +3 Query: 355 GVQVHQERCRWVKRWQGRRHPLQVRRQ 435 G +V + R RW +RW G P RR+ Sbjct: 39 GGEVEEARARWRRRWGGSNPPSLTRRR 119 Score = 24.9 bits (48), Expect(2) = 1.5 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 / +1 Query: 566 NHTHTHTHIYMN 601 NH H HT IY+N Sbjct: 2950 NH*HNHTFIYVN 2985
>LOC_Os12g26290:12012.t02343:unspliced-genomic alpha-DOX2, putative, expressed| Length = 10360 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +2 / +3 Query: 563 HNHTHTHTHIYM 598 H HTHTHTHIY+ Sbjct: 267 HTHTHTHTHIYI 302 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 / -1 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+CVCVCV +C Sbjct: 310 YIYIYICVCVCVCVC 266 Score = 31.3 bits (62), Expect = 7.9 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCV 571 +++IYMCVCVCV Sbjct: 308 YIYIYMCVCVCV 273
>LOC_Os11g33450:12011.t02939:unspliced-genomic conserved hypothetical protein| Length = 3772 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 Y++ HTHTHTH + + +HI Sbjct: 2830 YIYTHTHTHTHTHTHTHTHI 2889 Score = 33.6 bits (67), Expect = 1.6 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 Y H HTHTHTH + + HI Sbjct: 2838 YTHTHTHTHTHTHTHTYIHI 2897 Score = 33.6 bits (67), Expect = 1.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 + H HTHTHTH Y++ HI Sbjct: 2850 HTHTHTHTHTHTYIHIHIHI 2909 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIY 595 + H HTHTHTHIY Sbjct: 2852 HTHTHTHTHTHIY 2890 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIY 595 + H HTHTHTHIY Sbjct: 2854 HTHTHTHTHTHIY 2892 Score = 32.7 bits (65), Expect = 3.0 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIY 595 Y+H HTHTHTH + Sbjct: 2834 YIHTHTHTHTHTH 2872 Score = 32.7 bits (65), Expect = 3.0 Identities = 8/15 (53%), Positives = 14/15 (93%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWLC 562 ++++Y+CVCVCV +C Sbjct: 2903 YMYVYICVCVCVCVC 2859 Score = 32.2 bits (64), Expect = 4.1 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 Y++ HTHTHTH + + +HI Sbjct: 2828 YIYIHTHTHTHTHTHTHTHI 2887 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCVWLC 562 ++ +YMCVCVCV +C Sbjct: 2901 YVCVYMCVCVCVCVC 2857 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIY 595 Y H HTHTHTH + Sbjct: 2836 YTHTHTHTHTHTH 2874 Score = 31.3 bits (62), Expect = 7.9 Identities = 7/17 (41%), Positives = 15/17 (88%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+C+CVC+++ Y Sbjct: 2957 YIYIYICMCVCIYIYMY 2907
>LOC_Os08g42210:12008.t03950:unspliced-genomic cation cation antiporter, putative, expressed| Length = 5466 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 / -2 Query: 199 YEEHSGHHGDQHELSSCRTG 140 + EH+GHH D+ L +CR G Sbjct: 2927 HNEHAGHHEDEQPLEACRLG 2868
>LOC_Os06g46330:12006.t04319:unspliced-genomic serine/threonine-protein kinase receptor precursor, putative,| expressed Length = 4259 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +2 / +2 Query: 563 HNHTHTHTHIYM 598 H HTHTHTHIY+ Sbjct: 4073 HTHTHTHTHIYI 4108 Score = 31.8 bits (63), Expect = 5.7 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +2 / +1 Query: 563 HNHTHTHTHIYMNK*SHILSPCGRKRERSTYVEPAL 670 H HTHTHT+IY+ S LS +S +P L Sbjct: 4075 HTHTHTHTYIYIYIYSPFLS*INSVNCQSVIKKPLL 4182 Score = 31.3 bits (62), Expect = 7.9 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCV 571 +++IYMCVCVCV Sbjct: 4114 YIYIYMCVCVCV 4079
>LOC_Os05g22830:12005.t01942:unspliced-genomic DNA-directed RNA polymerase beta chain, putative| Length = 4309 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +2 / -2 Query: 563 HNHTHTHTHIYM 598 H HTHTHTHIY+ Sbjct: 1260 HTHTHTHTHIYI 1225 Score = 31.3 bits (62), Expect = 7.9 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -1 / +2 Query: 600 FIYMCVCVCVWLC 562 +IY+CVCVCV +C Sbjct: 1223 YIYICVCVCVCVC 1261 Score = 31.3 bits (62), Expect = 7.9 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -1 / +1 Query: 603 LFIYMCVCVCV 571 L+IYMCVCVCV Sbjct: 1222 LYIYMCVCVCV 1254
>LOC_Os04g40850:12004.t03646:unspliced-genomic 26S proteasome non-ATPase regulatory subunit 6, putative, expressed| Length = 2850 Score = 33.6 bits (67), Expect = 1.6 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYMNK*SHILSPCGRKRE 643 + H HTHTHTH + + +H S KR+ Sbjct: 407 HTHTHTHTHTHTHTHTHTHTESEARGKRK 321 Score = 31.3 bits (62), Expect = 7.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYMNK*SHILS 622 + H HTHTHTH + + +H S Sbjct: 409 HTHTHTHTHTHTHTHTHTHTQS 344 Score = 31.3 bits (62), Expect = 7.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYMNK*SHILS 622 + H HTHTHTH + H S Sbjct: 391 HTHTHTHTHTHTHTQSQKHAAS 326
>LOC_Os03g59120:12003.t05162:unspliced-genomic pheophorbide a oxygenase, chloroplast precursor, putative,| expressed Length = 2388 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYMNK*SH 613 ++H HTHTHTHI+ + H Sbjct: 874 HIHTHTHTHTHIHTHTSRH 818 Score = 32.2 bits (64), Expect = 4.1 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYMN 601 Y+H HTHTHTH +++ Sbjct: 880 YIHIHTHTHTHTHIH 836 Score = 32.2 bits (64), Expect = 4.1 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIY 595 Y++ HTHTHTH Y Sbjct: 876 YIYTHTHTHTHTY 838 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYM 598 + H HTHTHTH Y+ Sbjct: 866 HTHTHTHTHTHTYI 825 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIY 595 Y H HTHTHTH + Sbjct: 872 YTHTHTHTHTHTH 834
>LOC_Os03g46180:12003.t03987:unspliced-genomic lipid binding protein, putative, expressed| Length = 1272 Score = 33.6 bits (67), Expect = 1.6 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 / +1 Query: 218 SCGQVSSALRPCISYASGNGGILPPACCSGVK 313 SC +L PCI YA G G +CCS ++ Sbjct: 136 SCPAAPLSLSPCIGYAFGVGSATLSSCCSELR 231
>LOC_Os02g20330:12002.t01825:unspliced-genomic cation cation antiporter, putative| Length = 6835 Score = 33.6 bits (67), Expect = 1.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 / -2 Query: 199 YEEHSGHHGDQHELSSCRTG 140 + EH+GHH D+ L +CR G Sbjct: 4290 HNEHAGHHEDEQPLEACRLG 4231
>LOC_Os12g03770:12012.t00269:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4948 Score = 33.6 bits (67), Expect = 1.6 Identities = 8/17 (47%), Positives = 15/17 (88%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCVWLCKY 556 +++I +CVCVC+++C Y Sbjct: 3915 YIYICVCVCVCIYICAY 3865 Score = 33.1 bits (66), Expect = 2.2 Identities = 9/14 (64%), Positives = 14/14 (100%) Frame = -1 / -1 Query: 606 HLFIYMCVCVCVWL 565 +++IYMCVCVCV++ Sbjct: 3919 YIYIYMCVCVCVYI 3878 Score = 32.2 bits (64), Expect = 4.1 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYM 598 Y++ HTHTHT+IY+ Sbjct: 3874 YIYTHTHTHTYIYI 3915 Score = 32.2 bits (64), Expect = 4.1 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYM 598 Y+H HTHTH +IY+ Sbjct: 3878 YIHTHTHTHIYIYI 3919 Score = 32.2 bits (64), Expect = 4.2 Identities = 9/34 (26%), Positives = 23/34 (67%) Frame = -1 / +1 Query: 657 TYVLLSLFLPHGDNI*DHLFIYMCVCVCVWLCKY 556 TY+ + +++ +I H++IY+C+ + +++C Y Sbjct: 3901 TYIYIYIYIYIYIHIYKHIYIYICIYIYIYVCIY 4002 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYM 598 +++ HTHTHTHIY+ Sbjct: 3872 HIYIHTHTHTHIYI 3913 Score = 31.3 bits (62), Expect = 7.9 Identities = 8/14 (57%), Positives = 14/14 (100%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWL 565 +++IY+CVCVCV++ Sbjct: 3917 YIYIYVCVCVCVYI 3876
>LOC_Os02g10390:12002.t00887:unspliced-genomic chlorophyll a-b binding protein 8, chloroplast precursor, putative,| expressed Length = 2123 Score = 33.6 bits (67), Expect = 1.6 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -1 / +2 Query: 609 DHLFIYMCVCVCVWLCKY 556 + L +Y+C CVCV++C Y Sbjct: 1631 EFLIMYVCTCVCVYVCTY 1684
>LOC_Os01g69020:12001.t06256:unspliced-genomic fibroin heavy chain precursor, putative, expressed| Length = 1375 Score = 33.6 bits (67), Expect = 1.6 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 / -2 Query: 361 QVHQERCRWVKRWQGRRHPLQVRRQRPLLHQHFRR 465 Q ++R RW +RW R ++ QR HQH RR Sbjct: 987 QRRRQRRRWHRRWHRCRRERRLPHQRQHQHQHQRR 883 Score = 32.2 bits (64), Expect = 4.2 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +1 / -2 Query: 376 RCRWVKRWQGRRHPLQVRRQRPLLHQHFRRLL*DSLIDH 492 R RW +RW+ H Q RRQR H+ + R + + H Sbjct: 1032 RRRWHRRWRRCPHQRQRRRQRRRWHRRWHRCRRERRLPH 916
>LOC_Os12g12120:12012.t01081:unspliced-genomic verticillium wilt disease resistance protein precursor, putative,| expressed Length = 3281 Score = 27.2 bits (53), Expect(2) = 1.6 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +1 / -2 Query: 319 GRRSAEHR*QASGVQVHQERCRWVKRWQGRRHPLQV 426 GR R Q+ Q RC K W RRH L + Sbjct: 226 GRGVVTDRGVEGAFQLEQRRCLVWKAWNWRRHGLNM 119 Score = 23.5 bits (45), Expect(2) = 1.6 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 / -1 Query: 277 RHPASGLLQRRQEIGRRSAEHR 342 RH + L RR IGR + HR Sbjct: 272 RHSSGSSLCRRPMIGRPRSSHR 207
>LOC_Os07g27940:12007.t02486:unspliced-genomic nonspecific lipid-transfer protein Cw18 precursor, putative| Length = 553 Score = 27.6 bits (54), Expect(2) = 1.8 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 / +1 Query: 215 ISCGQVSSALRPCISYASGNGG 280 + CG V+S L C ++ G+GG Sbjct: 94 LHCGTVTSLLSGCAAFVRGHGG 159 Score = 23.1 bits (44), Expect(2) = 1.8 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 / +1 Query: 290 PACCSGVKRLAGAAQSTADKQAVCKCI 370 P C A AA S + +AVC+C+ Sbjct: 187 PCCDGVAGLYAVAADSADNWRAVCRCM 267
>LOC_Os04g22720:12004.t01999:unspliced-genomic expressed protein| Length = 7591 Score = 33.1 bits (66), Expect = 2.2 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = +2 / -2 Query: 566 NHTHTHTHIYMN 601 +HTHTHTHIY+N Sbjct: 5112 SHTHTHTHIYIN 5077
>LOC_Os03g11410:12003.t00941:unspliced-genomic mitochondrial-processing peptidase beta subunit, mitochondrial| precursor, putative, expressed Length = 4661 Score = 33.1 bits (66), Expect = 2.2 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYMNK 604 + H HTHTHTH Y K Sbjct: 2612 HTHTHTHTHTHTYTQK 2565 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 / -2 Query: 563 HNHTHTHTHIYMNK*SHIL 619 H HTHTHTH + +K H + Sbjct: 2608 HTHTHTHTHTHTHKNIHFI 2552 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIY 595 + H HTHTHTHI+ Sbjct: 2610 HTHTHTHTHTHIH 2572 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYMN 601 + H HTHTHTH + N Sbjct: 2608 HTHTHTHTHTHTHKN 2564
>LOC_Os02g17534:12002.t01546:unspliced-genomic fucosyltransferase 8, putative, expressed| Length = 6984 Score = 33.1 bits (66), Expect = 2.2 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYMNK*SH 613 Y+H HTHTHTH + + +H Sbjct: 2198 YIHIHTHTHTHTHTHTHTH 2142 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIY 595 Y H HTHTHTH + Sbjct: 2190 YTHTHTHTHTHTH 2152 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIY 595 Y H HTHTHTH + Sbjct: 2188 YTHTHTHTHTHTH 2150 Score = 31.3 bits (62), Expect = 7.9 Identities = 6/17 (35%), Positives = 15/17 (88%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+C+ +C+++C Y Sbjct: 2227 YVYIYVCIYICIYICMY 2277
>LOC_Os08g37930:12008.t03529:unspliced-genomic blight-associated protein p12 precursor, putative, expressed| Length = 2021 Score = 33.1 bits (66), Expect = 2.2 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -1 / +1 Query: 603 LFIYMCVCVCVWLCKY 556 L+IYMCVCVCV L Y Sbjct: 382 LYIYMCVCVCVCLFCY 429 Score = 32.2 bits (64), Expect = 4.2 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 / +3 Query: 603 LFIYMCVCVCVWLCKY 556 L+IY+CVCVCV++ Y Sbjct: 384 LYIYVCVCVCVFVLLY 431
>LOC_Os03g28990:12003.t02519:unspliced-genomic protein binding protein, putative, expressed| Length = 1933 Score = 33.1 bits (66), Expect = 2.2 Identities = 24/73 (32%), Positives = 32/73 (43%) Frame = +1 / +2 Query: 247 PLHFLCQRQRRHPASGLLQRRQEIGRRSAEHR*QASGVQVHQERCRWVKRWQGRRHPLQV 426 PLH ++RR P L+RR+ R R + + HQ + R + RR P Sbjct: 335 PLHRHLLQRRRPPLPAPLRRRRRRAGRPWGPRRRPRRRRQHQHQGGPRDRPRRRRRPPPH 514 Query: 427 RRQRPLLHQHFRR 465 RR R H H RR Sbjct: 515 RRPRGERHAHVRR 553
>LOC_Os02g38220:12002.t03460:unspliced-genomic eukaryotic translation initiation factor 4B, putative, expressed| Length = 4218 Score = 33.1 bits (66), Expect = 2.2 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +1 / +3 Query: 268 RQRRHPASGLLQRRQEIGRRSAEHR*QASGVQVHQERCRWVKRWQGR 408 R+RR P LL+ R+ R A A+ V + + R RW RW R Sbjct: 627 RRRRRPRRFLLRPRRRRQRLVAREEADANAVPLPEPRLRWRWRWLPR 767
>LOC_Os02g09520:12002.t00799:unspliced-genomic conserved hypothetical protein| Length = 318 Score = 33.1 bits (66), Expect = 2.2 Identities = 19/56 (33%), Positives = 30/56 (53%) Frame = +1 / +3 Query: 271 QRRHPASGLLQRRQEIGRRSAEHR*QASGVQVHQERCRWVKRWQGRRHPLQVRRQR 438 +RR S +RRQ+ RRS R + + + RCR +R + R HP + R++R Sbjct: 84 RRRRRPSRPSRRRQQRTRRSRRWRRRCRPSRRQRRRCRPSRRRRRRCHPSRRRQRR 251
>LOC_Os01g47400:12001.t04188:unspliced-genomic hydrolase, hydrolyzing O-glycosyl compounds, putative, expressed| Length = 3863 Score = 33.1 bits (66), Expect = 2.2 Identities = 18/37 (48%), Positives = 20/37 (54%) Frame = +1 / +1 Query: 274 RRHPASGLLQRRQEIGRRSAEHR*QASGVQVHQERCR 384 RR A G QRR GRR+ HR Q GVQ + R R Sbjct: 301 RRPVAEGQGQRRARRGRRARPHRRQDVGVQRRRRRQR 411
>LOC_Os01g19170:12001.t01707:unspliced-genomic polygalacturonase precursor, putative, expressed| Length = 1796 Score = 33.1 bits (66), Expect = 2.2 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +1 / +3 Query: 298 LQRRQEIGRRSAEHR*QASGVQVHQERCRWVKRWQGRRH 414 LQRR+ + + A R A+GV+ H+ R ++R + RRH Sbjct: 1518 LQRRRAVHQHHALRRRAAAGVRRHRRRALLLERLRQRRH 1634
>LOC_Os08g11470:12008.t01029:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class, expressed| Length = 4624 Score = 31.3 bits (62), Expect(2) = 2.7 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCV 571 +++IYMCVCVCV Sbjct: 4205 YIYIYMCVCVCV 4170 Score = 23.5 bits (45), Expect(2) = 2.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -1 / -2 Query: 366 HLHTACLSAVLCAAPAN 316 H HT+C VLC+ N Sbjct: 2007 HSHTSCKGIVLCSLLLN 1957 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYM 598 Y + HTHTHTHIY+ Sbjct: 4158 YNYTHTHTHTHIYI 4199 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +2 / +2 Query: 560 LHNHTHTHTHIYM 598 LH HTHTHT+IY+ Sbjct: 4163 LHTHTHTHTYIYI 4201 Score = 31.3 bits (62), Expect = 7.9 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 / -2 Query: 603 LFIYMCVCVCVWLCKY 556 L+IY+ VCVCV +C Y Sbjct: 4206 LYIYIYVCVCVCVCSY 4159
>LOC_Os05g46210:12005.t04109:unspliced-genomic esterase, putative, expressed| Length = 3656 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +2 / +3 Query: 551 *GYLHNHTHTHTH 589 *GY++ HTHTHTH Sbjct: 1146 *GYIYRHTHTHTH 1184
>LOC_Os03g30500:12003.t02657:unspliced-genomic hypothetical protein| Length = 625 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +2 / -1 Query: 560 LHNHTHTHTHIYM 598 LH HTHTHT+IY+ Sbjct: 502 LHTHTHTHTYIYI 464 Score = 31.8 bits (63), Expect = 5.7 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLCKYPQRTQR 538 +++IYMCVCVCV + T R Sbjct: 460 YIYIYMCVCVCVCAARGTTGTAR 528
>LOC_Os03g22210:12003.t01973:unspliced-genomic phylloplanin precursor, putative, expressed| Length = 1409 Score = 32.7 bits (65), Expect = 3.0 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYM 598 Y + HTHTHTHIY+ Sbjct: 369 YRNTHTHTHTHIYI 410 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYM 598 ++ HTHTHTHIY+ Sbjct: 367 FIGTHTHTHTHIYI 408 Score = 31.3 bits (62), Expect = 7.9 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+ VCVCV +C Y Sbjct: 420 YIYIYIYVCVCVCVCSY 370 Score = 31.3 bits (62), Expect = 7.9 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 / -1 Query: 606 HLFIYMCVCVCV 571 +++IYMCVCVCV Sbjct: 416 YIYIYMCVCVCV 381
>LOC_Os03g12620:12003.t01061:unspliced-genomic glucan endo-1,3-beta-glucosidase 7 precursor, putative, expressed| Length = 4530 Score = 32.7 bits (65), Expect = 3.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYMNK*SHI 616 Y++ +THTHTH Y + * HI Sbjct: 1094 YIYIYTHTHTHTYTHT*YHI 1035 Score = 32.2 bits (64), Expect = 4.1 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +2 / -3 Query: 557 YLHNHTHTHTH 589 Y+H HTHTHTH Sbjct: 1084 YIHTHTHTHTH 1052
>LOC_Os01g64770:12001.t05843:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 4777 Score = 32.7 bits (65), Expect = 3.0 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYMNK*SHILSPCGRKR 640 + H HTHTHTH + +K + C K+ Sbjct: 3649 HTHTHTHTHTHTHTHKRVSRIKECVTKK 3566 Score = 31.8 bits (63), Expect = 5.7 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 / -3 Query: 563 HNHTHTHTHIYMNK*SHILSPCGRKR 640 H HTHTHTH + + +H KR Sbjct: 3659 HTHTHTHTHTHTHTHTHTQESVQNKR 3582 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 / -2 Query: 560 LHNHTHTHTHIYMNK*SH 613 +H HTHTHTH + + +H Sbjct: 3666 IHTHTHTHTHTHTHTHTH 3613 Score = 31.3 bits (62), Expect = 7.8 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 / -1 Query: 563 HNHTHTHTHIYMNK*SHILSPCGRKRE 643 H HTHTHTH + + +H R +E Sbjct: 3661 HTHTHTHTHTHTHTHTHTHKRVSRIKE 3581
>LOC_Os06g31950:12006.t02894:unspliced-genomic retrotransposon, putative, centromere-specific| Length = 4621 Score = 32.7 bits (65), Expect = 3.0 Identities = 11/21 (52%), Positives = 17/21 (80%) Frame = -1 / -3 Query: 618 NI*DHLFIYMCVCVCVWLCKY 556 N * +++IY+CVCVCV++ Y Sbjct: 2708 NR*IYIYIYICVCVCVYVSIY 2646 Score = 31.3 bits (62), Expect = 7.9 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCV 571 +++IYMCVCVCV Sbjct: 2694 YIYIYMCVCVCV 2659
>LOC_Os02g07340:12002.t00631:unspliced-genomic HEAT repeat family protein, expressed| Length = 13787 Score = 32.7 bits (65), Expect = 3.0 Identities = 8/14 (57%), Positives = 13/14 (92%) Frame = -1 / -3 Query: 597 IYMCVCVCVWLCKY 556 +Y+C+CVCV++C Y Sbjct: 6750 VYVCMCVCVYVCMY 6709 Score = 32.2 bits (64), Expect = 4.1 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYM 598 Y+H HTHT+TH +M Sbjct: 6714 YIHTHTHTYTHTHM 6755
>LOC_Os01g45320:12001.t03988:unspliced-genomic protein binding protein, putative| Length = 1770 Score = 32.7 bits (65), Expect = 3.0 Identities = 21/65 (32%), Positives = 27/65 (41%) Frame = +1 / +3 Query: 274 RRHPASGLLQRRQEIGRRSAEHR*QASGVQVHQERCRWVKRWQGRRHPLQVRRQRPLLHQ 453 +RHP R R+ R + G++ HQ R R + R P RR R H Sbjct: 336 QRHPPLPAALRHGGRAGRAQGPRRRPQGLRRHQHEGRPRDRHERCRRPQSGRRPRRQRHA 515 Query: 454 HFRRL 468 H RRL Sbjct: 516 HVRRL 530
>LOC_Os01g13560:12001.t01218:unspliced-genomic plant integral membrane protein TIGR01569 containing protein,| expressed Length = 1443 Score = 32.7 bits (65), Expect = 3.0 Identities = 8/11 (72%), Positives = 11/11 (100%) Frame = -1 / -3 Query: 594 YMCVCVCVWLC 562 ++CVCVCVW+C Sbjct: 181 HLCVCVCVWMC 149
>LOC_Os11g19160:12011.t01685:unspliced-genomic beta-D-xylosidase, putative, expressed| Length = 4225 Score = 29.5 bits (58), Expect(2) = 3.3 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYM 598 Y++ HTHTHT++ M Sbjct: 1463 YIYTHTHTHTYVCM 1504 Score = 24.9 bits (48), Expect(2) = 3.3 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +1 / +3 Query: 406 RRHPLQVRRQRPLLHQHFRRLL*DSLIDH 492 R+ P R Q P H H RRL L+ H Sbjct: 555 RQRPRAHRHQLPAGHPHRRRLRRRPLVPH 641
>LOC_Os03g49440:12003.t04292:unspliced-genomic phosphatase, putative, expressed| Length = 3229 Score = 27.6 bits (54), Expect(2) = 3.5 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -1 / +1 Query: 603 LFIYMCVCVCVW 568 L + C+CVCVW Sbjct: 3157 LLFFFCLCVCVW 3192 Score = 26.3 bits (51), Expect(2) = 3.5 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 / +3 Query: 681 CWPCRAGSTYVLLS 640 CWPCR Y+ +S Sbjct: 2082 CWPCRIRKAYIPIS 2123
>LOC_Os04g33610:12004.t03037:unspliced-genomic expressed protein| Length = 973 Score = 27.2 bits (53), Expect(2) = 4.0 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 / +1 Query: 391 KRWQGRRHPLQVRRQR 438 +RW RR P+ VRR+R Sbjct: 295 RRWPPRRRPIPVRRRR 342 Score = 24.9 bits (48), Expect(2) = 4.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 / +1 Query: 321 PAQRRAPLTSKRCAS 365 PA R P TSKRC S Sbjct: 82 PAAWRLPATSKRCRS 126
>LOC_Os01g50750:12001.t04509:unspliced-genomic protein binding protein, putative, expressed| Length = 2235 Score = 24.9 bits (48), Expect(2) = 4.1 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 / -3 Query: 526 IDAETLSTLRIFTQPHTHTHTH 591 I + + ++ + HTHTHTH Sbjct: 2035 ISIDHIREMQQHRKQHTHTHTH 1970 Score = 24.4 bits (47), Expect(2) = 4.1 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 / -2 Query: 572 THTHTHIYMNK*SH 613 THTHTH N +H Sbjct: 1991 THTHTHTQKNSFTH 1950
>LOC_Os09g28570:12009.t02535:unspliced-genomic zinc-binding alcohol dehydrogenase domain-containing protein 2,| putative, expressed Length = 11950 Score = 32.2 bits (64), Expect = 4.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 / -1 Query: 563 HNHTHTHTHIYMN 601 H HTHTHTH MN Sbjct: 598 HKHTHTHTHTLMN 560 Score = 31.8 bits (63), Expect = 5.7 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 / +3 Query: 609 DHLFIYMCVCVCVWLC 562 +H F+ +CVCVCV LC Sbjct: 552 NHQFMSVCVCVCVCLC 599
>LOC_Os09g12650:12009.t01054:unspliced-genomic pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha| subunit, putative, expressed Length = 4766 Score = 32.2 bits (64), Expect = 4.1 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYM 598 Y++ HTHTHTH +M Sbjct: 3252 YIYTHTHTHTHTHM 3293 Score = 32.2 bits (64), Expect = 4.1 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +2 / +1 Query: 557 YLHNHTHTHTH 589 Y+H HTHTHTH Sbjct: 3256 YIHTHTHTHTH 3288 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHI 592 Y H HTHTHTH+ Sbjct: 3258 YTHTHTHTHTHM 3293 Score = 31.3 bits (62), Expect = 7.8 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYMNK 604 Y H HTHTHTH +K Sbjct: 3260 YTHTHTHTHTHAIGSK 3307
>LOC_Os07g31870:12007.t04717:unspliced-genomic expressed protein| Length = 20526 Score = 32.2 bits (64), Expect = 4.1 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 / +2 Query: 321 PAQRRAPLTSKRCASASRAL 380 P+ RRAP+ S+RC +A RAL Sbjct: 15446 PSPRRAPVPSRRCPAAPRAL 15505
>LOC_Os07g06620:12007.t00541:unspliced-genomic protein YABBY, putative, expressed| Length = 7701 Score = 32.2 bits (64), Expect = 4.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIY 595 Y H HTHTHTH Y Sbjct: 4049 Y*HTHTHTHTHTY 4087
>LOC_Os06g23140:12006.t02126:unspliced-genomic amine oxidase precursor, putative| Length = 2543 Score = 32.2 bits (64), Expect = 4.1 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYM 598 Y H HTHTHTH ++ Sbjct: 1817 YTHTHTHTHTHTHL 1776
>LOC_Os02g06490:12002.t00547:unspliced-genomic vacuolar protein sorting-associated protein VPS4, putative, expressed| Length = 3660 Score = 32.2 bits (64), Expect = 4.1 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 / -2 Query: 560 LHNHTHTHTHIYMNK*SHILSPC 628 +H HTHTHTH + + + IL C Sbjct: 1748 IHRHTHTHTHTHTHTQN*ILHHC 1680
>LOC_Os01g25240:12001.t02242:unspliced-genomic expressed protein| Length = 4456 Score = 32.2 bits (64), Expect = 4.1 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYMNK 604 + H HTHTHTH + N+ Sbjct: 344 HTHTHTHTHTHTHSNR 297 Score = 25.4 bits (49), Expect(2) = 5.2 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 / -3 Query: 556 IFTQPHTHTHTH 591 IFT+ THTHTH Sbjct: 377 IFTRLVTHTHTH 342 Score = 23.5 bits (45), Expect(2) = 5.2 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 / -3 Query: 572 THTHTHIYMNK*SHILSPCGRK 637 THTHTH + + +H + R+ Sbjct: 359 THTHTHTHTHTHTHTHTHSNRR 294 Score = 31.8 bits (63), Expect = 5.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 / -2 Query: 563 HNHTHTHTHIYMNK*SHIL 619 H HTHTHTH + + +H L Sbjct: 360 HTHTHTHTHTHTHTHTHTL 304 Score = 31.3 bits (62), Expect = 7.8 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYMNK*SH 613 + H HTHTHTH K H Sbjct: 342 HTHTHTHTHTHTLKQKNDH 286
>LOC_Os09g09930:12009.t00785:unspliced-genomic heavy metal-associated domain containing protein, expressed| Length = 1760 Score = 26.7 bits (52), Expect(2) = 4.2 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 / +2 Query: 265 QRQRRHPASGLLQRRQEIGRRSAEHR 342 Q + R A LL+RRQE GRR R Sbjct: 800 QPRPRRAAQRLLRRRQEDGRRRRPRR 877 Score = 22.6 bits (43), Expect(2) = 4.2 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 / +2 Query: 382 RWVKRWQGRRHPLQVRRQ 435 RW +R RR P + RRQ Sbjct: 896 RWPRRHGVRRRPRRQRRQ 949
>LOC_Os11g42210:12011.t03752:unspliced-genomic hypothetical protein| Length = 2918 Score = 32.2 bits (64), Expect = 4.2 Identities = 19/54 (35%), Positives = 25/54 (46%) Frame = +1 / -1 Query: 31 SSCIPHDPPVQSLSKSSYLIICGLAHHHYYC*LDRNGPFCSYSARAGRHGGRYA 192 SS D V+SLS SS +++ + Y C D + S S R GR R A Sbjct: 2117 SSSDSEDMVVRSLSSSSSIVVAAVVRAGYVCCADAHADERSSSRRCGRWRTRRA 1956
>LOC_Os11g29840:12011.t02588:unspliced-genomic expressed protein| Length = 5524 Score = 32.2 bits (64), Expect = 4.2 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +1 / +2 Query: 406 RRHPLQVRRQRPLLHQHFR 462 RR PL +RRQRP H+H R Sbjct: 2534 RRRPLHLRRQRPSHHRHAR 2590
>LOC_Os09g39790:12009.t03443:unspliced-genomic triacylglycerol lipase, putative, expressed| Length = 2877 Score = 32.2 bits (64), Expect = 4.2 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -1 / +1 Query: 603 LFIYMCVCVCVWLCKYPQRTQR 538 L+ ++CVCVCV +CK + R Sbjct: 2707 LYSFVCVCVCVCVCKGKNKNNR 2772
>LOC_Os08g07560:12008.t00645:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4802 Score = 32.2 bits (64), Expect = 4.2 Identities = 7/17 (41%), Positives = 15/17 (88%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLCKY 556 +++I +C+CVC+++C Y Sbjct: 3985 YIYICICICVCIYMCIY 4035
>LOC_Os06g43670:12006.t04057:unspliced-genomic Leucine Rich Repeat family protein, expressed| Length = 12542 Score = 32.2 bits (64), Expect = 4.2 Identities = 15/56 (26%), Positives = 23/56 (41%) Frame = +1 / +2 Query: 271 QRRHPASGLLQRRQEIGRRSAEHR*QASGVQVHQERCRWVKRWQGRRHPLQVRRQR 438 +R+H + +G A+ R A+G H W ++W RR RR R Sbjct: 6908 ERKHAGDKQAEECSRVGGEQAKERQPAAGYASHGGAR*WSEKWASRRTTSDDRRSR 7075
>LOC_Os03g59840:12003.t05228:unspliced-genomic conserved hypothetical protein| Length = 3266 Score = 32.2 bits (64), Expect = 4.2 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = +1 / -2 Query: 268 RQRRHPASGLLQRRQEIGRRSAEHR*QASGVQVHQERCRWVKRWQGRRHPLQV 426 R RRH +RR+ RR R + H+ RCR +R + RRH V Sbjct: 262 RCRRHRCCRRHRRRRRHSRRRCRRRHHRRRRRHHRRRCRRRRRRRHRRHQTPV 104
>LOC_Os03g54040:12003.t04719:unspliced-genomic 50S ribosomal protein L6, putative, expressed| Length = 3588 Score = 32.2 bits (64), Expect = 4.2 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -1 / +2 Query: 609 DHLFIYMCVCVCVWLCKYPQRTQRLS 532 D I+ CVCVW+C P T LS Sbjct: 443 DEGIIFFFFCVCVWVCVVPYLTGMLS 520
>LOC_Os02g28074:12002.t02500:unspliced-genomic XRN 5-3 exonuclease N-terminus family protein, expressed| Length = 16540 Score = 32.2 bits (64), Expect = 4.2 Identities = 6/17 (35%), Positives = 15/17 (88%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCVWLCKY 556 ++++YM +C+C+++C Y Sbjct: 3288 YMYMYMYICICIYICMY 3238 Score = 32.2 bits (64), Expect = 4.2 Identities = 7/17 (41%), Positives = 15/17 (88%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+ VC+C+++C Y Sbjct: 3222 YMYIYIYVCICIYICMY 3172 Score = 31.8 bits (63), Expect = 5.7 Identities = 6/16 (37%), Positives = 14/16 (87%) Frame = -1 / -3 Query: 603 LFIYMCVCVCVWLCKY 556 ++I +C+C+C+++C Y Sbjct: 3359 IYICICICICIYICMY 3312
>LOC_Os01g33430:12001.t02910:unspliced-genomic Leucine Rich Repeat family protein| Length = 5057 Score = 32.2 bits (64), Expect = 4.2 Identities = 7/15 (46%), Positives = 14/15 (93%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWLC 562 ++++YMC+C+CV +C Sbjct: 540 YVYMYMCICICVCVC 496 Score = 31.8 bits (63), Expect = 5.7 Identities = 6/17 (35%), Positives = 15/17 (88%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCVWLCKY 556 ++++YM +C+C+++C Y Sbjct: 334 YVYMYMYICICIYICMY 284 Score = 31.8 bits (63), Expect = 5.7 Identities = 7/17 (41%), Positives = 15/17 (88%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+C+ VC+++C Y Sbjct: 306 YVYIYVCIYVCIYICMY 256 Score = 31.8 bits (63), Expect = 5.7 Identities = 7/17 (41%), Positives = 15/17 (88%) Frame = -1 / -1 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+C+ VC+++C Y Sbjct: 278 YVYIYVCIYVCIYICMY 228 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYM 598 Y+H HTHTH HI++ Sbjct: 485 YIHIHTHTHIHIHI 526 Score = 31.3 bits (62), Expect = 7.9 Identities = 6/17 (35%), Positives = 15/17 (88%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+C+ +C+++C Y Sbjct: 250 YVYIYVCIYICIYICMY 200
>LOC_Os01g18584:12001.t01651:unspliced-genomic OsWRKY9 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 8261 Score = 30.9 bits (61), Expect(2) = 4.3 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 / +2 Query: 557 YLHNHTHTHTHIYMNK 604 + H HTHTHTH + K Sbjct: 3644 HCHTHTHTHTHTHTQK 3691 Score = 24.0 bits (46), Expect(2) = 4.3 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +1 / +1 Query: 490 HLLPSFLPIAPAIDAET 540 H+L ++L I P IDA+T Sbjct: 2101 HVLTTYLLILPNIDADT 2151
>LOC_Os01g57280:12001.t05134:unspliced-genomic rp1-like protein, putative, expressed| Length = 6479 Score = 29.0 bits (57), Expect(2) = 4.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 / -2 Query: 603 LFIYMCVCVCVWLCK 559 L ++CVCVC WL K Sbjct: 1684 LSFFLCVCVCDWLWK 1640 Score = 25.4 bits (49), Expect(2) = 4.8 Identities = 7/19 (36%), Positives = 15/19 (78%) Frame = -3 / -3 Query: 697 HRYNRVLAMQSWLNVRTSL 641 ++Y +L+ SW++VRT++ Sbjct: 4569 YQYPSILSASSWMSVRTTM 4513
>LOC_Os06g19854:12006.t01803:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 9933 Score = 25.8 bits (50), Expect(2) = 4.9 Identities = 5/12 (41%), Positives = 12/12 (100%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCV 571 ++++Y+CVC+C+ Sbjct: 3272 YVYMYVCVCICM 3307 Score = 23.1 bits (44), Expect(2) = 4.9 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -1 / +3 Query: 582 CVCVWLCKY 556 CVCV++C Y Sbjct: 3309 CVCVYVCMY 3335
>LOC_Os04g30240:12004.t02711:unspliced-genomic OsWAK60 - OsWAK receptor-like protein kinase, expressed| Length = 7310 Score = 29.0 bits (57), Expect(2) = 5.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 / +1 Query: 318 WPAQRRAPLTSKRCASASRALPLG 389 WP+ AP ++ R + SR LPLG Sbjct: 3697 WPSPTAAPESASRGGARSRRLPLG 3768 Score = 25.4 bits (49), Expect(2) = 5.2 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 / +1 Query: 67 LSKSSYLIICGLAHHHYY 120 L+ YL IC H HYY Sbjct: 3244 LNTPIYLYICNTRHIHYY 3297
>LOC_Os01g17130:12001.t01561:unspliced-genomic disease resistance protein, putative| Length = 3062 Score = 26.3 bits (51), Expect(2) = 5.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 / +3 Query: 284 GCRRCRWHRKCRGARQS 234 G +RC W RK +G R++ Sbjct: 246 GSQRCSWERKRKGRRRA 296 Score = 22.6 bits (43), Expect(2) = 5.3 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = -3 / +1 Query: 205 GGYEEHSGHH 176 GG +H GHH Sbjct: 418 GGVSDHGGHH 447
>LOC_Os03g48104:12003.t05726:unspliced-genomic expressed protein| Length = 1471 Score = 30.4 bits (60), Expect(2) = 5.7 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +2 / +2 Query: 557 YLHNHTHTHTH 589 Y H HTHTHTH Sbjct: 161 YSHGHTHTHTH 193 Score = 21.7 bits (41), Expect(2) = 5.7 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 / +1 Query: 485 STTCCRRFCL*LQLSMLRR* 544 +TT C RF + +Q LRR* Sbjct: 37 ATTVCYRFSITVQHIFLRR* 96
>LOC_Os11g06690:12011.t00561:unspliced-genomic serine esterase family protein, putative, expressed| Length = 4839 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYMNK 604 Y++ HTHTHTH + K Sbjct: 4611 YIYRHTHTHTHTHTRK 4658
>LOC_Os09g37150:12009.t03190:unspliced-genomic hypothetical protein| Length = 2600 Score = 31.8 bits (63), Expect = 5.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIYMNK*SHILSP 625 Y+H + +THTH Y + +HI +P Sbjct: 621 YVHIYIYTHTHTYTHTSNHIYAP 689
>LOC_Os08g45010:12008.t04223:unspliced-genomic ATP-binding cassette sub-family F member 2, putative, expressed| Length = 3589 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = +2 / +2 Query: 560 LHNHTHTHTHIYM 598 +H HTHTHT+IY+ Sbjct: 575 IHTHTHTHTYIYI 613 Score = 31.3 bits (62), Expect = 7.9 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCV 571 +++IYMCVCVCV Sbjct: 617 YIYIYMCVCVCV 582
>LOC_Os07g41600:12007.t03815:unspliced-genomic expressed protein| Length = 2808 Score = 31.8 bits (63), Expect = 5.7 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +2 / -2 Query: 560 LHNHTHTHTHIYMNK* 607 LH HTHTHTH + K* Sbjct: 359 LHMHTHTHTHTQLKK* 312 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLC 562 H F ++CVCVCV +C Sbjct: 313 HFFSWVCVCVCVCMC 357
>LOC_Os04g33760:12004.t03052:unspliced-genomic expressed protein| Length = 1361 Score = 31.8 bits (63), Expect = 5.7 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 / -3 Query: 569 HTHTHTHIYMNK*SHILSPCGRKR 640 HTH HTH + +K + I S C +K+ Sbjct: 1209 HTHIHTHAHTSKGTKIASSCIKKK 1138
>LOC_Os04g12460:12004.t01070:unspliced-genomic Leucine Rich Repeat family protein, expressed| Length = 5123 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIY 595 Y+H +T+THTHIY Sbjct: 3831 YIHTYTYTHTHIY 3793
>LOC_Os03g07180:12003.t00584:unspliced-genomic embryonic protein DC-8, putative, expressed| Length = 2105 Score = 31.8 bits (63), Expect = 5.7 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 / -3 Query: 563 HNHTHTHTHIYMNK*SHILS 622 H HTHTHTH ++N H ++ Sbjct: 480 HTHTHTHTHPHVN*LQHTMA 421
>LOC_Os03g05630:12003.t00435:unspliced-genomic expressed protein| Length = 2524 Score = 31.8 bits (63), Expect = 5.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 / -2 Query: 563 HNHTHTHTHIYMNK*SHIL 619 H HTHTHTH + + +H L Sbjct: 2325 HTHTHTHTHTHTHTHTHTL 2269 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYMN 601 + H HTHTHTH + N Sbjct: 2311 HTHTHTHTHTHTHTN 2267
>LOC_Os01g22352:12001.t01970:unspliced-genomic peroxidase 2 precursor, putative, expressed| Length = 5750 Score = 27.6 bits (54), Expect(2) = 5.7 Identities = 5/15 (33%), Positives = 14/15 (93%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCVWLC 562 +++IY+ +C+C+++C Sbjct: 4903 YIYIYIYICICMYVC 4859 Score = 26.3 bits (51), Expect(2) = 5.7 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -2 / -2 Query: 278 RRCRWHRKCRGARQ 237 RRCRW R RG R+ Sbjct: 4393 RRCRWRRCRRGGRR 4352
>LOC_Os12g42720:12012.t03946:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5293 Score = 31.8 bits (63), Expect = 5.7 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = -1 / +3 Query: 603 LFIYMCVCVCVWLCKY 556 L+IY+CVCVC+++ Y Sbjct: 1878 LYIYICVCVCIYMYIY 1925
>LOC_Os07g17520:12007.t01612:unspliced-genomic conserved hypothetical protein| Length = 2241 Score = 31.8 bits (63), Expect = 5.7 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +1 / +2 Query: 265 QRQRRHPASGLLQRRQEIGRRSAEHR*QASGVQVHQERCRWVKRWQG 405 +R+RRH G L R E GRR A R + RC W + +G Sbjct: 29 RRRRRHRLPGSLPGRGEGGRRRATTRSRMKQHHHASRRCLWPRGAEG 169
>LOC_Os04g58580:12004.t05321:unspliced-genomic phosphomannomutase, putative, expressed| Length = 3030 Score = 31.8 bits (63), Expect = 5.7 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +1 / +1 Query: 334 EHR*QASGVQVHQERCRWVKRWQGRRHPLQVRRQRPLLHQHFRRLL 471 E + SG +E CR + + RRHP + + P+L FR L+ Sbjct: 277 EEEEERSGGDGGEEECRCPRALRRRRHPHRAPQGFPILRIRFRHLI 414
>LOC_Os04g04800:12004.t00364:unspliced-genomic lectin-like protein kinase, putative| Length = 1928 Score = 31.8 bits (63), Expect = 5.7 Identities = 8/13 (61%), Positives = 13/13 (100%) Frame = -1 / -2 Query: 603 LFIYMCVCVCVWL 565 ++IYMCVCVC+++ Sbjct: 868 MYIYMCVCVCIYI 830
>LOC_Os02g54440:12002.t05023:unspliced-genomic transposon protein, putative, Pong sub-class| Length = 1964 Score = 31.8 bits (63), Expect = 5.7 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 / -3 Query: 16 VGYYLSSCIPHDPPVQSLSKSSYLIICGLAHHHYYC* 126 + Y L + PP+ ++S +S GL HHHY C* Sbjct: 1104 IAYILIYLLVLCPPLLTMSTASQS*QWGLLHHHYQC* 994
>LOC_Os01g38359:12001.t03372:unspliced-genomic peptidyl-prolyl isomerase, putative, expressed| Length = 24382 Score = 31.8 bits (63), Expect = 5.7 Identities = 8/17 (47%), Positives = 15/17 (88%) Frame = -1 / -3 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+CVCVC+++ Y Sbjct: 3869 YIYIYICVCVCIYIYIY 3819
>LOC_Os01g34410:12001.t02999:unspliced-genomic transposon protein, putative, Pong sub-class| Length = 1967 Score = 31.8 bits (63), Expect = 5.7 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 / -3 Query: 16 VGYYLSSCIPHDPPVQSLSKSSYLIICGLAHHHYYC* 126 + Y L + PP+ ++S +S GL HHHY C* Sbjct: 1107 IAYILIYLLVLCPPLLTMSTASQS*HWGLLHHHYQC* 997
>LOC_Os06g09540:12006.t00833:unspliced-genomic phosphoinositide 5-phosphatase, putative, expressed| Length = 10278 Score = 25.4 bits (49), Expect(2) = 6.5 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 / +1 Query: 524 LSMLRR*VR*GYLHNHTHTHTH 589 L+ LR * + H HT THTH Sbjct: 9355 LAPLRP*PQINIPHTHTRTHTH 9420 Score = 23.1 bits (44), Expect(2) = 6.5 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 / +1 Query: 569 HTHTHTHIYMNK*SHILSPC 628 HTHT TH + S PC Sbjct: 9394 HTHTRTHTHTKNSSS**LPC 9453
>LOC_Os02g31940:12002.t02837:unspliced-genomic potassium transporter 1, putative, expressed| Length = 6213 Score = 26.3 bits (51), Expect(2) = 6.7 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 / +1 Query: 324 PANLLTPLQQAGGRMPPLPL 265 P L+ PLQ GR+PPL L Sbjct: 5182 PLPLVDPLQVCRGRVPPLLL 5241 Score = 22.1 bits (42), Expect(2) = 6.7 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -2 / +3 Query: 281 CRRCRWHRKCRGA 243 CR RW R RGA Sbjct: 5322 CRPTRWRRCWRGA 5360
>LOC_Os03g32526:12003.t02843:unspliced-genomic expressed protein| Length = 5974 Score = 26.3 bits (51), Expect(2) = 6.8 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 / -1 Query: 569 HTHTHTHIYMNK 604 HTHTHTH +N+ Sbjct: 463 HTHTHTHC*INR 428 Score = 22.1 bits (42), Expect(2) = 6.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +1 / -3 Query: 508 LPIAPAIDAETLSTLRIFTQPHTHT 582 LP+ P++ + R T HTHT Sbjct: 518 LPVLPSLCPHRNARERKTTHTHTHT 444
>LOC_Os07g27150:12007.t02409:unspliced-genomic trafficking protein particle complex subunit 4, putative, expressed| Length = 4857 Score = 31.3 bits (62), Expect = 7.8 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 / -2 Query: 563 HNHTHTHTHIYMNK*SHILSPCGRKRER 646 H HTHTHT SH+ S R+R R Sbjct: 2102 HTHTHTHTGSARASVSHVPSTTARRRLR 2019
>LOC_Os07g07790:12007.t00657:unspliced-genomic lipid transfer protein, putative, expressed| Length = 1071 Score = 31.3 bits (62), Expect = 7.8 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 / +1 Query: 218 SCGQVSSALRPCISYASGNGGILPPACCSGV 310 SC +L C+ Y SGN P+CC+ + Sbjct: 205 SCMTEIISLASCLGYMSGNSSAPKPSCCTAL 297
>LOC_Os06g46910:12006.t04377:unspliced-genomic nucleic acid binding protein, putative, expressed| Length = 3171 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +2 / -2 Query: 563 HNHTHTHTHIY 595 H HTHTHTHI+ Sbjct: 2159 HTHTHTHTHIF 2127
>LOC_Os05g50930:12005.t04523:unspliced-genomic RNA polymerase sigma factor rpoD, putative, expressed| Length = 2586 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 / -2 Query: 554 GYLHNHTHTHTH 589 G+ H HTHTHTH Sbjct: 2366 GHTHTHTHTHTH 2331
>LOC_Os05g43230:12005.t03814:unspliced-genomic cysteine proteinase RD21a precursor, putative, expressed| Length = 3754 Score = 31.3 bits (62), Expect = 7.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 / +3 Query: 545 VR*GYLHNHTHTHTHIYMNK 604 V+* + H HTHTHTH + + Sbjct: 1338 VQ*KHTHTHTHTHTHTHTER 1397
>LOC_Os03g63440:12003.t05561:unspliced-genomic expressed protein| Length = 3152 Score = 31.3 bits (62), Expect = 7.8 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 / -1 Query: 551 *GYLHNHTHTHTH 589 *G+ H HTHTHTH Sbjct: 2477 *GWKHTHTHTHTH 2439
>LOC_Os03g57990:12003.t05060:unspliced-genomic lipid binding protein, putative, expressed| Length = 1097 Score = 31.3 bits (62), Expect = 7.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 / +3 Query: 239 ALRPCISYASGNGGILPPACCSGV 310 +L PC+ Y SGN ACCS + Sbjct: 183 SLSPCMGYMSGNATAPAAACCSAL 254
>LOC_Os03g45870:12003.t03959:unspliced-genomic expressed protein| Length = 1816 Score = 31.3 bits (62), Expect = 7.8 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 / -2 Query: 223 AGDGCVGGYEEHSGHHGDQHELSSCR 146 AGDG G + H GH G E+S+ R Sbjct: 1515 AGDGGGGTCDSHRGHRGSDREMSTYR 1438
>LOC_Os02g57150:12002.t05287:unspliced-genomic tubulin-specific chaperone A, putative, expressed| Length = 2053 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 / -1 Query: 557 YLHNHTHTHTHIYMNK 604 + H HTHTHTH + +K Sbjct: 1435 FSHTHTHTHTHTHTHK 1388 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYMNK 604 + H HTHTHTH + K Sbjct: 1433 FTHTHTHTHTHTHTQK 1386 Score = 31.3 bits (62), Expect = 7.8 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 / -2 Query: 557 YLHNHTHTHTHIYMNK*SHILS 622 + H HTHTHTH + K I S Sbjct: 1431 HTHTHTHTHTHTHTKKKKKIKS 1366
>LOC_Os02g37654:12002.t03402:unspliced-genomic 1-O-acylceramide synthase precursor, putative, expressed| Length = 10594 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIYM 598 Y++ HTHTHTH Y+ Sbjct: 1483 YIYIHTHTHTHTYV 1524 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHI 592 Y++ HTHTHTHI Sbjct: 1485 YIYTHTHTHTHI 1520
>LOC_Os01g66170:12001.t05978:unspliced-genomic expressed protein| Length = 3619 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 / +1 Query: 557 YLHNHTHTHTHIY 595 Y H HTHTHTH + Sbjct: 1183 YTHTHTHTHTHTH 1221
>LOC_Os01g42020:12001.t03722:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5299 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 / +3 Query: 557 YLHNHTHTHTHIY 595 + H HTHTHTH Y Sbjct: 1953 HTHTHTHTHTHTY 1991
>LOC_Os01g07620:12001.t00642:unspliced-genomic expressed protein| Length = 1005 Score = 31.3 bits (62), Expect = 7.8 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 / -3 Query: 557 YLHNHTHTHTHIYMNK*SHIL 619 + H HTHTHTH + K +++ Sbjct: 847 HTHTHTHTHTHTHKKKSQNLI 785
>LOC_Os12g39430:12012.t03623:unspliced-genomic hypothetical protein| Length = 6849 Score = 31.3 bits (62), Expect = 7.9 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCV 571 +++IYMCVCVCV Sbjct: 2445 YIYIYMCVCVCV 2480
>LOC_Os12g26980:12012.t02411:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4100 Score = 31.3 bits (62), Expect = 7.9 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCV 571 +++IYMCVCVCV Sbjct: 3365 YIYIYMCVCVCV 3400
>LOC_Os12g18010:12012.t01652:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 10182 Score = 31.3 bits (62), Expect = 7.9 Identities = 7/17 (41%), Positives = 15/17 (88%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+ VC+C+++C Y Sbjct: 6216 YIYIYIYVCICIYICIY 6266
>LOC_Os11g37330:12011.t03275:unspliced-genomic tetratricopeptide-like helical, putative, expressed| Length = 4569 Score = 31.3 bits (62), Expect = 7.9 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = -1 / -2 Query: 603 LFIYMCVCVCVW 568 LF+ +CVC+CVW Sbjct: 1718 LFVCLCVCICVW 1683
>LOC_Os10g26470:12010.t02059:unspliced-genomic sucrose transporter 1, putative, expressed| Length = 6418 Score = 31.3 bits (62), Expect = 7.9 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 / -1 Query: 606 HLFIYMCVCVCV 571 +++IYMCVCVCV Sbjct: 343 YIYIYMCVCVCV 308
>LOC_Os10g04170:12010.t00306:unspliced-genomic hypothetical protein| Length = 6906 Score = 31.3 bits (62), Expect = 7.9 Identities = 7/17 (41%), Positives = 15/17 (88%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCVWLCKY 556 +L+IY+C C+C+++ K+ Sbjct: 2822 YLYIYVCKCICIYILKH 2872
>LOC_Os10g01984:12010.t00094:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 15035 Score = 31.3 bits (62), Expect = 7.9 Identities = 7/15 (46%), Positives = 15/15 (100%) Frame = -1 / -3 Query: 609 DHLFIYMCVCVCVWL 565 ++++IY+C+CVCV++ Sbjct: 9708 EYIYIYICICVCVYV 9664
>LOC_Os09g20190:12009.t01753:unspliced-genomic hypothetical protein| Length = 2663 Score = 31.3 bits (62), Expect = 7.9 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 / +3 Query: 606 HLFIYMCVCVCV 571 +++IYMCVCVCV Sbjct: 690 YIYIYMCVCVCV 725
>LOC_Os09g18230:12009.t01608:unspliced-genomic protein kinase domain containing protein, expressed| Length = 12782 Score = 31.3 bits (62), Expect = 7.9 Identities = 7/17 (41%), Positives = 15/17 (88%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+C+CVC+++ Y Sbjct: 6436 YIYIYICICVCIYIYIY 6486
>LOC_Os07g15370:12007.t01400:unspliced-genomic metal transporter Nramp6, putative, expressed| Length = 7470 Score = 31.3 bits (62), Expect = 7.9 Identities = 7/17 (41%), Positives = 15/17 (88%) Frame = -1 / +2 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+CVC+ +++C Y Sbjct: 6380 YIYIYICVCIYIYMCIY 6430
>LOC_Os07g09020:12007.t00777:unspliced-genomic argonaute-like protein, putative, expressed| Length = 9652 Score = 31.3 bits (62), Expect = 7.9 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 / +2 Query: 379 CRWVKRWQGRRHPLQVRRQRPLLHQHFRR 465 CRW + W+ RR + RR RP + RR Sbjct: 284 CRWSRNWRRRRRRARGRRTRPWPWRRRRR 370
>LOC_Os06g31920:12006.t02891:unspliced-genomic retrotransposon, putative, centromere-specific| Length = 4609 Score = 31.3 bits (62), Expect = 7.9 Identities = 8/14 (57%), Positives = 14/14 (100%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCVWL 565 +++IY+CVCVC++L Sbjct: 2688 NIYIYICVCVCIYL 2647
>LOC_Os06g02770:12006.t00170:unspliced-genomic expressed protein| Length = 1624 Score = 31.3 bits (62), Expect = 7.9 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 / -3 Query: 376 RCRWVKRWQGRRHPLQVRRQRPLLHQHFRR 465 +C W++R RRH RR+RP L RR Sbjct: 461 QCAWIRRLCRRRHRRHPRRRRPSLCHPRRR 372
>LOC_Os05g46874:12005.t04171:unspliced-genomic hypothetical protein| Length = 5067 Score = 31.3 bits (62), Expect = 7.9 Identities = 6/17 (35%), Positives = 15/17 (88%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVWLCKY 556 +++IY+ +C+C+++C Y Sbjct: 3976 YIYIYIYICICIYVCMY 4026
>LOC_Os04g50920:12004.t04570:unspliced-genomic WRKY DNA binding domain containing protein, expressed| Length = 4057 Score = 31.3 bits (62), Expect = 7.9 Identities = 7/16 (43%), Positives = 14/16 (87%) Frame = -1 / +2 Query: 597 IYMCVCVCVWLCKYPQ 550 +Y+CVC+C+++ +PQ Sbjct: 107 VYVCVCICIYMHTHPQ 154
>LOC_Os03g42569:12003.t03660:unspliced-genomic expressed protein| Length = 10430 Score = 31.3 bits (62), Expect = 7.9 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 / -2 Query: 606 HLFIYMCVCVCV 571 +++IYMCVCVCV Sbjct: 7540 YIYIYMCVCVCV 7505
>LOC_Os03g34300:12003.t03018:unspliced-genomic serine incorporator 3, putative, expressed| Length = 7078 Score = 31.3 bits (62), Expect = 7.9 Identities = 9/19 (47%), Positives = 16/19 (84%) Frame = -1 / +1 Query: 612 *DHLFIYMCVCVCVWLCKY 556 *++++IY+CVCVC ++ Y Sbjct: 6886 *NYIYIYVCVCVCTYVRTY 6942 Score = 31.3 bits (62), Expect = 7.9 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -1 / +3 Query: 603 LFIYMCVCVCVWLCKYPQRTQRLSI 529 L+IY+C+CVC+++ Y + R S+ Sbjct: 6891 LYIYICLCVCMYVRTYVRTYVRYSL 6965
>LOC_Os03g32499:12003.t02840:unspliced-genomic expressed protein| Length = 18888 Score = 31.3 bits (62), Expect = 7.9 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -1 / +1 Query: 606 HLFIYMCVCVCVW 568 H F+ +CVCVC+W Sbjct: 8968 HQFLSVCVCVCIW 9006
>LOC_Os02g53850:12002.t04964:unspliced-genomic xylem serine proteinase 1 precursor, putative, expressed| Length = 2347 Score = 31.3 bits (62), Expect = 7.9 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 / -2 Query: 364 VHQERCRWVKRWQGRR 411 VH+E C W + WQG+R Sbjct: 783 VHREPCPWQRHWQGQR 736
>LOC_Os01g51060:12001.t04540:unspliced-genomic IAA-amino acid hydrolase ILR1-like 4 precursor, putative, expressed| Length = 8107 Score = 31.3 bits (62), Expect = 7.9 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +1 / -1 Query: 550 LRIFTQPHTHTHTH 591 LR+ T HTHTHTH Sbjct: 8005 LRLITHTHTHTHTH 7964
>LOC_Os06g49000:12006.t04586:unspliced-genomic expressed protein| Length = 6648 Score = 28.6 bits (56), Expect(2) = 8.6 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 / -3 Query: 307 RQEIGRRSAEHR*QASGVQVHQERCRWVKRWQGR 408 RQ + R + SG+ + RCRW RW+ R Sbjct: 5377 RQNAVHATRRRRRRRSGLGWSRSRCRWRWRWRWR 5276 Score = 24.9 bits (48), Expect(2) = 8.6 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 / -3 Query: 560 LHNHTHTHTHIYMN 601 L +TH H H+Y+N Sbjct: 3271 LTTYTHMHIHVYIN 3230
>LOC_Os06g19444:12006.t01764:unspliced-genomic CCT motif family protein, expressed| Length = 6612 Score = 24.9 bits (48), Expect(2) = 9.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +2 / +2 Query: 569 HTHTHTHIYMNK*SHILSPC 628 HTHTHT + + H + C Sbjct: 3899 HTHTHTQTHSSTYIHTVCAC 3958 Score = 23.1 bits (44), Expect(2) = 9.0 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = +1 / +2 Query: 496 LPSFLPIAPAIDAETLSTLRIFTQPHTHTHTH 591 L F P + +S L HTHT TH Sbjct: 3830 LQIFRPFYFNLPLHHVSFLESIRHTHTHTQTH 3925
>LOC_Os02g44770:12002.t04067:unspliced-genomic mechanosensitive ion channel family protein, expressed| Length = 4450 Score = 25.8 bits (50), Expect(2) = 9.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 / +3 Query: 403 GRRHPLQVRRQRPLLHQHFRRLL 471 GRR L+ RR+RPL ++ R L Sbjct: 552 GRRRGLRRRRRRPLRYRRSRHTL 620 Score = 22.1 bits (42), Expect(2) = 9.3 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +1 / +1 Query: 370 QERCRWVKRWQGRRHPLQVR 429 Q R RW RW R +Q++ Sbjct: 487 QRRWRWRWRWPARLRGVQLQ 546 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 253,664,103 Number of extensions: 3797170 Number of successful extensions: 36074 Number of sequences better than 10.0: 225 Length of query: 247 Length of database: 55,613,886 Length adjustment: 49 Effective length of query: 198 Effective length of database: 52,856,264 Effective search space: 10465540272 Effective search space used: 10465540272 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
