| Clone Name | FLbaf48e05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | P33072:LYOX_BOVIN Protein-lysine 6-oxidase precursor - Bos tauru... | 29 | 4.3 | 2 | P21769:ODFP_RAT Outer dense fiber protein - Rattus norvegicus (Rat) | 28 | 9.6 | 3 | Q61999:ODFP_MOUSE Outer dense fiber protein - Mus musculus (Mouse) | 28 | 9.6 | 4 | Q8CBD1:NRIP1_MOUSE Nuclear receptor-interacting protein 1 - Mus ... | 28 | 9.6 |
|---|
>P33072:LYOX_BOVIN Protein-lysine 6-oxidase precursor - Bos taurus (Bovine)| Length = 418 Score = 29.3 bits (64), Expect = 4.3 Identities = 19/58 (32%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = +3 Query: 3 GAVRSALGGMSKPVFLLDITLLSQLR-RDAHPSAYSGGHPGNDCSHWCLAGLPDTWNH 173 GA + M P+ LL + R R A PSA + G P HW AG + H Sbjct: 77 GAANATAPQMRTPILLLRNNRTAAARVRTAGPSAAAAGRPRPAARHWFQAGYSTSGAH 134
>P21769:ODFP_RAT Outer dense fiber protein - Rattus norvegicus (Rat)| Length = 245 Score = 28.1 bits (61), Expect = 9.6 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +1 Query: 187 RSLHRLGRACPQVLASCCCSVFFHSKVN 270 RSL RL R ++LAS CCS VN Sbjct: 89 RSLERLRRTTNRILASSCCSSNILGSVN 116
>Q61999:ODFP_MOUSE Outer dense fiber protein - Mus musculus (Mouse)| Length = 247 Score = 28.1 bits (61), Expect = 9.6 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +1 Query: 187 RSLHRLGRACPQVLASCCCSVFFHSKVN 270 RSL RL R ++LAS CCS VN Sbjct: 89 RSLERLRRTTNRILASSCCSSNILGSVN 116
>Q8CBD1:NRIP1_MOUSE Nuclear receptor-interacting protein 1 - Mus musculus (Mouse)| Length = 1161 Score = 28.1 bits (61), Expect = 9.6 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -3 Query: 266 TLL*K-KTEQQQLAKTCGHARPSLCKERRVEDMVPGVGQAG 147 TLL K KT+ Q+ T P+L ++ VE P VGQ+G Sbjct: 187 TLLKKSKTKDQKSGPTLPDVTPNLIRDSFVESSHPAVGQSG 227 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 62,103,836 Number of extensions: 1258082 Number of successful extensions: 2839 Number of sequences better than 10.0: 4 Number of HSP's gapped: 2839 Number of HSP's successfully gapped: 4 Length of query: 134 Length of database: 100,686,439 Length adjustment: 100 Effective length of query: 34 Effective length of database: 73,256,939 Effective search space: 2490735926 Effective search space used: 2490735926 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)