| Clone Name | FLbaf45a19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | O15554:KCNN4_HUMAN Intermediate conductance calcium-activated po... | 32 | 2.5 | 2 | Q61180:SCNNA_MOUSE Amiloride-sensitive sodium channel subunit al... | 31 | 5.7 | 3 | Q7N288:FADJ_PHOLL Fatty acid oxidation complex subunit alpha [In... | 30 | 9.7 | 4 | Q9UKG1:DP13A_HUMAN DCC-interacting protein 13-alpha - Homo sapie... | 30 | 9.7 |
|---|
>O15554:KCNN4_HUMAN Intermediate conductance calcium-activated potassium channel| protein 4 - Homo sapiens (Human) Length = 427 Score = 32.3 bits (72), Expect = 2.5 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +3 Query: 354 LDKQKDQRGWRRCLGDGQMMLMHFELVTIWFGRLTW-LHLCCLSCITEISEDLL 512 L+++K GW L + LM +WFG +W L+L + C IS LL Sbjct: 19 LEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFLVKCTISISTFLL 72
>Q61180:SCNNA_MOUSE Amiloride-sensitive sodium channel subunit alpha - Mus musculus| (Mouse) Length = 699 Score = 31.2 bits (69), Expect = 5.7 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = +1 Query: 22 TESPRFAAPHHGTSPAGDDNRPPPANGARSAGSFRMGTEDTKDMLKNADWK 174 T R A PH P PPP N ARSA S D + DWK Sbjct: 204 TRDLRGALPH----PLQRLRTPPPPNPARSARSASSSVRDNNPQVDRKDWK 250
>Q7N288:FADJ_PHOLL Fatty acid oxidation complex subunit alpha [Includes: Enoyl-CoA| hydratase/3-hydroxybutyryl-CoA epimerase - Photorhabdus luminescens subsp. laumondii Length = 727 Score = 30.4 bits (67), Expect = 9.7 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = -1 Query: 794 KQNKIDQSWYTILITTCNYLQTKFQIVLTCAVLMMPTNDSYRCVDD 657 + K+D S YT+L T +I C +LM+ N++ RC+D+ Sbjct: 613 RDKKVDSSVYTLLNITPESHMLSSEIAQRCVMLML--NEAVRCLDE 656
>Q9UKG1:DP13A_HUMAN DCC-interacting protein 13-alpha - Homo sapiens (Human)| Length = 709 Score = 30.4 bits (67), Expect = 9.7 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 22 TESPRFAAPHHGTSPAGDDNRPPPANGARSAGSFRMGTEDT 144 T SP F H PA +RPP AR++ S +G+E T Sbjct: 399 TPSPSFQQRHESLRPAAGQSRPPT---ARTSSSGSLGSEST 436 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 150,184,228 Number of extensions: 3207565 Number of successful extensions: 8058 Number of sequences better than 10.0: 4 Number of HSP's gapped: 8055 Number of HSP's successfully gapped: 4 Length of query: 290 Length of database: 100,686,439 Length adjustment: 112 Effective length of query: 178 Effective length of database: 69,965,399 Effective search space: 12453841022 Effective search space used: 12453841022 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)