| Clone Name | FLbaf43d17 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os10g38360:12010.t03081:unspliced-genomic glutathione S-transferase GSTU6, putative, expressed| Length = 1094 Score = 40.9 bits (83), Expect(2) = 0.001 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = -3 / +1 Query: 209 HDVLINNVARRRSTGSGYLGHSDGAHQRDQRRHGNEPWEHCCCH 78 H V R G G Q D+ RHG + W CCCH Sbjct: 757 HHPAAGGVGRALRRAGRRQGRHAGGGQADRARHGEDGWRRCCCH 888 Score = 23.5 bits (45), Expect(2) = 0.001 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 / +2 Query: 231 RSSCSTHSRRS 199 RSSCST +RRS Sbjct: 299 RSSCSTSTRRS 331
>LOC_Os01g13229:12001.t01185:unspliced-genomic cyclin-A1, putative, expressed| Length = 11380 Score = 32.7 bits (65), Expect(3) = 0.073 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 / -3 Query: 322 WPPKTTQQSTGTLPTLPEIILSAMAFCIPTP 230 WP +T++ S+ P P + +A A C+P P Sbjct: 8480 WPLRTSRPSSSPPPPCPRLAWAAAASCLPPP 8388 Score = 25.4 bits (49), Expect(3) = 0.073 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 / -2 Query: 254 HGILHTYSEALVARIHDVLINNVARRRSTGS 162 HG+LH +A RIH+ + N ++ T S Sbjct: 4578 HGLLHAPCQASRPRIHEHMFNLPTQQDRTPS 4486 Score = 23.5 bits (45), Expect(3) = 0.073 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = -3 / -2 Query: 152 GHSDGAHQRDQRRHGNEPWEHC 87 GH G HQR R + HC Sbjct: 4437 GHRHGLHQRTSPRARQDNHLHC 4372
>LOC_Os09g09980:12009.t00790:unspliced-genomic glucan endo-1,3-beta-glucosidase 5 precursor, putative, expressed| Length = 2340 Score = 35.4 bits (71), Expect = 0.38 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 / +1 Query: 112 WRRWSR*CAPSLWPRYPLPVERRRA 186 W R C PS WPR+P P RRR+ Sbjct: 163 WAPSRRRCWPSCWPRWPRPRRRRRS 237
>LOC_Os05g23880:12005.t02045:unspliced-genomic lipoxygenase A, putative, expressed| Length = 6014 Score = 31.8 bits (63), Expect(2) = 0.42 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +1 / +2 Query: 64 TSIWSWQQQCSQGSLPWR 117 T + SW++ C++GS PWR Sbjct: 4403 TPVASWRRPCTRGSTPWR 4456 Score = 25.8 bits (50), Expect(2) = 0.42 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 / +3 Query: 94 SQGSLPWRRWSR*CAPSLWPRYPLPVERR 180 S+G WR W A S W R P RR Sbjct: 5322 SRGRRRWRSWRPTRAGSSWRRCPTGSRRR 5408
>LOC_Os10g39090:12010.t03151:unspliced-genomic hydrolase, putative, expressed| Length = 1590 Score = 35.0 bits (70), Expect = 0.53 Identities = 17/50 (34%), Positives = 22/50 (44%) Frame = +1 / +1 Query: 40 STLDHLYQTSIWSWQQQCSQGSLPWRRWSR*CAPSLWPRYPLPVERRRAT 189 ST+ L Q W + + WRR R P+ WPR P P R A+ Sbjct: 550 STVSSLSQARTWRAAAEARRTCGWWRRARRGRCPTCWPRPPPPCSRAAAS 699
>LOC_Os04g53420:12004.t04814:unspliced-genomic hypothetical protein| Length = 456 Score = 34.5 bits (69), Expect = 0.72 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +1 / +2 Query: 82 QQQCSQGSLPWRRWSR*CAPSLWPRYPLPVERRR 183 +Q+CS +LP RR R C+ R PLP RRR Sbjct: 56 RQRCSGHALPLRRRRRRCSKRRCSRRPLPRRRRR 157
>LOC_Os01g08980:12001.t00776:unspliced-genomic conserved hypothetical protein| Length = 441 Score = 34.5 bits (69), Expect = 0.72 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +1 / -1 Query: 82 QQQCSQGSLPWRRWSR*CAPSLWPRYPLPVERRR 183 +Q+CS +LP RR R C+ R PLP RRR Sbjct: 270 RQRCSGHALPLRRRRRRCSKRRCSRRPLPRRRRR 169
>LOC_Os12g10700:12012.t00948:unspliced-genomic expressed protein| Length = 7432 Score = 34.1 bits (68), Expect = 0.99 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 / -3 Query: 76 SWQQQCSQGSLPWRRWSR*CAPSLWPRYPLPVER 177 SW+Q Q ++PW +WS+ PS ++ P R Sbjct: 4646 SWEQLMHQPNIPWTKWSQYSLPSYLEQFLYPFLR 4545
>LOC_Os08g07870:12008.t00675:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5004 Score = 34.1 bits (68), Expect = 0.99 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -2 / +1 Query: 378 PGPFCLEPATSSSSCRGMSGLQRQHNSQLEPYRHYPK 268 PGP PA S+S+C GL R L P H P+ Sbjct: 3217 PGPPSAGPAPSASTCPAPPGLPRLDGPHLPPAPHVPR 3327
>LOC_Os12g17950:12012.t01646:unspliced-genomic expressed protein| Length = 1452 Score = 33.6 bits (67), Expect = 1.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 / -2 Query: 479 SSGRCSPTPCLLLFAYVCHLSLFYF 553 + G C PC LL +VCH+ LF F Sbjct: 1157 AKGLCGVDPCSLLQEHVCHIVLFIF 1083
>LOC_Os09g37540:12009.t03228:unspliced-genomic carboxy-lyase, putative, expressed| Length = 2170 Score = 33.6 bits (67), Expect = 1.4 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = +1 / +2 Query: 88 QCSQGSLPWRRWSR*CAPSLWPRYPLPVERRRATLLIRTS*MRATRAS 231 +C +G+ WRRW R* W P P +T +S +TR S Sbjct: 803 RCREGTGRWRRWWR*SRGRSWASTPSPSASSTSTATTTSSSPSSTRPS 946
>LOC_Os01g10830:12001.t00956:unspliced-genomic carnitine racemase like protein, putative, expressed| Length = 893 Score = 33.1 bits (66), Expect = 1.9 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 / -1 Query: 355 RLKAKRPRIMCNASGRRPASEC 420 R + +RPR C A+GRRP S C Sbjct: 614 RRRRRRPRPRCPAAGRRPPSSC 549
>LOC_Os07g40550:12007.t03714:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 6624 Score = 28.6 bits (56), Expect(2) = 2.0 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 / -3 Query: 215 RIHDVLINNVARRRSTGSGYLGHSDGAHQR 126 R+ +L+ RRRS G+ G DG H+R Sbjct: 1057 RLVPLLLRPPTRRRSRGAAQGGRGDGHHRR 968 Score = 26.7 bits (52), Expect(2) = 2.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 / -3 Query: 311 DNTTVNWNLTDITRNNPVGHGILHTYSE 228 DN+T +W TR + H + TYS+ Sbjct: 3658 DNSTTHWYYMSGTRALTIAHTKMRTYSQ 3575
>LOC_Os04g33120:12004.t02988:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3764 Score = 29.9 bits (59), Expect(2) = 2.2 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 / -3 Query: 474 WFQVVDVHLLLVCFYLLMCVI*VCSIFLC*SVS*VFLV 587 WF + HLL V F+ L +C FLC +FL+ Sbjct: 1044 WFIFIINHLLTVIFHSLASTTFICHPFLCLLCFLIFLL 931 Score = 24.4 bits (47), Expect(2) = 2.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 / -3 Query: 435 FVHPRPLVLWIL 470 F+HP PLV +IL Sbjct: 2151 FIHPSPLVFFIL 2116
>LOC_Os09g37860:12009.t03260:unspliced-genomic proliferating-cell nucleolar antigen p120, putative, expressed| Length = 5315 Score = 27.6 bits (54), Expect(2) = 2.2 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +1 / +3 Query: 469 YVGFKWSMFTYSLFAFICLCVSSESVLFFYV 561 + + W +F Y LF +C CV F+V Sbjct: 3507 FAQYLWVLFAYPLFVRLCDCVQLLFGAIFFV 3599 Score = 27.2 bits (53), Expect(2) = 2.2 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +1 / +2 Query: 109 PWRRWSR*CAPSLWPRYPLPVERRRATLLI 198 P +WS+ C S++ Y V+ +ATLL+ Sbjct: 1796 PIGKWSKVCFVSIFLLYSSKVQNLKATLLV 1885
>LOC_Os05g51900:12005.t04615:unspliced-genomic expressed protein| Length = 577 Score = 27.2 bits (53), Expect(2) = 2.4 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 / +3 Query: 139 PSLWPRYPLPVERRRATLLIRTS 207 P L PR P+PV RRA L ++ + Sbjct: 141 PLLTPRTPMPVA*RRAALKLKAA 209 Score = 24.4 bits (47), Expect(2) = 2.4 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 / +1 Query: 474 WFQVVDVHLLLVCFYLLM 527 + Q +DVHL+ C +L + Sbjct: 415 YMQPIDVHLIYACSFLFL 468
>LOC_Os12g29710:12012.t02682:unspliced-genomic NBS-LRR disease resistance protein, putative| Length = 4575 Score = 27.2 bits (53), Expect(3) = 2.5 Identities = 14/49 (28%), Positives = 22/49 (44%) Frame = -3 / -3 Query: 224 LVARIHDVLINNVARRRSTGSGYLGHSDGAHQRDQRRHGNEPWEHCCCH 78 L+ +H +++RRRS L H + R H ++ WE CH Sbjct: 958 LLIHLH*NFEKHISRRRSESGSSLLHICVV*KLSSRYHLDQQWEAR*CH 812 Score = 23.5 bits (45), Expect(3) = 2.5 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 / -1 Query: 249 HFAYLLRSSCS 217 HF YLL SSC+ Sbjct: 1185 HFCYLLLSSCN 1153 Score = 22.6 bits (43), Expect(3) = 2.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 / -3 Query: 432 DFQHALTSRPSP*RIAHYPGPFCLEP 355 DFQ P IAHYP P P Sbjct: 2542 DFQEHFLL**DPYYIAHYPNPILNYP 2465
>LOC_Os11g19930:12011.t01763:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2168 Score = 32.7 bits (65), Expect = 2.6 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +1 / -1 Query: 73 WSWQQQCSQGSLPWRR 120 WSWQQ+ +LPWRR Sbjct: 1211 WSWQQRGQHRTLPWRR 1164
>LOC_Os07g10380:12007.t00912:unspliced-genomic conserved hypothetical protein| Length = 465 Score = 32.7 bits (65), Expect = 2.6 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 / +2 Query: 109 PWRRWSR*CAPSLWPRYPLPVERRR 183 PWR W C+PS W P RRR Sbjct: 68 PWRGWRARCSPSSWRFLMPPPRRRR 142
>LOC_Os06g09200:12006.t00799:unspliced-genomic hypothetical protein| Length = 591 Score = 32.7 bits (65), Expect = 2.6 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +1 / -1 Query: 82 QQQCSQGSLPWRRWSR*CAPSLWPRYPLPVERR 180 +Q+CS +LP RR R C+ R PLP +RR Sbjct: 270 RQRCSGHALPLRRRRRRCSKRRCSRRPLPRKRR 172
>LOC_Os03g19550:12003.t01720:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 1280 Score = 25.4 bits (49), Expect(2) = 2.7 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -2 / -3 Query: 231 RSSCSTHSRRSDQQCRTSALHRQRVP 154 R ST RR+ + CR + HR+ P Sbjct: 1008 RRRLSTPERRAPEWCRVTRRHRRWAP 931 Score = 24.4 bits (47), Expect(2) = 2.7 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -3 / -3 Query: 134 HQRDQRRHGNEPWEH 90 H+R QR+ +PW H Sbjct: 858 HRRRQRQAPRQPWHH 814
>LOC_Os12g43060:12012.t03978:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6008 Score = 29.9 bits (59), Expect(2) = 3.3 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 / -2 Query: 474 WFQVVDVHLLLVCFYLLMCVI*VCSIFLC*SVS*VFLV 587 WF + HLL V F+ L +C FLC +FL+ Sbjct: 1798 WFIFIINHLLTVIFHSLTSTTFICHPFLCLLCFLIFLL 1685 Score = 24.4 bits (47), Expect(2) = 3.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 / -3 Query: 435 FVHPRPLVLWIL 470 F+HP PLV +IL Sbjct: 2889 FIHPSPLVFFIL 2854
>LOC_Os02g09270:12002.t00774:unspliced-genomic cytochrome P450 71A1, putative, expressed| Length = 2027 Score = 26.3 bits (51), Expect(3) = 3.5 Identities = 8/34 (23%), Positives = 20/34 (58%) Frame = +3 / +1 Query: 429 SLFVHPRPLVLWILCWFQVVDVHLLLVCFYLLMC 530 +L L+ +L + +D+H+ ++ FY+++C Sbjct: 952 ALIYEEHTLIHSVLVYI*KIDLHMEVIYFYIIIC 1053 Score = 22.1 bits (42), Expect(3) = 3.5 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +1 / +2 Query: 106 LPWRRWSR*CAPSLW 150 + WRRW A S W Sbjct: 11 MAWRRWRGALASSCW 55 Score = 22.1 bits (42), Expect(3) = 3.5 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 / +2 Query: 502 SLFAFICLCVSSESVLFFYVDRSV 573 SLF CL +S +L F+ RSV Sbjct: 1088 SLFF*ECLLLS*GCILLFHFSRSV 1159
>LOC_Os07g06610:12007.t00540:unspliced-genomic ubiquitin-specific protease-like protein, putative, expressed| Length = 6938 Score = 32.2 bits (64), Expect = 3.5 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 / -2 Query: 76 SWQQQCSQGSLPWRRWSR*CAPSLWPRYP 162 S +++ +GS WRRW R P W R+P Sbjct: 88 SGRRRRRRGSRGWRRWRRRRRPGRWRRWP 2
>LOC_Os05g45510:12005.t04039:unspliced-genomic expressed protein| Length = 1848 Score = 24.9 bits (48), Expect(2) = 3.6 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 160 PLPVERRRATLLIR 201 P+PV RRRAT IR Sbjct: 258 PVPVPRRRATAQIR 299 Score = 24.4 bits (47), Expect(2) = 3.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 / +3 Query: 130 *CAPSLWPRYPLPV 171 *C P L PR PLPV Sbjct: 216 *CLPLLAPRSPLPV 257
>LOC_Os06g01890:12006.t00085:unspliced-genomic MADS-box transcription factor 56, putative, expressed| Length = 16557 Score = 29.0 bits (57), Expect(2) = 4.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 / -1 Query: 459 LWILCWFQVVDVHLLLVCFYLLM 527 L+ C F ++++H VCFYL M Sbjct: 9711 LFFSCSFNLLEIHNFSVCFYLHM 9643 Score = 26.3 bits (51), Expect(2) = 4.3 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +1 / -3 Query: 64 TSIWSWQQQCSQGSLPWRRWSR 129 T W+ Q G L W RW R Sbjct: 11119 TGAQGWRGQGGSGELAWSRWWR 11054
>LOC_Os10g41460:12010.t03382:unspliced-genomic expressed protein| Length = 1554 Score = 28.6 bits (56), Expect(2) = 4.4 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 / +2 Query: 109 PWRRWSR*CAPS 144 PW RW R CAPS Sbjct: 863 PWPRWPRRCAPS 898 Score = 23.5 bits (45), Expect(2) = 4.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 / +2 Query: 431 SLRPSKTSSSLDTMLVSSGRCSPTP 505 S RPS SSS T R SP P Sbjct: 1016 SSRPSSASSSTTTTTTRRPR*SPPP 1090
>LOC_Os06g48250:12006.t04511:unspliced-genomic cell Division Protein AAA ATPase family, putative, expressed| Length = 1937 Score = 26.3 bits (51), Expect(2) = 4.8 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 / +2 Query: 440 PSKTSSSLDTMLVSSGRCSPTP 505 PS TSSS + SS C PTP Sbjct: 998 PSPTSSSSTSTTWSSPPCPPTP 1063 Score = 22.6 bits (43), Expect(2) = 4.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 / +3 Query: 358 LKAKRPRIMCNASGRRPA 411 L+A+RPR+ RPA Sbjct: 915 LRARRPRVEARVPAPRPA 968
>LOC_Os07g10330:12007.t00907:unspliced-genomic hypothetical protein| Length = 636 Score = 31.8 bits (63), Expect = 4.9 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 / +2 Query: 109 PWRRWSR*CAPSLWPRYPLPVERRR 183 PWR W C+P+ W P RRR Sbjct: 62 PWRGWRARCSPNSWRFLMTPRRRRR 136
>LOC_Os03g22560:12003.t02006:unspliced-genomic myb-like DNA-binding domain containing protein, expressed| Length = 4617 Score = 31.8 bits (63), Expect = 4.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 / -2 Query: 488 RCSPTPCLLLFAYVCHLSLFYFSML 562 +C P C+ LF C L++FY +L Sbjct: 1496 KCVPQECISLFLLFCRLTIFYMLLL 1422
>LOC_Os02g42270:12002.t03812:unspliced-genomic T-cell activation protein phosphatase 2C-like protein, putative| Length = 948 Score = 31.8 bits (63), Expect = 4.9 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +1 / -3 Query: 91 CSQGSLPWRRWSR*CAPSLWPRYPLPVERRRATLLIRTS*MRATRAS 231 C S P RR R PS W P P RR+ R S R R S Sbjct: 847 CPSSSTPRRRSRRRRPPSAWATAPAPCPSRRSAGAPRWSRCRTARPS 707
>LOC_Os05g49620:12005.t04395:unspliced-genomic OsWRKY19 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 1260 Score = 28.1 bits (55), Expect(2) = 5.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 / -3 Query: 334 AR*RRSGRLKAKRPRIMCNASGRR 405 AR RSGR + +RP C GRR Sbjct: 826 ARAARSGRRRRRRPGRRCGRQGRR 755 Score = 23.5 bits (45), Expect(2) = 5.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 / -2 Query: 388 NASGRRPASECVLKVSSS 441 ++SGRRPA+ C S S Sbjct: 491 SSSGRRPATPCPAPTSPS 438
>LOC_Os03g02180:12003.t00110:unspliced-genomic cytochrome P450 84A1, putative, expressed| Length = 1789 Score = 27.6 bits (54), Expect(2) = 5.0 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 / +3 Query: 325 HASAR*RRSGRLKAKRPRIMCNASGRRPA 411 H + R R +A RPR+ A+GRR A Sbjct: 1452 HRARDVRAGARRRAPRPRVRVGAAGRRGA 1538 Score = 24.4 bits (47), Expect(2) = 5.0 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 / +2 Query: 76 SWQQQCSQGSLPWRR 120 +W+ S G+ PWRR Sbjct: 1148 TWRSSPSSGASPWRR 1192
>LOC_Os10g42850:12010.t03509:unspliced-genomic OsWRKY2 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 1144 Score = 27.2 bits (53), Expect(2) = 6.1 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 / -3 Query: 393 RIAHYPGPFCLEPATSSSSC 334 R H P P C P++S SSC Sbjct: 512 RRRHSPPPGCTPPSSSGSSC 453 Score = 24.0 bits (46), Expect(2) = 6.1 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -1 / -1 Query: 334 QRHEWPPKTTQQSTGTLPTLPEIILSAMA 248 +R W P + S+ TLP +L +A Sbjct: 331 RRRRWCPPQSSSSSSTLPAAAPALLVVVA 245
>LOC_Os12g23490:12012.t02078:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3987 Score = 31.3 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 / +1 Query: 152 GHSDGAHQRDQRRHGNEPWE 93 G G H RDQRR G++ WE Sbjct: 1114 GRVQGDHGRDQRRDGDDRWE 1173
>LOC_Os12g17810:12012.t01633:unspliced-genomic hypothetical protein| Length = 2104 Score = 31.3 bits (62), Expect = 6.6 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -3 / -2 Query: 215 RIHDVLINNVARRRSTGSGYLGHSDGAHQRDQRRHGNEP 99 R HDV+ R+ TG LG + HQR + N P Sbjct: 648 RRHDVIDGTAWDRKITGDRGLGRAKRRHQRGEDNEANSP 532
>LOC_Os12g15400:12012.t01395:unspliced-genomic esterase, putative, expressed| Length = 4921 Score = 31.3 bits (62), Expect = 6.6 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +3 / +3 Query: 501 LLVCFYLLMCVI*VCSIFLC*SVS*VFLVCTNQNKFGWNFLFH 629 L+ C + L C +* C+ F C*SV V L +FL H Sbjct: 3600 LIPCVFNLFCFV*QCNSFAC*SVCCVCLTLYIPPVLDISFLMH 3728
>LOC_Os08g45080:12008.t04229:unspliced-genomic expressed protein| Length = 10271 Score = 31.3 bits (62), Expect = 6.6 Identities = 18/54 (33%), Positives = 24/54 (44%) Frame = +3 / -2 Query: 456 VLWILCWFQVVDVHLLLVCFYLLMCVI*VCSIFLC*SVS*VFLVCTNQNKFGWN 617 VLW W HLL++ L V+ + F C S+S + LVC WN Sbjct: 7474 VLW*RNWESTALFHLLIIKVIALSQVLLINPRFHCSSLSNLQLVCIISRMMLWN 7313
>LOC_Os07g07070:12007.t00586:unspliced-genomic anthranilate phosphoribosyltransferase-like protein, putative,| expressed Length = 3892 Score = 31.3 bits (62), Expect = 6.6 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 / -3 Query: 188 VARRRSTGSGYLGHSDGAHQRDQRRH 111 V RRR+ + L H+DG H + +RRH Sbjct: 2831 VRRRRARPAPVLPHADGRHVQGERRH 2754
>LOC_Os07g07060:12007.t00585:unspliced-genomic prolyl-tRNA synthetase, putative, expressed| Length = 3702 Score = 31.3 bits (62), Expect = 6.6 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 / +2 Query: 188 VARRRSTGSGYLGHSDGAHQRDQRRH 111 V RRR+ + L H+DG H + +RRH Sbjct: 3467 VRRRRARPAPVLPHADGRHVQGERRH 3544
>LOC_Os06g03000:12006.t00193:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1386 Score = 31.3 bits (62), Expect = 6.6 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 / -1 Query: 459 LWILCWFQVVDVHLLLVCFYLLM 527 L+ C F ++++H L +CFYL M Sbjct: 1356 LFFSCSFNLLEIHNLFICFYLHM 1288
>LOC_Os05g49840:12005.t04417:unspliced-genomic triacylglycerol lipase, putative, expressed| Length = 4927 Score = 31.3 bits (62), Expect = 6.6 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 / +3 Query: 182 RRRSTGSGYLGHSDGAHQRDQRRHGNEP 99 RRR G G G H+R RHG EP Sbjct: 453 RRRGDGRGRRGARAARHRRGVARHGGEP 536
>LOC_Os11g12680:12011.t01155:unspliced-genomic conserved hypothetical protein| Length = 441 Score = 31.3 bits (62), Expect = 6.7 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +1 / -1 Query: 82 QQQCSQGSLPWRRWSR*CAPSLWPRYPLPVERRR 183 +Q+CS +LP RR R C+ R PL RRR Sbjct: 270 RQRCSGHALPLRRRRRRCSKRRCSRQPLSHRRRR 169
>LOC_Os07g10310:12007.t00905:unspliced-genomic mature-parasite-infected erythrocyte surface antigen, putative| Length = 831 Score = 31.3 bits (62), Expect = 6.7 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 / +2 Query: 109 PWRRWSR*CAPSLWPRYPLPVERRR 183 PW W C+PS W P RRR Sbjct: 68 PWHGWRARCSPSSWRFLMTPPRRRR 142
>LOC_Os03g50644:12003.t04404:unspliced-genomic conserved hypothetical protein| Length = 1006 Score = 31.3 bits (62), Expect = 6.7 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +1 / +1 Query: 109 PWRRWSR*CAPSLWPRYPLPVERRR 183 P R SR CAP+L PR P P RRR Sbjct: 787 PARPSSRPCAPALPPRRPHPCLRRR 861
>LOC_Os02g01150:12002.t00015:unspliced-genomic hydroxypyruvate reductase, putative, expressed| Length = 4470 Score = 31.3 bits (62), Expect = 6.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 / +1 Query: 497 PTPCLLLFAYVCHLSLFYF 553 P C+ L+ Y+C SLFYF Sbjct: 2236 PACCICLYIYICLASLFYF 2292
>LOC_Os10g39744:12010.t03216:unspliced-genomic conserved hypothetical protein| Length = 667 Score = 27.6 bits (54), Expect(2) = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 / +3 Query: 112 WRRWSR*CAPSLWPRY 159 WRRW R P LW R+ Sbjct: 219 WRRWQRRWRP*LWKRW 266 Score = 22.6 bits (43), Expect(2) = 6.7 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = +1 / +1 Query: 358 LKAKRPRIMCNASGRRPASECVLKVSSSIQD 450 LKA RPR GRR C + D Sbjct: 376 LKAWRPRTPSRGRGRRLLLVCAASFGGRVGD 468
>LOC_Os06g49130:12006.t04597:unspliced-genomic TAZ zinc finger family protein, expressed| Length = 13198 Score = 25.8 bits (50), Expect(2) = 7.3 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 / +2 Query: 249 HFAYLLRSSCSTHSRRSD 196 H L+R CS H+RR D Sbjct: 3494 H*GCLIRDECSEHARRED 3547 Score = 22.1 bits (42), Expect(2) = 7.3 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = -3 / +3 Query: 173 STGSGYLGHSDGAHQRDQRRHGNEPWEHCCCHDQMDV 63 STG+GYL + Q + + CC Q D+ Sbjct: 3612 STGTGYLNGKSNVMAQMQEQQAPFASKINCCPVQRDL 3722
>LOC_Os12g04030:12012.t00293:unspliced-genomic proteasome-associated protein ECM29, putative, expressed| Length = 6956 Score = 24.4 bits (47), Expect(2) = 7.7 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 / +2 Query: 460 FGYYVGFKWSMFTYSLFAFIC 522 +G V F +F+YS F F C Sbjct: 761 WGERVSFNVELFSYSNFVFCC 823 Score = 23.5 bits (45), Expect(2) = 7.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 / +1 Query: 506 CLLLFAYVCHLSLFYFSML 562 CLLL YV L++FY L Sbjct: 811 CLLLSLYVSLLNVFYLVSL 867
>LOC_Os01g60740:12001.t05455:unspliced-genomic nonspecific lipid-transfer protein precursor, putative, expressed| Length = 1058 Score = 24.4 bits (47), Expect(2) = 8.9 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -2 / -3 Query: 264 SCRPWHFAYLLRSSCSTHSRRSDQQCRTSALHRQR 160 + RP H A L + H R ++ R S HR+R Sbjct: 270 AARPGHRAPRLHVRQARHQRVVHRRARDSRAHRRR 166 Score = 23.5 bits (45), Expect(2) = 8.9 Identities = 7/17 (41%), Positives = 7/17 (41%) Frame = -3 / -3 Query: 140 GAHQRDQRRHGNEPWEH 90 G HQ R PW H Sbjct: 153 GRHQHHHHRQRRAPWSH 103
>LOC_Os02g33130:12002.t02956:unspliced-genomic invertase inhibitor precursor, putative, expressed| Length = 674 Score = 28.1 bits (55), Expect(2) = 9.1 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +1 / -3 Query: 76 SWQQQCSQGSLPWRRWSR*CAPSLWPRYPLPVERR 180 S+ + G PWRR R A WP P P +R Sbjct: 618 SYAAPAATGRRPWRRHRRTGARGGWPLPPSPSPQR 514 Score = 21.7 bits (41), Expect(2) = 9.1 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +2 / -3 Query: 488 RCSPTPCLLL 517 RC P PC+ L Sbjct: 249 RCRPRPCMFL 220
>LOC_Os10g04000:12010.t00289:unspliced-genomic mitogen-activated protein kinase kinase kinase 1, putative| Length = 1581 Score = 30.9 bits (61), Expect = 9.1 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 / +3 Query: 185 ARRRSTGSGYLGHSDGAHQRDQRRHGNEP 99 A RR G+G H DG R RHG P Sbjct: 567 AGRRRLGAGLHRHRDGHRPRPVERHGQRP 653
>LOC_Os08g34700:12008.t03210:unspliced-genomic GDU1, putative, expressed| Length = 1076 Score = 30.9 bits (61), Expect = 9.1 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = -3 / -1 Query: 179 RRSTGSGYLGHSDGAHQRDQRRHGNEPWEHCCC 81 RR G+ GH +R +RR W HC C Sbjct: 224 RRRAAGGHGGHHGRLRRRHRRRVEPCSWPHCLC 126
>LOC_Os05g08370:12005.t00717:unspliced-genomic CESA1 - cellulose synthase, expressed| Length = 6285 Score = 30.9 bits (61), Expect = 9.1 Identities = 9/26 (34%), Positives = 19/26 (73%) Frame = +3 / +1 Query: 456 VLWILCWFQVVDVHLLLVCFYLLMCV 533 + ++LC+ Q + + L +CFYL++C+ Sbjct: 4102 IFYLLCYEQPLHLVLSTLCFYLVLCL 4179
>LOC_Os05g04850:12005.t00379:unspliced-genomic RNA-binding protein 8A, putative, expressed| Length = 3217 Score = 30.9 bits (61), Expect = 9.1 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 / +3 Query: 471 CWFQVVDVHLLLVCFYLLMCVI*VCSI 551 C+F VDV L CF ++ V+ +CS+ Sbjct: 1164 CFFPSVDVSYLF*CFQIITVVLTICSL 1244
>LOC_Os10g33680:12010.t02668:unspliced-genomic serine/threonine-protein phosphatase 2A 72/130 kDa regulatory| subunitB, putative, expressed Length = 7862 Score = 30.9 bits (61), Expect = 9.2 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 / +1 Query: 460 FGYYVGFKWSMFTYSLFAFICLCVSSESVLFFYV 561 F Y V + SLF F C CV +++ FYV Sbjct: 5953 FVYSVSLSLIKLSLSLFNFECKCVVEPAIVLFYV 6054
>LOC_Os09g25740:12009.t02253:unspliced-genomic expressed protein| Length = 2218 Score = 30.9 bits (61), Expect = 9.2 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -2 / -3 Query: 489 RPLETNIVSKELEVLDGRRDFQHALTSRPSP 397 +P N +K DGRR F HA TS P P Sbjct: 665 KPALMNCSNKFQATGDGRRGFSHAATSPPPP 573
>LOC_Os08g40830:12008.t03813:unspliced-genomic pumilio domain-containing protein PPD1, putative, expressed| Length = 15552 Score = 30.9 bits (61), Expect = 9.2 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 / +2 Query: 106 LPWRRWSR*CAPSLWPRYPLP 168 L WR W C+ WPR P P Sbjct: 5111 LAWRAWPGACSAPAWPR*PAP 5173
>LOC_Os07g10370:12007.t00911:unspliced-genomic expressed protein| Length = 905 Score = 30.9 bits (61), Expect = 9.2 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 / +1 Query: 109 PWRRWSR*CAPSLWPRYPLPVERRR 183 PW W CAP+ W P RRR Sbjct: 271 PWHGWRARCAPNSWRFLMTPRRRRR 345
>LOC_Os05g48130:12005.t04247:unspliced-genomic hypothetical protein| Length = 456 Score = 30.9 bits (61), Expect = 9.2 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +1 / +2 Query: 82 QQQCSQGSLPWRRWSR*CAPSLWPRYPLPVERRR 183 +Q+CS +LP R R C+ R PLP RRR Sbjct: 56 RQRCSGHALPLRCRRRRCSKRRCSRRPLPRRRRR 157
>LOC_Os05g34240:12005.t03018:unspliced-genomic expressed protein| Length = 3448 Score = 30.9 bits (61), Expect = 9.2 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -2 / -3 Query: 414 TSRPSP*RIAHYPGPFCLEPATSSSSCRGMSGLQRQH 304 T R +P +H P CLE +S S + + LQR H Sbjct: 800 TDRSTPSACSHKGSPLCLEELSSYSISQSLELLQRCH 690
>LOC_Os03g24610:12003.t02155:unspliced-genomic hydrolase, putative, expressed| Length = 3383 Score = 30.9 bits (61), Expect = 9.2 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 / -2 Query: 109 PWRRWSR*CAPSLWPRYPLP 168 PWR W R* +P W R P P Sbjct: 271 PWRTWRR*TSPRGW*RAPPP 212
>LOC_Os03g17010:12003.t01482:unspliced-genomic THO complex subunit 4, putative, expressed| Length = 3726 Score = 30.9 bits (61), Expect = 9.2 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +2 / -3 Query: 161 RCRWSADVRHC*SERRECVLQELRSRYAKCHG 256 R WSA H S + VLQ+ + YA CHG Sbjct: 2182 RSSWSASHLHGISPSQHQVLQQTLAGYALCHG 2087
>LOC_Os02g49270:12002.t04511:unspliced-genomic proliferating-cell nucleolar antigen p120, putative, expressed| Length = 5382 Score = 30.9 bits (61), Expect = 9.2 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 / +1 Query: 478 FKWSMFTYSLFAFICLCVSS 537 F W MFT S+FA +C CV S Sbjct: 3616 FLWIMFT*SVFAKLCDCVQS 3675
>LOC_Os02g36890:12002.t03326:unspliced-genomic DNA binding protein, putative, expressed| Length = 2323 Score = 30.9 bits (61), Expect = 9.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 / -2 Query: 49 DHLYQTSIWSWQQQCSQGSL 108 DHL+ S WSW CS S+ Sbjct: 396 DHLFPRSAWSWMMVCSSCSV 337
>LOC_Os01g29488:12001.t02637:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 7915 Score = 30.9 bits (61), Expect = 9.2 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 / -3 Query: 466 YYVGFKWSMFTYSLFAFICLCVSSESVLFF 555 ++ F S F + LF+F LC+ + LFF Sbjct: 2810 FFFSFFLSFFLFFLFSFFLLCIFGAAFLFF 2721
>LOC_Os01g03020:12001.t00194:unspliced-genomic leucyl-tRNA synthetase, putative, expressed| Length = 9266 Score = 30.9 bits (61), Expect = 9.2 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +2 / +1 Query: 392 RQGEGLLVSAC*KSLRPSKTSSSLDTMLVSSGRCSPTPCLLL 517 R G G S + R S T+S+ + +S CSPTP LLL Sbjct: 223 RGGRGTGRSTARSAPRTSATASTPPSPSATSSTCSPTPGLLL 348 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 271,705,357 Number of extensions: 4680833 Number of successful extensions: 24438 Number of sequences better than 10.0: 67 Length of query: 216 Length of database: 55,613,886 Length adjustment: 48 Effective length of query: 168 Effective length of database: 52,912,542 Effective search space: 8889307056 Effective search space used: 8889307056 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)