| Clone Name | FLbaf47m13 |
|---|---|
| Clone Library Name | barley_pub |
>Q505D9:TRI67_MOUSE Tripartite motif-containing protein 67 - Mus musculus (Mouse)| Length = 768 Score = 34.7 bits (78), Expect = 1.5 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +2 Query: 1571 QGDRIGIQCDTDKHSITFYQNGRRVGDT-YTDVNESVCPAVCIAGNQTVRLDFPSLVP 1741 +G +G+ D +KH++TF+ NG++ G T ++ V+ PA+ + N V L VP Sbjct: 700 KGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRNVQVTLHTGLEVP 757
>Q5M9B1:SPSB3_XENLA SPRY domain-containing SOCS box protein 3 - Xenopus laevis (African| clawed frog) Length = 360 Score = 34.3 bits (77), Expect = 2.0 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +2 Query: 1571 QGDRIGIQCDTDKHSITFYQNGRRVGDTYTDV-NESVCPAVC 1693 QG IG+ DT +TFY+N +R+G T + N+ + P VC Sbjct: 216 QGSIIGVHLDTWHGVLTFYKNRKRIGVAATQLRNKKLFPLVC 257
>Q9A9A7:RECA_CAUCR Protein recA - Caulobacter crescentus (Caulobacter vibrioides)| Length = 356 Score = 33.5 bits (75), Expect = 3.4 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +1 Query: 643 NMREKKKQLPKAIAEAQKAVDEAGKKIEEAVLAGG 747 N+RE K P A+ +KAV ++ +KIEE +L GG Sbjct: 315 NVREFLKNNPDVAADIEKAVRKSSQKIEEELLVGG 349
>Q8P040:SYV_STRP8 Valyl-tRNA synthetase - Streptococcus pyogenes serotype M18| Length = 882 Score = 32.0 bits (71), Expect = 9.9 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 3/72 (4%) Frame = +1 Query: 631 SQILNMREKKKQLPKAIAEAQKAVDEAGKKIEEAVLAGGTVQEIKHQDENVQG---MDID 801 + +LN+ E+ +L K +A+ QK +D GKK+ E+ ++++ Q D Sbjct: 809 ADLLNVEEELARLDKELAKWQKELDMVGKKLGNERFVANAKPEVVQKEKDKQADYQAKYD 868 Query: 802 GAGTLFWELHKL 837 E+HKL Sbjct: 869 ATQERIAEMHKL 880
>Q5XAW8:SYV_STRP6 Valyl-tRNA synthetase - Streptococcus pyogenes serotype M6| Length = 882 Score = 32.0 bits (71), Expect = 9.9 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 3/72 (4%) Frame = +1 Query: 631 SQILNMREKKKQLPKAIAEAQKAVDEAGKKIEEAVLAGGTVQEIKHQDENVQG---MDID 801 + +LN+ E+ +L K +A+ QK +D GKK+ E+ ++++ Q D Sbjct: 809 ADLLNVEEELARLDKELAKWQKELDMVGKKLGNERFVANAKPEVVQKEKDKQADYQAKYD 868 Query: 802 GAGTLFWELHKL 837 E+HKL Sbjct: 869 ATQERIVEMHKL 880
>O35608:ANGP2_MOUSE Angiopoietin-2 precursor - Mus musculus (Mouse)| Length = 496 Score = 32.0 bits (71), Expect = 9.9 Identities = 13/48 (27%), Positives = 27/48 (56%) Frame = +1 Query: 625 HCSQILNMREKKKQLPKAIAEAQKAVDEAGKKIEEAVLAGGTVQEIKH 768 H Q+ +M+E+K +L +++ +DE KK+ A + +Q+ +H Sbjct: 202 HSEQLQSMKEQKDELQVLVSKQSSVIDELEKKLVTATVNNSLLQKQQH 249 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 324,571,462 Number of extensions: 6649423 Number of successful extensions: 16121 Number of sequences better than 10.0: 6 Number of HSP's gapped: 16113 Number of HSP's successfully gapped: 6 Length of query: 669 Length of database: 100,686,439 Length adjustment: 120 Effective length of query: 549 Effective length of database: 67,771,039 Effective search space: 37206300411 Effective search space used: 37206300411 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)