| Clone Name | FLbaf37k18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | P83690:NFCP_MONEF GFP-like non-fluorescent chromoprotein - Monti... | 30 | 5.4 | 2 | Q4U0G1:CLAP1_XENLA CLIP-associating protein 1 - Xenopus laevis (... | 30 | 7.2 | 3 | Q2UQ97:SLD2_ASPOR DNA replication regulator sld2 - Aspergillus o... | 29 | 9.4 |
|---|
>P83690:NFCP_MONEF GFP-like non-fluorescent chromoprotein - Montipora efflorescens| (Coral) Length = 221 Score = 30.0 bits (66), Expect = 5.4 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -2 Query: 497 GGHRCKHGKALCCQKYPARPQGQE-LDRSIPITHHPKNYTSMKEVQ 363 GGH K K P + G +DR + +T+H K+YTS+++ + Sbjct: 166 GGHYLCEFKTTYKAKKPVKMPGYHYVDRKLDVTNHNKDYTSVEQCE 211
>Q4U0G1:CLAP1_XENLA CLIP-associating protein 1 - Xenopus laevis (African clawed frog)| Length = 1468 Score = 29.6 bits (65), Expect = 7.2 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -1 Query: 519 GKDMLGGGRAPMQTRQGSLLPKVSSAPTRPRTRSINPY 406 G DM+ GGR + + L + A T PR R NPY Sbjct: 1160 GTDMVEGGRMALDNKTSLLNTQPPRAFTGPRGREYNPY 1197
>Q2UQ97:SLD2_ASPOR DNA replication regulator sld2 - Aspergillus oryzae| Length = 527 Score = 29.3 bits (64), Expect = 9.4 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -1 Query: 516 KDMLGGGRAPMQTRQGSLLPKVSSAPTRPRTRSINP 409 +D +G P +Q PKV T+PR R +NP Sbjct: 464 RDAIGVVEPPPAEKQEKPQPKVKEKQTKPRERKVNP 499 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 89,141,601 Number of extensions: 1791611 Number of successful extensions: 5000 Number of sequences better than 10.0: 3 Number of HSP's gapped: 4999 Number of HSP's successfully gapped: 3 Length of query: 182 Length of database: 100,686,439 Length adjustment: 106 Effective length of query: 76 Effective length of database: 71,611,169 Effective search space: 5442448844 Effective search space used: 5442448844 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)