| Clone Name | FLbaf43l07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | P13808:B3A2_MOUSE Anion exchange protein 2 - Mus musculus (Mouse) | 32 | 2.9 | 2 | O80770:SPT52_ARATH Putative transcription elongation factor SPT5... | 31 | 8.4 | 3 | P48746:B3A2_RABIT Anion exchange protein 2 - Oryctolagus cunicul... | 31 | 8.4 |
|---|
>P13808:B3A2_MOUSE Anion exchange protein 2 - Mus musculus (Mouse)| Length = 1237 Score = 32.3 bits (72), Expect = 2.9 Identities = 21/63 (33%), Positives = 26/63 (41%), Gaps = 6/63 (9%) Frame = -1 Query: 235 HQILHTHVAKKEGRCFTQQGPGARRRWREGAGQA------SEGGRDVENRERLAGERSGE 74 H L TH+ R T QGPG + R R GA EG D E G R+ Sbjct: 81 HHPLSTHLPPDARRRKTPQGPGRKPRRRPGASPTGETPTIEEGEEDEEEASEAEGFRAPP 140 Query: 73 EEP 65 ++P Sbjct: 141 QQP 143
>O80770:SPT52_ARATH Putative transcription elongation factor SPT5 homolog 2 -| Arabidopsis thaliana (Mouse-ear cress) Length = 990 Score = 30.8 bits (68), Expect = 8.4 Identities = 29/92 (31%), Positives = 44/92 (47%), Gaps = 5/92 (5%) Frame = +2 Query: 245 NPSAGYNFQRGFERRGD----GTMEEMK-ELKKQRTERMMEDYQNTESRDGAIRCPIPCK 409 NP AG Q G RRGD GT +++ K + R++ E +D +R + K Sbjct: 666 NPGAGGRHQGGRGRRGDDHLVGTYVKIRLGPFKGYSGRLV------EVKDKLVRVELEAK 719 Query: 410 SSRPYREYDFKAAQDLSDFIVSKASPPYFMGS 505 ++ KA D++D +V A+P Y MGS Sbjct: 720 IVTGKLHFERKAISDMTDNVV--ATPQYNMGS 749
>P48746:B3A2_RABIT Anion exchange protein 2 - Oryctolagus cuniculus (Rabbit)| Length = 1237 Score = 30.8 bits (68), Expect = 8.4 Identities = 21/61 (34%), Positives = 24/61 (39%), Gaps = 6/61 (9%) Frame = -1 Query: 235 HQILHTHVAKKEGRCFTQQGPGARRRWREGAGQA------SEGGRDVENRERLAGERSGE 74 H L TH+ R T QGPG + R R GA EG D E G R+ Sbjct: 82 HHPLSTHLPPDARRRKTPQGPGRKPRRRPGASPTGATPTIEEGEEDEEEANEAEGARAPT 141 Query: 73 E 71 E Sbjct: 142 E 142 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 135,535,889 Number of extensions: 2639808 Number of successful extensions: 7767 Number of sequences better than 10.0: 3 Number of HSP's gapped: 7766 Number of HSP's successfully gapped: 3 Length of query: 316 Length of database: 100,686,439 Length adjustment: 113 Effective length of query: 203 Effective length of database: 69,691,104 Effective search space: 14147294112 Effective search space used: 14147294112 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)