ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf39f04 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os07g22640:12007.t01967:unspliced-genomic lipid binding protein, putative, expressed| Length = 13170 Score = 168 bits (361), Expect(12) = 0.0 Identities = 71/77 (92%), Positives = 74/77 (96%) Frame = +3 / +1 Query: 993 SELELKPEGKLSVTVVKAISLKNKELIGKSDPYVTLYVRPMFKVKTKVIDDNLNPEWNET 1172 SELELKP+G+L+VTVVKA SLKNKELIGKSDPYV LYVRPMFKVKTKVIDDNLNPEWNET Sbjct: 7246 SELELKPQGRLTVTVVKATSLKNKELIGKSDPYVILYVRPMFKVKTKVIDDNLNPEWNET 7425 Query: 1173 FELIVEDKETQSVIFEV 1223 F LIVEDKETQSVIFEV Sbjct: 7426 FPLIVEDKETQSVIFEV 7476 Score = 147 bits (315), Expect(12) = 0.0 Identities = 49/82 (59%), Positives = 58/82 (70%) Frame = +2 / +1 Query: 1388 GHVSSIYQGRTTGSPGVRKESNRGEKAAEGGWGNWQHDGCTWWRRFTSWFRCWICGHWRC 1567 GH+S I++GRT GSP V KES RGEKA +GGWG W ++GC+WW FTSWF CW CGHW C Sbjct: 12478 GHISPIFKGRTDGSPRV*KESYRGEKATQGGWGYW*YNGCSWWCCFTSWFWCWTCGHWHC 12657 Query: 1568 RGCWARGLRAWCWRWSGRFWYW 1633 R W +R WCW W+ F W Sbjct: 12658 RRGWTCWIRNWCWCWACWFGCW 12723 Score = 106 bits (226), Expect(12) = 0.0 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = +3 / +2 Query: 1218 EVYDEDNLQQDKRLGVAKLAVNNIVPEIPSEITLKLMQSLDSLKIKDYRDRGSLHLKV 1391 +VYDED LQQDK+LGVAKLAVN++ PE SEITLKL QSLDSLKIKD +DRG+LHL+V Sbjct: 10340 QVYDEDRLQQDKKLGVAKLAVNSLQPEATSEITLKLQQSLDSLKIKDTKDRGTLHLQV 10513 Score = 95.9 bits (203), Expect(12) = 0.0 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = +3 / +1 Query: 489 QAATAVVKESVEPLLDDYRPPGIKSLKFNKFSLGNVSPKIEGIRI 623 QAATAVVKESVEPLLDDYRPPGIKSLKF+KFSLG VSPKIEG I Sbjct: 3421 QAATAVVKESVEPLLDDYRPPGIKSLKFSKFSLGTVSPKIEGFPI 3555 Score = 90.0 bits (190), Expect(12) = 0.0 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +3 / +2 Query: 609 EGIRIQNLQPGQIIMDIDFRWGGDPSIILAVDARVASLPIQL 734 +GIRIQN+QPGQIIMDID RWGGDPSIILAVDA VASLPIQ+ Sbjct: 4826 KGIRIQNIQPGQIIMDIDLRWGGDPSIILAVDAVVASLPIQV 4951 Score = 87.7 bits (185), Expect(12) = 0.0 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +3 / +1 Query: 324 KRVAKAADIMVLGSLGRDDLKKLCGDNFPEWISFPQYEQV 443 K +AADI VLGSLGRDDLKKLCGDNFPEWISFPQYEQV Sbjct: 607 KLFLQAADIKVLGSLGRDDLKKLCGDNFPEWISFPQYEQV 726 Score = 71.6 bits (150), Expect(12) = 0.0 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 / +3 Query: 729 QLKDLQVFTVVRVVFQLSEEIPCISAFVVALLAE 830 QLKDLQV+T+VRVVFQLSEEIPCISA VVALLAE Sbjct: 5043 QLKDLQVYTIVRVVFQLSEEIPCISAVVVALLAE 5144 Score = 65.7 bits (137), Expect(12) = 0.0 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = +3 / +1 Query: 828 EPEPKIQYTLKAVGGSLTAIPGLSDMID 911 +PEPKIQYTLKA+GGSLTA+PGLSDMID Sbjct: 5752 QPEPKIQYTLKAIGGSLTAVPGLSDMID 5835 Score = 63.4 bits (132), Expect(12) = 0.0 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = +3 / +3 Query: 912 DTVNSIVNDMLQWPHRVVVPLGVNVDT 992 DTVNSIV+DML+WPHR+VVPLGVNVDT Sbjct: 5916 DTVNSIVSDMLKWPHRLVVPLGVNVDT 5996 Score = 62.5 bits (130), Expect(12) = 0.0 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 / +2 Query: 1665 KFMGRTVTGHLGISRKSGSSSTVPQPDQPSA*LDVQ* 1775 KFMG+TV G +SRK+GSSST PQ +QPSA*LDVQ* Sbjct: 12776 KFMGKTVAGPFSMSRKNGSSSTAPQAEQPSA*LDVQ* 12886 Score = 50.1 bits (103), Expect(12) = 0.0 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +3 / +2 Query: 438 QVKWLNKHLSKLWPFVSQAATAVVK 512 QVKWLNKHLSKLWPFV Q VK Sbjct: 2543 QVKWLNKHLSKLWPFVDQVRQMFVK 2617 Score = 46.4 bits (95), Expect(12) = 0.0 Identities = 19/35 (54%), Positives = 23/35 (65%) Frame = +3 / +3 Query: 234 MGFLSXXXXXXXXXXXIMAGWSRVMQRRTRKRVAK 338 MG +S +MAGWSRVMQRR+RKR+AK Sbjct: 375 MGLISGMVMGMVVGVALMAGWSRVMQRRSRKRIAK 479 Score = 145 bits (311), Expect(13) = e-168 Identities = 60/81 (74%), Positives = 67/81 (82%) Frame = -3 / -1 Query: 1220 LKNDRLGFLVFNNQFKCFIPFRI*VVVYDFCFDLEHGTHIQGHVGIRFTNQLLILQRYCF 1041 LKNDRLGF VFNNQ +CFIPFRI*V++YDFCFDLEH THI H+ I FTNQLLILQ CF Sbjct: 7473 LKNDRLGFFVFNNQRECFIPFRI*VIIYDFCFDLEHWTHI*YHIWI*FTNQLLILQ*SCF 7294 Query: 1040 YYSNRQFSLRFKLQLTCINID 978 YYSN + SLRFKLQLT ++ Sbjct: 7293 YYSNSKSSLRFKLQLTADEVE 7231 Score = 88.1 bits (186), Expect(13) = e-168 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -3 / -3 Query: 731 LNRQ*CNSSINSKDYAWITTPTEIYIHYDLAWLEILDTDAF 609 LNR+*CN+SINSKDYAWITTPT+IYIHYDLAWL IL+ + F Sbjct: 4948 LNRK*CNNSINSKDYAWITTPTKIYIHYDLAWLNILNANTF 4826 Score = 73.5 bits (154), Expect(13) = e-168 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -2 / -3 Query: 441 PAHTVGKISTRGNCRRRAS*GRPCQETQGP*YPQP 337 PAHT G+ISTRGNCRR AS* RP +ETQGP*YPQP Sbjct: 724 PAHTAGRISTRGNCRRTAS*DRPYRETQGP*YPQP 620 Score = 72.5 bits (152), Expect(13) = e-168 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = -3 / -1 Query: 611 FDLWRDISKREFVELQRFYSWRSIII*QWFN*FLNNCSCSL 489 F LW + SKREF ELQRFYSWRSIII*QW N FL+ CS SL Sbjct: 3543 FYLW*NSSKREFAELQRFYSWRSIII*QWLNRFLDYCSGSL 3421 Score = 69.8 bits (146), Expect(13) = e-168 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -1 / -1 Query: 1777 SHCTSSYAEGWSGWGTVELLPLLRDMPKCPVTVLPMNF 1664 +HCTSS+AEG S WG VELLP RD+ K P TVLPMNF Sbjct: 12888 NHCTSSHAEGCSAWGAVELLPFFRDILKGPATVLPMNF 12775 Score = 63.4 bits (132), Expect(13) = e-168 Identities = 33/60 (55%), Positives = 38/60 (63%) Frame = -2 / -2 Query: 1392 *P*DAVILYPCSL*S*VNLVTA*ASE*FHWEFRAQYYSLLI*PHLASCLAEGCLHHKPQK 1213 *P D + LYP * * NLV A S+*FHW + + SLL+* H A CLAE CLHH P K Sbjct: 10514 *PEDVMFLYPWCP*F*ENLVIAEVSK*FHW*PQVEDCSLLV*LHQAFCLAEVCLHHIPAK 10335 Score = 62.0 bits (129), Expect(13) = e-168 Identities = 25/44 (56%), Positives = 29/44 (65%) Frame = -2 / -2 Query: 1632 QYQNLPDQRQHQALSPRAQHPRQRQCPQIQHLNQLVKRRHQVHP 1501 Q+ N Q QHQ L + Q RQ QCPQ+QH NQLVK+ HQ HP Sbjct: 12722 QHPNQQAQHQHQFLIQQVQPRRQCQCPQVQHQNQLVKQHHQEHP 12591 Score = 58.8 bits (122), Expect(13) = e-168 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -1 / -3 Query: 829 SARRATTKAEMQGISSDS*NTTRTTVKTWRSLS 731 SARRATT AEMQGISSDS*NTTRT V T RSLS Sbjct: 5143 SARRATTTAEMQGISSDS*NTTRTMV*T*RSLS 5045 Score = 56.1 bits (116), Expect(13) = e-168 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -1 / -2 Query: 916 VSSIISESPGIAVRLPPTAFNVYCILGSG 830 ++SI+SESPG AVRLPP AF VYCI GSG Sbjct: 5840 LTSIMSESPGTAVRLPPIAFKVYCIFGSG 5754 Score = 49.6 bits (102), Expect(13) = e-168 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = -1 / -1 Query: 1504 SIVLPITPASFSRFLSSIAFFXXXXXXXXXSLVNG*YMT 1388 SIVLPITPAS SRFLSSIA F S NG*Y+T Sbjct: 12594 SIVLPITPASLSRFLSSIALFSDSRASICSSFENG*YVT 12478 Score = 46.9 bits (96), Expect(13) = e-168 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -2 / -1 Query: 993 LYQH*RQVEQQPCVATGACH*QLN*Q 916 LYQH* QVEQQ CVAT AC QLN*Q Sbjct: 5997 LYQH*HQVEQQACVAT*ACQKQLN*Q 5920 Score = 43.2 bits (88), Expect(13) = e-168 Identities = 21/44 (47%), Positives = 25/44 (56%) Frame = -1 / -3 Query: 361 PRTMISAALATRFLVRRCITRLHPAXXXXXXXXXXXXPERNPIV 230 PR + LA RFL+RRCITRLHPA PE +PI+ Sbjct: 502 PRAPETRTLAMRFLLRRCITRLHPAISATPTTIPITIPEISPIL 371 Score = 42.3 bits (86), Expect(13) = e-168 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -1 / -1 Query: 484 TKGQSLLRCLFNHFTC 437 TKGQSLLRCLF+HFTC Sbjct: 2589 TKGQSLLRCLFSHFTC 2542 Score = 133 bits (285), Expect(14) = e-149 Identities = 60/77 (77%), Positives = 65/77 (84%) Frame = +2 / +3 Query: 992 K*AGA*T*GKTVCYCSKSNISEE*GVDW*I*SLRDPVCASHVQGQNKSHRRQPKS*ME*N 1171 +*AGA*T GKT CYCSKSN EE*GVDW*I S+ D +CAS+VQGQNKSHR PKS*ME*N Sbjct: 7245 Q*AGA*TSGKTYCYCSKSNFIEE*GVDW*IRSICDTICASNVQGQNKSHR**PKS*ME*N 7424 Query: 1172 I*IDC*RQGNPICHF*G 1222 I DC*RQ NP+CHF*G Sbjct: 7425 IPSDC*RQRNPVCHF*G 7475 Score = 86.3 bits (182), Expect(14) = e-149 Identities = 35/66 (53%), Positives = 42/66 (63%) Frame = +2 / +1 Query: 1577 WARGLRAWCWRWSGRFWYWRRGQRPW*SWEVHGEDCDRALGHIS*EW*QLHCSPT*PAFC 1756 W W W+ F YWR QRP *SWE+HG+DC RA ++ E *QL+CSP * FC Sbjct: 12688 WCWCWACWFGCWACWFGYWRCRQRPR*SWEIHGQDCGRAFQYVPEER*QLNCSPG*TTFC 12867 Query: 1757 IT*CTV 1774 +T*CTV Sbjct: 12868 VT*CTV 12885 Score = 85.4 bits (180), Expect(14) = e-149 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +3 / +2 Query: 1386 KVMYHPFTKEEQLEALESEKKAIEERKRLKEAGVIGSTMD 1505 +V YHPF+KEEQ+EALESEK+AIEERKRLKEAGVIGSTMD Sbjct: 12476 QVTYHPFSKEEQMEALESEKRAIEERKRLKEAGVIGSTMD 12595 Score = 79.9 bits (168), Expect(14) = e-149 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +2 / +1 Query: 611 RHPYPKSPARPNHNGYRFPLGW*SKHNPCC*CSSCITAYS 730 R+ + K ARPNHNGYR LGW*SKHNPCC*C CIT+YS Sbjct: 4828 RYSHSKYSARPNHNGYRSSLGW*SKHNPCC*CCCCITSYS 4947 Score = 70.3 bits (147), Expect(14) = e-149 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +2 / +3 Query: 338 GCGYHGPWVSWQGRPQEALRRQFPRVDIFPTV*AG 442 GCGY GPWVS GR QEA+RRQFPRVDI P V*AG Sbjct: 621 GCGYQGPWVSR*GRSQEAVRRQFPRVDILPAV*AG 725 Score = 60.6 bits (126), Expect(14) = e-149 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +2 / +2 Query: 914 YCQFNCQ*HAPVATQGCCSTWRQC*YK 994 +CQFNC *HA VATQ CCSTW QC*YK Sbjct: 5918 HCQFNCF*HAQVATQACCSTWCQC*YK 5998 Score = 58.8 bits (122), Expect(14) = e-149 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +2 / +2 Query: 728 SAQGSPGLYRCSCCISTVRRDSLHLCFCCCSPRR 829 +AQ S L+ C CCIST+R D LHLC CCCS R Sbjct: 5042 TAQRSSSLHHCPCCISTIRGDPLHLCCCCCSSCR 5143 Score = 51.9 bits (107), Expect(14) = e-149 Identities = 32/59 (54%), Positives = 37/59 (62%) Frame = +2 / +1 Query: 1214 F*GL**RQPSARQEARCG*ISSE*YCARNSQ*NHSEAYAVTRFTQD*RLQG*RITAS*G 1390 F G+**RQ SARQ+A C * SSE Q*NH E A+TRF+ +* QG*R S G Sbjct: 10336 FAGI**RQTSARQKAWCS*TSSEQSST*GYQ*NHFETSAITRFS*N*GHQG*RNITSSG 10512 Score = 44.1 bits (90), Expect(14) = e-149 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = +2 / +3 Query: 554 NKIFEVQQILSWKCLAKDRRHPY 622 NKI EVQQILSW C KDRR Y Sbjct: 3486 NKISEVQQILSWNCFTKDRRFSY 3554 Score = 40.9 bits (83), Expect(14) = e-149 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = +1 / +3 Query: 1498 RWMHLVAPLH*LVQVLDLWALAL 1566 +WM LV LH*LV VLDLWALAL Sbjct: 12588 QWMLLVVLLH*LVLVLDLWALAL 12656 Score = 34.5 bits (69), Expect(14) = e-149 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +2 / +3 Query: 830 ARA*NTVHIEGCWG*SDCYSRTF*YD* 910 ARA NT+H EG W SD SRT +D* Sbjct: 5754 ARAENTIHFEGYWRKSDRCSRTLRHD* 5834 Score = 27.6 bits (54), Expect(14) = e-149 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 / +1 Query: 440 GEMVEQAS*QTLAF 481 GEM EQAS QTLAF Sbjct: 2545 GEMAEQASQQTLAF 2586 Score = 26.7 bits (52), Expect(14) = e-149 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 / +2 Query: 296 EPRDAAAHQEARRQGCGYHGPW 361 EP DAAA QEA R G + W Sbjct: 437 EPCDAAAQQEAHR*GSCFGCAW 502 Score = 26.3 bits (51), Expect(14) = e-149 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 / +2 Query: 526 HC*MIIDLQE 555 HC*MIIDLQE Sbjct: 3458 HC*MIIDLQE 3487 Score = 131 bits (280), Expect(9) = e-121 Identities = 55/65 (84%), Positives = 59/65 (90%) Frame = -1 / -2 Query: 1216 KMTDWVSLSSTINSNVSFHSGFRLSSMTFVLTLNMGRTYRVT*GSDLPINSLFFRDIAFT 1037 KMTDWVSLSSTI NVSFHSGFRLSSMTFVLTLN+GRTY +T GSDLPINSLFF ++AFT Sbjct: 7469 KMTDWVSLSSTIRGNVSFHSGFRLSSMTFVLTLNIGRTYSITYGSDLPINSLFFNEVAFT 7290 Query: 1036 TVTDS 1022 TVT S Sbjct: 7289 TVTVS 7275 Score = 84.9 bits (179), Expect(9) = e-121 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = -1 / -2 Query: 442 TCSYCGKDIHSGKLSPQSFLRSSLPRDPRTMISAALATRF 323 TCSYCGKDIHSGKLSP SFLRSSLPRDPRT+ISAA F Sbjct: 725 TCSYCGKDIHSGKLSPHSFLRSSLPRDPRTLISAACRKSF 606 Score = 76.7 bits (161), Expect(9) = e-121 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -1 / -1 Query: 739 SLS*IGSDATRASTARIMLGSPPQRKSISIMIWPGWRFWIRMP 611 S +*IGSDAT ASTARIMLGSPPQR+SISIMIWPG F +R+P Sbjct: 4956 SKT*IGSDATTASTARIMLGSPPQRRSISIMIWPG*IF*MRIP 4828 Score = 73.0 bits (153), Expect(9) = e-121 Identities = 39/90 (43%), Positives = 50/90 (55%) Frame = -2 / -2 Query: 1776 LTVHQVMQKAGQVGEQWSCYHSYEICPSALSQSSP*TSQLYQGRCPRRQYQNLPDQRQHQ 1597 +TVHQV QK Q GEQ SCY S A QS P* SQLY+GRC +RQY N Q +Q Sbjct: 12887 ITVHQVTQKVVQPGEQLSCYRSSGTY*KARPQSCP*ISQLYRGRCRQRQYPNQQAQHPNQ 12708 Query: 1596 ALSPRAQHPRQRQCPQIQHLNQLVKRRHQV 1507 + Q Q+ P+ Q V+ ++Q+ Sbjct: 12707 QAQHQHQFLIQQVQPRRQCQCPQVQHQNQL 12618 Score = 61.1 bits (127), Expect(9) = e-121 Identities = 23/53 (43%), Positives = 27/53 (50%) Frame = -3 / -2 Query: 992 CINIDAKWNNNPVWPLEHVXXXXXXXXXXXIRKSWNSSQTTPNSLQCVLYFRL 834 CINID KWNN PVWPLEHV +SW+ ++C YF L Sbjct: 5996 CINIDTKWNNKPVWPLEHVRNN*IDSVLIKGEESWSGFYNLLEEIKCSKYFHL 5838 Score = 60.6 bits (126), Expect(9) = e-121 Identities = 34/59 (57%), Positives = 40/59 (67%) Frame = -3 / -3 Query: 1391 DLKMQ*SSIPVVFNLE*I**LHKLQSDFTGNFGHNIIHC*FSHT*PLVLLKVVFIINLK 1215 +LKM SSI V N + I**L K QSDFTG+ +HC*FS+T VLLK VFII L+ Sbjct: 10513 NLKM*CSSILGVLNFKRI**LLKFQSDFTGSLRLKTVHC*FSYTKLFVLLKSVFIIYLQ 10337 Score = 55.6 bits (115), Expect(9) = e-121 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -3 / -2 Query: 836 LWLCEESNNKSRDAGNLF*QLKYNTNNGKDLEILEL 729 ++LC++SNN SRDA +L * LKYNT+NG DL+I EL Sbjct: 5150 VYLCKKSNNNSRDARDLL**LKYNTDNGVDLKIFEL 5043 Score = 51.0 bits (105), Expect(9) = e-121 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -1 / -2 Query: 622 IRMPSIFGETFPRENLLNFKDFIP 551 I PSIFGET PRENLLNF+DFIP Sbjct: 3554 IGKPSIFGETVPRENLLNFRDFIP 3483 Score = 36.8 bits (74), Expect(9) = e-121 Identities = 13/16 (81%), Positives = 16/16 (100%) Frame = -3 / -3 Query: 485 NKRPKFAKMLVQPFHL 438 N+RP+FA+MLVQPFHL Sbjct: 2590 NERPEFAEMLVQPFHL 2543 Score = 123 bits (263), Expect(9) = 1e-91 Identities = 60/76 (78%), Positives = 61/76 (80%) Frame = -2 / -3 Query: 1221 PQK*QIGFPCLQQSIQMFHSIQDLGCRL*LLF*P*TWDAHTGSRRDQIYQSTPYSSEILL 1042 PQK*Q GF CLQQS MFHSIQDLG L*LLF*P*T DAH S D IYQSTPYSS LL Sbjct: 7474 PQK*QTGFLCLQQSEGMFHSIQDLGYHL*LLF*P*TLDAHIVSHMDLIYQSTPYSSMKLL 7295 Query: 1041 LLQ*QTVFPQV*APAH 994 LLQ*Q VFP+V*APAH Sbjct: 7294 LLQ*Q*VFPEV*APAH 7247 Score = 71.2 bits (149), Expect(9) = 1e-91 Identities = 38/80 (47%), Positives = 45/80 (56%) Frame = -3 / -3 Query: 1781 LLSLYIKLCRRLVRLGNSGAATTLTRYAQVPCHSPPHELPSFTKAAAHGANTRTYQTSAS 1602 L SLYIK RRL LG+S AAT L + + P HS HE PSFT+AAA ANTRT + + Sbjct: 12892 LQSLYIKSRRRLFSLGSS*AATVLPGHTERPGHSLAHEFPSFTEAAADSANTRTNKPNTR 12713 Query: 1601 TKP*AHEPNTPGNASAHKSN 1542 T N+ N S N Sbjct: 12712 TNKPNTSTNS*SNKSNPADN 12653 Score = 68.4 bits (143), Expect(9) = 1e-91 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 / -2 Query: 729 E*AVMQLEHQQQGLCLDHHPNGNLYPL*FGLAGDF 625 E* VMQ +HQQQGLCLDHHPN +LYPL*FGLA F Sbjct: 4946 E*EVMQQQHQQQGLCLDHHPNEDLYPL*FGLAEYF 4842 Score = 64.8 bits (135), Expect(9) = 1e-91 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 / -1 Query: 443 HLLILWERYPLGEIVAAELLEVVPAKRPKDHDIRSL 336 +LLIL E YPLGEIVAA+LLE+VP +RPKD DIRSL Sbjct: 726 NLLILREGYPLGEIVAAQLLEIVPTERPKDLDIRSL 619 Score = 50.6 bits (104), Expect(9) = 1e-91 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -2 / -3 Query: 612 LRSLARHFQERIC*TSKILFLEVDNH 535 L SL + FQERIC*TS+ILFLEVDNH Sbjct: 3544 LLSLVKQFQERIC*TSEILFLEVDNH 3467 Score = 48.3 bits (99), Expect(9) = 1e-91 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -3 / -1 Query: 896 KSWNSSQTTPNSLQCVLYFRLWL 828 +SWNS QT+ NSLQ VLYFRLWL Sbjct: 5820 ESWNSGQTSSNSLQSVLYFRLWL 5752 Score = 38.6 bits (78), Expect(9) = 1e-91 Identities = 20/35 (57%), Positives = 24/35 (68%) Frame = -2 / -1 Query: 834 LALRGEQQQKQRCRESLLTVEIQHEQR*RPGDP*A 730 + L+ EQQQ+QRC+ S L VEIQH Q R D *A Sbjct: 5148 IPLQEEQQQQQRCKGSPLIVEIQHGQWCRLEDL*A 5044 Score = 31.8 bits (63), Expect(9) = 1e-91 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 / -1 Query: 1321 FRVISLGISGTILFTANLATP 1259 F+VISL SG LFTA+LATP Sbjct: 10443 FKVISLVASG*RLFTASLATP 10381 Score = 31.3 bits (62), Expect(9) = 1e-91 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -1 / -3 Query: 955 CGHWSMSLTIELTVS 911 CGH SMS TIELTVS Sbjct: 5959 CGHLSMSETIELTVS 5915 Score = 98.2 bits (208), Expect(7) = 1e-49 Identities = 52/76 (68%), Positives = 55/76 (72%) Frame = +1 / +2 Query: 994 VSWSLNLRENCXXXXXKQYL*RIRS*LVNLIPT*PCMCVPCSRSKQKSXXXXXILNGMKH 1173 VSWSLNLRE+ KQ *RIRS*LVN I * MCV CSRSKQKS ILNGMKH Sbjct: 7247 VSWSLNLREDLLLL**KQLH*RIRS*LVNQIHM*YYMCVQCSRSKQKS*MIT*ILNGMKH 7426 Query: 1174 LN*LLKTRKPNLSFLR 1221 *LLKT+KP+LSFLR Sbjct: 7427 SL*LLKTKKPSLSFLR 7474 Score = 58.3 bits (121), Expect(7) = 1e-49 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = +1 / +2 Query: 337 RLRISWSLGLLAGTTSRSSAATISPSGYLSHSMSR 441 RLRIS SLGL GT SRS AATISPSGY S SMSR Sbjct: 620 RLRISRSLGLSVGTISRSCAATISPSGYPSRSMSR 724 Score = 47.3 bits (97), Expect(7) = 1e-49 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = +1 / +1 Query: 937 TCSSGHTGLLFHLASMLIQVSWS 1005 TCSSGHTGLLFHL SMLIQ +S Sbjct: 5941 TCSSGHTGLLFHLVSMLIQGDFS 6009 Score = 40.0 bits (81), Expect(7) = 1e-49 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +1 / +3 Query: 1213 FLRFMMKTTFSKTRG*VWLN*Q*IILCPKFPVK 1311 F R+MMKT FSKT+ V LN*Q* + + PVK Sbjct: 10335 FCRYMMKTDFSKTKSLV*LN*Q*TVFNLRLPVK 10433 Score = 39.1 bits (79), Expect(7) = 1e-49 Identities = 19/38 (50%), Positives = 22/38 (57%) Frame = +1 / +3 Query: 1657 KLGSSWGGL*QGTWAYLVRVVAAPLFPNLTSLLHNLMY 1770 KLG+SW L G R VAA L P L +LL +LMY Sbjct: 12768 KLGNSWARLWPGLSVCPGRTVAAQLLPRLNNLLRDLMY 12881 Score = 29.9 bits (59), Expect(7) = 1e-49 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 / +3 Query: 1372 DHCILRSCIIHLPRKNNWKP 1431 D + RS I H RKN WKP Sbjct: 12462 DILLFRSHITHFQRKNRWKP 12521 Score = 29.0 bits (57), Expect(7) = 1e-49 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = +2 / +1 Query: 1577 WARGLRAWCWRWSGRFWYWRRGQRPW 1654 W +W W W+ W+ RRG W Sbjct: 12601 WWCCFTSWFWCWTCGHWHCRRGWTCW 12678 Score = 56.5 bits (117), Expect(2) = 3e-10 Identities = 27/48 (56%), Positives = 32/48 (66%) Frame = -3 / -3 Query: 1631 NTRTYQTSASTKP*AHEPNTPGNASAHKSNT*TN**SGATKCIHRAAN 1488 NTRT + + ST *+++ N NASAHKSNT TN**S TK IH N Sbjct: 12721 NTRTNKPNTSTNS*SNKSNPADNASAHKSNTRTN**SSTTKSIHCTTN 12578 Score = 37.3 bits (75), Expect(2) = 3e-10 Identities = 17/28 (60%), Positives = 21/28 (75%) Frame = -2 / -3 Query: 912 HQSYQKVLE*QSDYPQQPSMCTVF*ALA 829 HQS ++VLE +SD+ Q PS C VF ALA Sbjct: 5836 HQSCRRVLEQRSDFLQ*PSKCIVFSALA 5753
>LOC_Os03g14700:12003.t01257:unspliced-genomic lipid binding protein, putative| Length = 4816 Score = 151 bits (325), Expect(12) = e-146 Identities = 62/78 (79%), Positives = 69/78 (88%) Frame = +3 / +1 Query: 993 SELELKPEGKLSVTVVKAISLKNKELIGKSDPYVTLYVRPMFKVKTKVIDDNLNPEWNET 1172 S+LELKP GKL+VTVV+A SLKNKELIGKSDPYV LY+RPMFK KT VIDDNLNPEWNET Sbjct: 3865 SDLELKPHGKLTVTVVRAESLKNKELIGKSDPYVVLYIRPMFKEKTSVIDDNLNPEWNET 4044 Query: 1173 FELIVEDKETQSVIFEVY 1226 F LI EDKETQ +I +V+ Sbjct: 4045 FSLIAEDKETQHLILQVH 4098 Score = 79.9 bits (168), Expect(12) = e-146 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +3 / +1 Query: 489 QAATAVVKESVEPLLDDYRPPGIKSLKFNKFSLGNVSPKIEGIR 620 QAAT V+++SVEP+LDDYRP GI SLKF+K SLG V PKIEG R Sbjct: 2770 QAATMVIRDSVEPILDDYRPAGISSLKFSKLSLGTVPPKIEGFR 2901 Score = 79.0 bits (166), Expect(12) = e-146 Identities = 33/62 (53%), Positives = 46/62 (74%) Frame = +3 / +2 Query: 1218 EVYDEDNLQQDKRLGVAKLAVNNIVPEIPSEITLKLMQSLDSLKIKDYRDRGSLHLKVMY 1397 +V+DED L+QDKRLG+AKL +N++ E EI L+L+ SLD+ K+KD +DRG L +KV Sbjct: 4175 QVFDEDKLKQDKRLGIAKLPLNDLEMESVQEINLQLLSSLDTTKVKDKKDRGVLTIKVSS 4354 Query: 1398 HP 1403 P Sbjct: 4355 CP 4360 Score = 69.8 bits (146), Expect(12) = e-146 Identities = 24/42 (57%), Positives = 35/42 (83%) Frame = +3 / +1 Query: 321 RKRVAKAADIMVLGSLGRDDLKKLCGDNFPEWISFPQYEQVK 446 +K + +AAD+ L SL R+D+KK+CG+N PEW+SFP+YEQV+ Sbjct: 2290 KKILYQAADVNALASLDREDVKKICGENLPEWVSFPEYEQVQ 2415 Score = 68.0 bits (142), Expect(12) = e-146 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +3 / +1 Query: 711 VASLPIQLKDLQVFTVVRVVFQLSEEIPCISAFVVALLAE 830 V S+ IQ K+LQV+T++RVVFQL +EIPCISA VVALLAE Sbjct: 3229 VCSVCIQFKNLQVYTIIRVVFQLCDEIPCISAVVVALLAE 3348 Score = 57.4 bits (119), Expect(12) = e-146 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +3 / +2 Query: 822 LAEPEPKIQYTLKAVGGSLTAIPGLSDMID 911 L +P+P+I Y LKAVGGSLTA+PGLSDMID Sbjct: 3452 LWQPKPRIDYILKAVGGSLTAMPGLSDMID 3541 Score = 55.1 bits (114), Expect(12) = e-146 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = +3 / +2 Query: 1386 KVMYHPFTKEEQLEALESEKKAIEERKRLKE 1478 +V+YHPFTK E LEALE EKK +EER++ KE Sbjct: 4433 QVLYHPFTKAEALEALELEKKTVEERRKTKE 4525 Score = 48.7 bits (100), Expect(12) = e-146 Identities = 17/25 (68%), Positives = 22/25 (88%) Frame = +3 / +1 Query: 903 MIDDTVNSIVNDMLQWPHRVVVPLG 977 ++ DTV S++ DMLQWPHR+VVPLG Sbjct: 3631 LV*DTVASLIADMLQWPHRIVVPLG 3705 Score = 44.1 bits (90), Expect(12) = e-146 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +3 / +1 Query: 438 QVKWLNKHLSKLWPFVSQAAT 500 QVKWLNK LSKLWPFV + T Sbjct: 2566 QVKWLNKQLSKLWPFVEEVHT 2628 Score = 39.1 bits (79), Expect(12) = e-146 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +3 / +1 Query: 234 MGFLSXXXXXXXXXXXIMAGWSRVMQRRTRKRVAKA 341 MGF+S ++AGWSR M RR KR AKA Sbjct: 1687 MGFISGVVMGMIIGVALIAGWSRAMARRAAKRSAKA 1794 Score = 37.3 bits (75), Expect(12) = e-146 Identities = 18/40 (45%), Positives = 23/40 (57%) Frame = +2 / +3 Query: 611 RHPYPKSPARPNHNGYRFPLGW*SKHNPCC*CSSCITAYS 730 RH + R N+NG R LG S + PC * SSC T++S Sbjct: 2982 RHSDSELQERANYNGRRLSLGRGS*YCPCS*HSSCFTSHS 3101 Score = 29.9 bits (59), Expect(12) = e-146 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 / +2 Query: 1665 KFMGRTVTGHLGISRKSGSS 1724 KF+GRTVTG +R+S SS Sbjct: 4736 KFVGRTVTGPFSSARRSASS 4795 Score = 92.7 bits (196), Expect(9) = 9e-64 Identities = 42/61 (68%), Positives = 47/61 (77%) Frame = -1 / -3 Query: 1201 VSLSSTINSNVSFHSGFRLSSMTFVLTLNMGRTYRVT*GSDLPINSLFFRDIAFTTVTDS 1022 VSLSS ++ NVSFHSG RLSSMT V +LN+GR Y T GSDLPI+SLF D A TTVT S Sbjct: 4073 VSLSSAMSENVSFHSGLRLSSMTLVFSLNIGRMYSTTYGSDLPISSLFLSDSARTTVTVS 3894 Query: 1021 F 1019 F Sbjct: 3893 F 3891 Score = 60.2 bits (125), Expect(9) = 9e-64 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -1 / -3 Query: 733 S*IGSDATRASTARIMLGSPPQRKSISIMIWPGWRFWIRMP 611 +*+GS+ATR STAR +LGSPPQRKS SI+I P + IRMP Sbjct: 3104 T*MGSEATRVSTARTILGSPPQRKSTSIVICPFLKL*IRMP 2982 Score = 50.1 bits (103), Expect(9) = 9e-64 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = -1 / -2 Query: 913 SSIISESPGIAVRLPPTAFNVYCILGSGSARR 818 +SIISE PGIAVRLPPTAF++ ILG G R+ Sbjct: 3543 TSIISERPGIAVRLPPTAFSM*SILGFGCQRQ 3448 Score = 49.6 bits (102), Expect(9) = 9e-64 Identities = 20/37 (54%), Positives = 22/37 (59%) Frame = -1 / -3 Query: 448 HFTCSYCGKDIHSGKLSPQSFLRSSLPRDPRTMISAA 338 H TCSY G D HSG+ SP F SS RD + SAA Sbjct: 2417 HCTCSYSGNDTHSGRFSPHIFFTSSRSRDASALTSAA 2307 Score = 43.2 bits (88), Expect(9) = 9e-64 Identities = 23/40 (57%), Positives = 28/40 (70%) Frame = -1 / -3 Query: 829 SARRATTKAEMQGISSDS*NTTRTTVKTWRSLS*IGSDAT 710 SARRATT AEMQGISS + TTR V T R L+ + ++ T Sbjct: 3347 SARRATTTAEMQGISSHNWKTTRMMV*T*RFLNCMHTEQT 3228 Score = 38.2 bits (77), Expect(9) = 9e-64 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 / -3 Query: 613 PSIFGETFPRENLLNFKDFIP 551 PSIFG T PRE+LLNF + IP Sbjct: 2894 PSIFGGTVPRESLLNFSEDIP 2832 Score = 31.8 bits (63), Expect(9) = 9e-64 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -1 / -3 Query: 499 VAACETKGQSLLRCLFNHFT 440 V TKGQSLL CL +H T Sbjct: 2627 VCTSSTKGQSLLNCLLSHLT 2568 Score = 30.9 bits (61), Expect(9) = 9e-64 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = -3 / -2 Query: 977 AKWNNNPVWPLEHV 936 A+W+++ VWPLEHV Sbjct: 3705 AQWDDDSVWPLEHV 3664 Score = 24.0 bits (46), Expect(9) = 9e-64 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 / -3 Query: 340 ALATRFLVRRCITRLHPAXXXXXXXXXXXXPERNPI 233 ALA R RR I R PA P+ NPI Sbjct: 1793 ALALRLAARRAIARDQPAMRATPMIIPITTPDMNPI 1686 Score = 57.4 bits (119), Expect(5) = 9e-19 Identities = 26/83 (31%), Positives = 48/83 (57%) Frame = -3 / -2 Query: 1226 INLKNDRLGFLVFNNQFKCFIPFRI*VVVYDFCFDLEHGTHIQGHVGIRFTNQLLILQRY 1047 ++LK+ L LV ++ + +P + VVV D LEH +Q HV + +QLL+L+R Sbjct: 4098 MHLKDQMLRLLVLGDERERLVPLGVEVVVDDAGLLLEHWADVQHHVRVGLADQLLVLERL 3919 Query: 1046 CFYYSNRQFSLRFKLQLTCINID 978 ++ +RQ +R +L++T ++ Sbjct: 3918 RAHHGHRQLPMRLQLKVTAEELE 3850 Score = 41.4 bits (84), Expect(5) = 9e-19 Identities = 17/34 (50%), Positives = 26/34 (76%) Frame = -3 / -2 Query: 830 LCEESNNKSRDAGNLF*QLKYNTNNGKDLEILEL 729 LC++SNN SRDA QL+ +T++G +L++LEL Sbjct: 3348 LCQKSNNNSRDARYFITQLEDDTDDGVNLKVLEL 3247 Score = 29.9 bits (59), Expect(5) = 9e-19 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -3 / -2 Query: 485 NKRPKFAKMLVQPFHL 438 NKRPK A++ V+PF+L Sbjct: 2613 NKRPKLAQLFVEPFNL 2566 Score = 28.6 bits (56), Expect(5) = 9e-19 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -1 / -3 Query: 955 CGHWSMSLTIELTVS 911 CGHWSMS + TVS Sbjct: 3683 CGHWSMSAIKDATVS 3639 Score = 28.6 bits (56), Expect(5) = 9e-19 Identities = 17/37 (45%), Positives = 19/37 (51%) Frame = -2 / -1 Query: 720 VMQLEHQQQGLCLDHHPNGNLYPL*FGLAGDFGYGCL 610 V QLE Q QG D PN + PL*F L+ CL Sbjct: 3091 VKQLECQLQGQY*DPRPNESRRPL*FALS*SSESECL 2981 Score = 78.0 bits (164), Expect(4) = 5e-18 Identities = 31/50 (62%), Positives = 39/50 (78%) Frame = +3 / +1 Query: 612 GIRIQNLQPGQIIMDIDFRWGGDPSIILAVDARVASLPIQLKDLQVFTVV 761 GIRIQ+ + GQI MD+DFRWGGDP+I+LAVD VASLPIQ+ Q ++ Sbjct: 2983 GIRIQSFKKGQITMDVDFRWGGDPNIVLAVDTLVASLPIQVFKSQPLAMI 3132 Score = 32.2 bits (64), Expect(4) = 5e-18 Identities = 14/39 (35%), Positives = 25/39 (64%) Frame = +2 / +3 Query: 1049 ISEE*GVDW*I*SLRDPVCASHVQGQNKSHRRQPKS*ME 1165 +++E G D + +R V +VQG+++ HRRQP+ +E Sbjct: 3921 VAQEQGADRQVRPVRGAVHPPNVQGEDQRHRRQPQPRVE 4037 Score = 28.6 bits (56), Expect(4) = 5e-18 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 / +3 Query: 338 GCGYHGPWVSWQGRPQEALRRQFPRVDIFPTV*AGEMV 451 GC +S R +E + R+ PR+ + P V* G M+ Sbjct: 2307 GCRCQCTCISRPRRREENMWRKSPRMGVIPRV*TGAMI 2420 Score = 24.0 bits (46), Expect(4) = 5e-18 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 / +3 Query: 1607 RWSGRFWYWRRGQRP 1651 RWS R WR G RP Sbjct: 4476 RWSWRRRRWRSGGRP 4520 Score = 42.3 bits (86), Expect = 0.012 Identities = 21/51 (41%), Positives = 31/51 (60%) Frame = -3 / -2 Query: 764 TNNGKDLEILELNRQ*CNSSINSKDYAWITTPTEIYIHYDLAWLEILDTDA 612 TN+G L LN +* N S+N KD I PT++ +H +L +LE L+ +A Sbjct: 3135 TNHG*RLRFEYLNGK*SN*SVNCKDNIRIPAPTKVDVHCNLPFLEALNPNA 2983 Score = 35.9 bits (72), Expect = 0.98 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +2 / +3 Query: 725 YSAQGSPGLYRCSCCISTVRRDSLHLCFCCCSPRR 829 ++ Q GL+ C + V ++LHLC CCCS R Sbjct: 3243 HTVQEPSGLHHHPCRLPIV**NTLHLCCCCCSSGR 3347
>LOC_Os04g55220:12004.t04995:unspliced-genomic lipid binding protein, putative, expressed| Length = 4356 Score = 73.0 bits (153), Expect(6) = 1e-44 Identities = 26/67 (38%), Positives = 48/67 (71%) Frame = +3 / +2 Query: 1140 DDNLNPEWNETFELIVEDKETQSVIFEVYDEDNLQQDKRLGVAKLAVNNIVPEIPSEITL 1319 +++LNP WNE FE IVED +TQ+V ++YD+D +Q+ + +G A++ + ++ P ++ L Sbjct: 3176 NNDLNPIWNEHFEFIVEDADTQTVTVKIYDDDGIQESELIGCAQVTLKDLQPGKVKDVWL 3355 Query: 1320 KLMQSLD 1340 KL++ L+ Sbjct: 3356 KLVKDLE 3376 Score = 62.0 bits (129), Expect(6) = 1e-44 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +3 / +3 Query: 984 VDTSELELKPEGKLSVTVVKAISLKNKELIGKSDPYVTLYVRPM 1115 V S+LELKP G L V +V+A L NK+LIGKSDP+ +YVRP+ Sbjct: 2916 VCNSDLELKPVGTLEVKLVQARDLTNKDLIGKSDPFAIVYVRPL 3047 Score = 58.3 bits (121), Expect(6) = 1e-44 Identities = 23/47 (48%), Positives = 36/47 (76%) Frame = +3 / +3 Query: 483 VSQAATAVVKESVEPLLDDYRPPGIKSLKFNKFSLGNVSPKIEGIRI 623 +SQAA+ ++K SVEP+L+ YRP + SLKF+K +LG V+P+ G ++ Sbjct: 1146 LSQAASELIKTSVEPVLEQYRPIILASLKFSKLTLGTVAPQFTGKKL 1286 Score = 36.3 bits (73), Expect(6) = 1e-44 Identities = 11/26 (42%), Positives = 20/26 (76%) Frame = +3 / +2 Query: 834 EPKIQYTLKAVGGSLTAIPGLSDMID 911 + K+ + LK +GG ++AIPG+SD ++ Sbjct: 2549 QKKLDFRLKVIGGEISAIPGISDALE 2626 Score = 35.4 bits (71), Expect(6) = 1e-44 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = +3 / +2 Query: 438 QVKWLNKHLSKLWPFVS 488 Q+KWLN+ L K+WPFV+ Sbjct: 1001 QLKWLNQELIKIWPFVN 1051 Score = 30.4 bits (60), Expect(6) = 1e-44 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +3 / +2 Query: 903 MIDDTVNSIVNDMLQWPHRVVVPL 974 ++ DT+ + + D + WP R V+P+ Sbjct: 2708 VLQDTIKNAIEDSITWPVRKVIPI 2779 Score = 48.3 bits (99), Expect(2) = 8e-08 Identities = 16/39 (41%), Positives = 26/39 (66%) Frame = +3 / +1 Query: 1131 KVIDDNLNPEWNETFELIVEDKETQSVIFEVYDEDNLQQ 1247 +V+ ++LNP WN+TF+ +VED ++ EVYD D + Sbjct: 3961 QVVSESLNPVWNQTFDFVVEDGLHDMLMLEVYDHDTFSR 4077 Score = 35.9 bits (72), Expect(2) = 8e-08 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +3 / +1 Query: 1002 ELKPEGKLSVTVVKAISLKNKELIGKSDPYVTLYVR 1109 E+ G LSVTV+ L ++ GKSDPYV L ++ Sbjct: 3709 EIIMRGVLSVTVISGEDLPAMDMNGKSDPYVVLSLK 3816 Score = 39.6 bits (80), Expect(2) = 4e-06 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = -1 / -3 Query: 1111 GRTYRVT*GSDLPINSLFFRDIAFTTVTDS 1022 GRTY + GSD PI SLF + +A T++T + Sbjct: 3043 GRTYTIAKGSDFPIRSLFVKSLACTSLTSN 2954 Score = 38.6 bits (78), Expect(2) = 4e-06 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = -3 / -3 Query: 1244 LKVVFIINLKNDRLGFLVFNNQFKCFIPFRI*VVV 1140 L + IINL L +FNN+ K FIP R+ VVV Sbjct: 3280 LNTIIIINLHCHSLSICIFNNKLKVFIPDRVQVVV 3176
>LOC_Os08g20544:12008.t01870:unspliced-genomic calcium lipid binding protein-like, putative, expressed| Length = 10658 Score = 62.0 bits (129), Expect(5) = 6e-26 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = +3 / +3 Query: 993 SELELKPEGKLSVTVVKAISLKNKELIGKSDPYVTLYVRPM 1115 S+LELKP G L V +V+A L NK+L+GKSDP+ LY+RP+ Sbjct: 8346 SDLELKPVGLLEVKLVEARDLTNKDLVGKSDPFAVLYIRPL 8468 Score = 43.7 bits (89), Expect(5) = 6e-26 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = +3 / +3 Query: 1131 KVIDDNLNPEWNETFELIVEDKETQSVIFEVYDED 1235 +V+ + LNP WN+TF+ +VED ++ EV+D D Sbjct: 9396 QVVTETLNPIWNQTFDFVVEDALHDLLMVEVWDHD 9500 Score = 41.8 bits (85), Expect(5) = 6e-26 Identities = 14/24 (58%), Positives = 20/24 (83%) Frame = +3 / +1 Query: 840 KIQYTLKAVGGSLTAIPGLSDMID 911 K+ +TLK +GG +TAIPG+SD I+ Sbjct: 8032 KVDFTLKVIGGEMTAIPGISDAIE 8103 Score = 36.3 bits (73), Expect(5) = 6e-26 Identities = 11/18 (61%), Positives = 16/18 (88%) Frame = +3 / +1 Query: 438 QVKWLNKHLSKLWPFVSQ 491 Q+KWLN+ L K+WPFV++ Sbjct: 3646 QLKWLNQELVKIWPFVNE 3699 Score = 31.8 bits (63), Expect(5) = 6e-26 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 / +2 Query: 915 TVNSIVNDMLQWPHRVVVPL 974 T+ + D L WP+R+VVP+ Sbjct: 8186 TIRDTIEDQLTWPNRIVVPI 8245 Score = 66.1 bits (138), Expect = 8e-10 Identities = 30/103 (29%), Positives = 58/103 (56%) Frame = +3 / +2 Query: 1068 LIGKSDPYVTLYVRPMFKVKTKVIDDNLNPEWNETFELIVEDKETQSVIFEVYDEDNLQQ 1247 LI + + +Y V + +++LNP WNE +E +VED TQ + ++YD++ LQ Sbjct: 8516 LINSAIKHPYIYFEGNIIVFVLLQNNDLNPIWNEHYEFVVEDTSTQRLTVKIYDDEGLQA 8695 Query: 1248 DKRLGVAKLAVNNIVPEIPSEITLKLMQSLDSLKIKDYRDRGS 1376 + +G A++ ++++ P E+ L L++ L+ + K R + S Sbjct: 8696 SELIGCARVDLSDLQPGKVKEVWLDLVKDLEIQRDKKRRGQVS 8824 Score = 32.7 bits (65), Expect(3) = 0.037 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -1 / -2 Query: 1111 GRTYRVT*GSDLPINSLFFRDIAFTTVTDS 1022 GR Y GSD P SLF + +A T+ T + Sbjct: 8464 GRMYNTAKGSDFPTRSLFVKSLASTSFTSN 8375 Score = 28.6 bits (56), Expect(3) = 0.037 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 / -3 Query: 1204 WVSLSSTINSNVSFHSGFR 1148 WV +SST NS SF GF+ Sbjct: 8652 WVDVSSTTNS*CSFQMGFK 8596 Score = 26.7 bits (52), Expect(3) = 0.037 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 / -1 Query: 913 SSIISESPGIAVRLPPTAFNV 851 +SI SE PGIAV PP V Sbjct: 8105 TSIASEIPGIAVISPPITLRV 8043 Score = 39.1 bits (79), Expect = 0.11 Identities = 15/31 (48%), Positives = 23/31 (74%) Frame = +3 / +3 Query: 1017 GKLSVTVVKAISLKNKELIGKSDPYVTLYVR 1109 G LSVTV+ A L +++GK+DP+V LY++ Sbjct: 9174 GVLSVTVISAEDLPPMDVMGKADPFVVLYLK 9266 Score = 28.6 bits (56), Expect(2) = 0.12 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -1 / -2 Query: 1102 YRVT*GSDLPINSLFFRDIAFTTVTD 1025 YR T GS LPI S+ + A TVTD Sbjct: 9259 YRTTNGSALPITSIGGKSSAEITVTD 9182 Score = 27.6 bits (54), Expect(2) = 0.12 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 / -2 Query: 1192 SSTINSNVSFHSGFRLSSMTFVLTLNMGRT 1103 SST SNV FH GF +S T G+T Sbjct: 9457 SSTTKSNV*FHIGFSVSVTTCKHNHEYGKT 9368
>LOC_Os02g25060:12002.t02203:unspliced-genomic calcium lipid binding protein-like, putative, expressed| Length = 7845 Score = 52.4 bits (108), Expect(4) = 5e-15 Identities = 20/35 (57%), Positives = 26/35 (74%) Frame = +3 / +2 Query: 1125 KTKVIDDNLNPEWNETFELIVEDKETQSVIFEVYD 1229 KT V NLNPEWNE F+L+V+D E+Q++ VYD Sbjct: 5360 KTSVKRSNLNPEWNEDFKLVVKDPESQALELTVYD 5464 Score = 44.1 bits (90), Expect(4) = 5e-15 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = +3 / +2 Query: 1008 KPEGKLSVTVVKAISLKNKELIGKSDPYVTL 1100 KP G L V +V+A+ L K+ +GKSDPYV L Sbjct: 5237 KPVGILHVNIVRAVKLTKKDFLGKSDPYVKL 5329 Score = 29.5 bits (58), Expect(4) = 5e-15 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = +3 / +2 Query: 612 GIRIQNLQPGQIIMDIDFRWGGDPSIILAVDA 707 G+++ ++IM+ +W G+P+I + V A Sbjct: 4205 GMKVYTTDEQELIMEPSIKWAGNPNITVVVKA 4300 Score = 28.6 bits (56), Expect(4) = 5e-15 Identities = 6/23 (26%), Positives = 15/23 (65%) Frame = +3 / +1 Query: 432 YEQVKWLNKHLSKLWPFVSQAAT 500 + ++ WLNK + +WP++ + + Sbjct: 1603 FMKIDWLNKFVENIWPYLDKVGS 1671 Score = 33.6 bits (67), Expect = 4.8 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -3 / -3 Query: 1229 IINLKNDRLGFLVFNNQFKCFIPFRI 1152 I+N K L F VF+N F+ FIPFR+ Sbjct: 5464 IVNSKLKSLRFWVFDN*FEIFIPFRV 5387
>LOC_Os06g47130:12006.t04399:unspliced-genomic calcium lipid binding protein-like, putative, expressed| Length = 6471 Score = 46.9 bits (96), Expect(4) = 4e-14 Identities = 18/35 (51%), Positives = 23/35 (65%) Frame = +3 / +2 Query: 1125 KTKVIDDNLNPEWNETFELIVEDKETQSVIFEVYD 1229 KT + NLNPEWNE F IV+D ETQ + ++D Sbjct: 4418 KTSIKMSNLNPEWNEHFRFIVKDPETQILELRMFD 4522 Score = 41.8 bits (85), Expect(4) = 4e-14 Identities = 17/31 (54%), Positives = 23/31 (74%) Frame = +3 / +2 Query: 1008 KPEGKLSVTVVKAISLKNKELIGKSDPYVTL 1100 KP G L V V++A++L +L+GKSDPYV L Sbjct: 4295 KPVGILHVKVIRAMNLLKMDLLGKSDPYVKL 4387 Score = 34.1 bits (68), Expect(4) = 4e-14 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +3 / +3 Query: 405 FPEWISFPQYEQVKWLNKHLSKLWPFVSQAATAVV 509 F +W + QV W+NK + +WPF+ + ++++ Sbjct: 2514 FMKWRIHFMFLQVDWINKFIFDMWPFLDKVFSSLI 2618 Score = 27.6 bits (54), Expect(4) = 4e-14 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 / +3 Query: 834 EPKIQYTLKAVGGSLTAIPGL 896 +P I + K +GG + AIPGL Sbjct: 3483 KPHIDFGFKLLGGDVMAIPGL 3545 Score = 30.9 bits (61), Expect(2) = 0.74 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -1 / -1 Query: 1201 VSLSSTINSNVSFHSGFRL 1145 VS S TIN SFHSGFRL Sbjct: 4494 VSGSLTINLKCSFHSGFRL 4438 Score = 22.6 bits (43), Expect(2) = 0.74 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 / -1 Query: 1096 VT*GSDLPINSLFFRDIAFTTVT 1028 +T*GSD P S+ R +A T T Sbjct: 4383 LT*GSDFPSKSILRRFMARITFT 4315
>LOC_Os01g60340:12001.t05415:unspliced-genomic C2 domain containing protein| Length = 4653 Score = 48.3 bits (99), Expect(4) = 6e-13 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = +3 / +3 Query: 1125 KTKVIDDNLNPEWNETFELIVEDKETQSVIFEVYD 1229 KT V NLNPEWN+ F+ ++ D ETQ + V+D Sbjct: 3132 KTAVKHSNLNPEWNQEFKFVIRDPETQELDINVFD 3236 Score = 35.9 bits (72), Expect(4) = 6e-13 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = +3 / +3 Query: 1008 KPEGKLSVTVVKAISLKNKELIGKSDPYVTL 1100 KP G L V V++A +L+ K +GK DPYV L Sbjct: 3009 KPVGILLVKVLRAQNLREKGPLGKRDPYVKL 3101 Score = 35.0 bits (70), Expect(4) = 6e-13 Identities = 15/66 (22%), Positives = 32/66 (48%) Frame = +3 / +2 Query: 612 GIRIQNLQPGQIIMDIDFRWGGDPSIILAVDARVASLPIQLKDLQVFTVVRVVFQLSEEI 791 G+++Q +++M+ +W G+P+ + V A IQ+ + + + FQ SE Sbjct: 2234 GVKVQVTNEQELVMEPSLKWAGNPNTTVVVKAYGLKATIQVLNFSGHVLKKYRFQPSETF 2413 Query: 792 PCISAF 809 ++ F Sbjct: 2414 IFLTRF 2431 Score = 25.8 bits (50), Expect(4) = 6e-13 Identities = 6/15 (40%), Positives = 12/15 (80%) Frame = +3 / +3 Query: 447 WLNKHLSKLWPFVSQ 491 WLN+ L +WP++++ Sbjct: 744 WLNRFLELMWPYLNK 788
>LOC_Os09g36770:12009.t03153:unspliced-genomic calcium lipid binding protein-like, putative, expressed| Length = 9639 Score = 49.6 bits (102), Expect(2) = 3e-12 Identities = 19/35 (54%), Positives = 24/35 (68%) Frame = +3 / +2 Query: 1125 KTKVIDDNLNPEWNETFELIVEDKETQSVIFEVYD 1229 KT V NLNPEWNE F+ +V D ETQ++ V+D Sbjct: 8270 KTTVKRSNLNPEWNEDFKFVVTDPETQALEINVFD 8374 Score = 43.2 bits (88), Expect(2) = 3e-12 Identities = 18/31 (58%), Positives = 24/31 (77%) Frame = +3 / +2 Query: 1008 KPEGKLSVTVVKAISLKNKELIGKSDPYVTL 1100 KP G L V V++A +L+ K+L+GKSDPYV L Sbjct: 8147 KPVGILLVKVLRAQNLRKKDLLGKSDPYVKL 8239
>LOC_Os06g41740:12006.t03866:unspliced-genomic expressed protein| Length = 966 Score = 34.5 bits (69), Expect(3) = 2e-07 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 / +3 Query: 1598 WCWRWSGRFWYWRRGQRPW*SWE 1666 W WRW R W WRR +R W+ Sbjct: 375 WRWRWWRRRWRWRRWRRRRWGWK 443 Score = 33.1 bits (66), Expect(3) = 2e-07 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 / +3 Query: 1460 EKAAEGGWGNWQHDGCTWWRRFTSWFRCWICGHWRCR 1570 E A GG W+ WWR W+R W WR R Sbjct: 216 ELAGMGGMERWRWRRRWWWRGRWWWWRRWRWWWWRRR 326 Score = 25.4 bits (49), Expect(3) = 2e-07 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +2 / +3 Query: 1577 WARGLRAWCWRWSG 1618 W R R W W W G Sbjct: 315 WRRRRRRWWWWWGG 356 Score = 35.0 bits (70), Expect = 1.9 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 / +3 Query: 1559 WRCRGCWARGLRAWCWRWSGRFWYW 1633 WR R W R R W WR R W+W Sbjct: 270 WRGRWWWWRRWRWWWWRRRRRRWWW 344 Score = 34.1 bits (68), Expect = 3.5 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 / +3 Query: 1598 WCWRWSGRFWYWRRGQRPW*SW 1663 W W R+W+WRR +R W W Sbjct: 282 WWWWRRWRWWWWRRRRRRWWWW 347 Score = 33.6 bits (67), Expect = 4.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 / +3 Query: 1604 WRWSGRFWYWRRGQRPW 1654 W W GR+W+WRR + W Sbjct: 264 WWWRGRWWWWRRWRWWW 314 Score = 25.8 bits (50), Expect(3) = 6.9 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 / +3 Query: 1511 WWRRFTSWFRCWICGHWRCRGCWARGLRAWCWR 1609 W RR W+ W R R W R W WR Sbjct: 315 WRRRRRRWWWWWGGWTRRGRWRWRWWRRRWRWR 413 Score = 24.4 bits (47), Expect(3) = 6.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 / +3 Query: 1598 WCWRWSGRFWYWRRGQR 1648 W WRW R + RR +R Sbjct: 735 WWWRWQRRCKWRRRRRR 785 Score = 22.6 bits (43), Expect(3) = 6.9 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = +2 / +3 Query: 1475 GGWGNWQHDGCTWWRR 1522 G W W+ WWRR Sbjct: 276 GRWWWWRRWRWWWWRR 323 Score = 32.7 bits (65), Expect = 9.1 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 / +3 Query: 1559 WRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW*SW 1663 WR R W R W WR +W+ RR +R W W Sbjct: 246 WRWRRRWWWRGRWWWWRRWRWWWWRRRRRRWWWWW 350
>LOC_Os07g32680:12007.t02950:unspliced-genomic fibroin heavy chain precursor, putative, expressed| Length = 1424 Score = 30.9 bits (61), Expect(3) = 7e-06 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 / +1 Query: 1598 WCWRWSGRFWYWRRGQR 1648 W W W +W+WRR R Sbjct: 559 WSWWWRRLWWWWRRWPR 609 Score = 29.5 bits (58), Expect(3) = 7e-06 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +2 / +1 Query: 1481 WGNWQHDGCTWWRRFTSWFR 1540 W W G WWRR +W+R Sbjct: 334 WRCWGWRGFWWWRRRWAWWR 393 Score = 27.2 bits (53), Expect(3) = 7e-06 Identities = 10/27 (37%), Positives = 10/27 (37%) Frame = +2 / +1 Query: 1532 WFRCWICGHWRCRGCWARGLRAWCWRW 1612 W W R R W WCWRW Sbjct: 457 WRWLWRRRWRRIRRWWWPWWWVWCWRW 537 Score = 51.5 bits (106), Expect = 2e-05 Identities = 19/58 (32%), Positives = 25/58 (43%) Frame = +2 / +1 Query: 1490 WQHDGCTWWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW*SW 1663 W+ C WW R+ W+ W+ R R W WCWR S + +WR W W Sbjct: 631 WRWCWCRWWSRWWRWWGWWVWRWRRQRAWWWPRRWVWCWRRSWWWHWWRWRLWRWWWW 804 Score = 30.4 bits (60), Expect(3) = 0.003 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 / +1 Query: 1514 WRRFTSWFRCWICGHWRCRGCWARGLRAWCWRW 1612 W R W CW WRCR R W W Sbjct: 823 WWRLWWWSWCWQWCRWRCRWWRRIWWRRWGGPW 921 Score = 29.5 bits (58), Expect(3) = 0.003 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 / +1 Query: 1601 CWRWSGRFWYWRRGQRPW 1654 CW W +W+WRR W Sbjct: 982 CWWWRRIWWWWRRRPWWW 1035 Score = 26.7 bits (52), Expect(3) = 0.003 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = +2 / +1 Query: 1475 GGWGNWQHDGCTWWRRFTSW 1534 G W W WWRR+ W Sbjct: 553 GWWSWWWRRLWWWWRRWPRW 612 Score = 32.7 bits (65), Expect(2) = 0.016 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +2 / +1 Query: 1568 RGCWARGLRAWCWRWSGRFWYWRRGQRPW 1654 R CW R W W W WRR + W Sbjct: 634 RWCWCRWWSRWWRWWGWWVWRWRRQRAWW 720 Score = 26.7 bits (52), Expect(2) = 0.016 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 / +1 Query: 1511 WWRRFTSWFRCW 1546 WWRR W+R W Sbjct: 568 WWRRLWWWWRRW 603 Score = 33.1 bits (66), Expect(2) = 0.034 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +2 / +1 Query: 1475 GGWGNWQHDGCTWWRRFTSWFRCWICGHWRCRGCWARGLRAWCWR 1609 G W W WR +W+R W R R W R W WR Sbjct: 220 GWWVRWWWRWRARWRWRWTWWRTWWWVRRRWRFRWRC*WRCWGWR 354 Score = 29.9 bits (59), Expect(2) = 0.034 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 / +1 Query: 1598 WCWRWSGRFWYWRRGQRPW 1654 W W W R+ WRRG W Sbjct: 511 WWWVWCWRWCRWRRGWWSW 567 Score = 26.3 bits (51), Expect(3) = 0.044 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 / +1 Query: 1598 WCWRWSGRFWYWRRGQRPW*SW 1663 W RW R W+ R G W +W Sbjct: 868 WRCRWWRRIWWRRWGGPWWWTW 933 Score = 24.0 bits (46), Expect(3) = 0.044 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +2 / +1 Query: 1511 WWRRFTSWFRCWICGHWRCR 1570 W R ++ W+R W WR R Sbjct: 643 WCRWWSRWWRWWGWWVWRWR 702 Score = 23.5 bits (45), Expect(3) = 0.044 Identities = 5/12 (41%), Positives = 7/12 (58%) Frame = +2 / +1 Query: 1577 WARGLRAWCWRW 1612 W +WCW+W Sbjct: 826 WRLWWWSWCWQW 861 Score = 33.6 bits (67), Expect(2) = 0.055 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = +2 / +1 Query: 1490 WQHDGCTWWRRFTSWFRCWICGHWRCRGCWARGLRAWCW 1606 W+ C W R+ W+ I WR R W R W W Sbjct: 943 WRRCWCWWRCRWRCWWWRRIWWWWRRRPWWWSRRRVWSW 1059 Score = 24.0 bits (46), Expect(2) = 0.055 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +2 / +1 Query: 1604 WRWSGRFWYWRRGQRPW 1654 WR R W+W R R W Sbjct: 1072 WRCWWRCWWWWRLWRRW 1122 Score = 40.0 bits (81), Expect = 0.056 Identities = 17/51 (33%), Positives = 20/51 (39%) Frame = +2 / +1 Query: 1511 WWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW*SW 1663 W RR+ R W W W R R W W R W+W R W +W Sbjct: 469 WRRRWRRIRRWWWPWWWVWCWRWCRWRRGWWSWWWRRLWWWWRRWPRWRAW 621 Score = 33.1 bits (66), Expect(2) = 0.25 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 / +1 Query: 1559 WRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW*SW 1663 W R W R R W W W W R +R W SW Sbjct: 463 WLWRRRWRRIRRWWWPWWWVWCWRWCRWRRGWWSW 567 Score = 22.1 bits (42), Expect(2) = 0.25 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +2 / +1 Query: 1505 CTWWRRFTSWFRCWICGHWRCR 1570 C WR F W R W R R Sbjct: 340 CWGWRGFWWWRRRWAWWRTRWR 405 Score = 32.2 bits (64), Expect(2) = 0.45 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = +2 / +1 Query: 1514 WRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW 1654 WRR W+RC W R W R W W + + RR R W Sbjct: 943 WRRCWCWWRCRWRCWWWRRIWWWWRRRPWWWSRRRVWSWCRRRWRCW 1083 Score = 22.1 bits (42), Expect(2) = 0.45 Identities = 6/11 (54%), Positives = 6/11 (54%) Frame = +2 / +1 Query: 1490 WQHDGCTWWRR 1522 W C WWRR Sbjct: 859 WCRWRCRWWRR 891 Score = 36.8 bits (74), Expect = 0.52 Identities = 17/58 (29%), Positives = 21/58 (36%) Frame = +2 / +1 Query: 1481 WGNWQHDGCTWWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW 1654 W W C W R + SW+ + WR W R W W W + W R W Sbjct: 514 WWVWCWRWCRWRRGWWSWWWRRLWWWWRRWPRWRAWRRLWRWCWCRWWSRWWRWWGWW 687 Score = 29.9 bits (59), Expect(2) = 0.81 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 / +1 Query: 1502 GCTWWRRFTSWFRCWICGHWRCRGCWARGLRAW 1600 G WW W RCW R R W R + W Sbjct: 913 GPWWWTW*RIWRRCWCWWRCRWRCWWWRRIWWW 1011 Score = 23.5 bits (45), Expect(2) = 0.81 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +2 / +1 Query: 1604 WRWSGRFWYWRR 1639 W W R W+W R Sbjct: 1006 WWWRRRPWWWSR 1041 Score = 34.5 bits (69), Expect = 2.6 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +2 / +1 Query: 1514 WRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYW 1633 W R+ +W R W R W R W WRW + +W Sbjct: 601 WPRWRAWRRLWRWCWCRWWSRWWRWWGWWVWRWRRQRAWW 720 Score = 31.3 bits (62), Expect(2) = 3.0 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = +2 / +1 Query: 1532 WFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWR 1636 W+R + W R W R W W W ++ WR Sbjct: 769 WWRWRLWRWWWWRPRWWTWWRLWWWSWCWQWCRWR 873 Score = 24.9 bits (48), Expect(2) = 3.0 Identities = 8/23 (34%), Positives = 10/23 (43%) Frame = +2 / +1 Query: 1478 GWGNWQHDGCTWWRRFTSWFRCW 1546 GW +W WW R +R W Sbjct: 553 GWWSWWWRRLWWWWRRWPRWRAW 621
>LOC_Os07g32710:12007.t02953:unspliced-genomic expressed protein| Length = 1402 Score = 33.6 bits (67), Expect(3) = 7e-06 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 / +3 Query: 1532 WFRCWICGHWRCRGCWARGLRAWCWR 1609 W R W W CR G RAW WR Sbjct: 432 WSRRWFWSRWWCRRWKWYGRRAWRWR 509 Score = 31.3 bits (62), Expect(3) = 7e-06 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 / +3 Query: 1598 WCWRWSGR 1621 WCWRWSGR Sbjct: 588 WCWRWSGR 611 Score = 22.6 bits (43), Expect(3) = 7e-06 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +2 / +3 Query: 1607 RWSGRFWYWRRGQRPW*SWEV 1669 R +GR W WR +R W V Sbjct: 615 RRNGRRWRWRVWRRRGQRWRV 677 Score = 32.7 bits (65), Expect(2) = 0.10 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 / +3 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLR 1594 RR+ W+R W W R CW+R R Sbjct: 762 RRWNGWWRRWRFRWWSWRRCWSRRQR 839 Score = 24.0 bits (46), Expect(2) = 0.10 Identities = 7/17 (41%), Positives = 8/17 (47%) Frame = +2 / +3 Query: 1604 WRWSGRFWYWRRGQRPW 1654 W W W R +RPW Sbjct: 924 WPWRWTRWRTRARRRPW 974 Score = 29.9 bits (59), Expect(2) = 1.2 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 / +3 Query: 1544 WICGHWRCRGCWARGLRAWCW 1606 W WR RG W R R W W Sbjct: 390 WPWRRWRRRGWWWRWSRRWFW 452 Score = 27.6 bits (54), Expect(2) = 1.2 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = +2 / +3 Query: 1583 RGLRAWCWRWSGRFWYWRRGQRPW*SW 1663 R R+W W W W RR W W Sbjct: 711 RRRRSWWWWWRRHGWRRRRWNGWWRRW 791 Score = 34.1 bits (68), Expect(2) = 2.2 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 / +3 Query: 1559 WRCRGCWARGLRAWCWRWSGRFWYWRR 1639 WR G R W RW R+W WRR Sbjct: 738 WRRHGWRRRRWNGWWRRWRFRWWSWRR 818 Score = 22.6 bits (43), Expect(2) = 2.2 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = +2 / +3 Query: 1517 RRFTSWFRCWICGHWRCRGCWAR 1585 RR W+ W WR R W R Sbjct: 219 RRRRRWWAWWRWRVWRRRWRWRR 287 Score = 29.0 bits (57), Expect(2) = 3.6 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 / +3 Query: 1583 RGLRAWCWRWSGR 1621 R RAW WRW GR Sbjct: 531 RWWRAWWWRWQGR 569 Score = 22.1 bits (42), Expect(2) = 3.6 Identities = 8/25 (32%), Positives = 10/25 (40%) Frame = +2 / +3 Query: 1511 WWRRFTSWFRCWICGHWRCRGCWAR 1585 WW + W R W R W+R Sbjct: 384 WWWPWRRWRRRGWWWRWSRRWFWSR 458 Score = 33.6 bits (67), Expect = 4.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 / +3 Query: 1505 CTWWRRFTSWFRCWICGHWRCRGCWARGLRAWC 1603 C WR F W RCW WR RG R C Sbjct: 1002 CRRWRWFWWWCRCWWWRGWRRTLRHRRGARTVC 1100
>LOC_Os07g25810:12007.t02277:unspliced-genomic expressed protein| Length = 1681 Score = 31.8 bits (63), Expect(3) = 3e-05 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 / +3 Query: 1592 RAWCWRWSGRFWYWRRGQRPW*SW 1663 R+W W G + +WR QR W W Sbjct: 822 RSWWRHWEGWWSWWRHWQRRWTWW 893 Score = 29.5 bits (58), Expect(3) = 3e-05 Identities = 9/28 (32%), Positives = 11/28 (39%) Frame = +2 / +3 Query: 1481 WGNWQHDGCTWWRRFTSWFRCWICGHWR 1564 W +W WW W + W G WR Sbjct: 627 WRSWWRHW*GWWTWRRFWKKWWTWGWWR 710 Score = 24.0 bits (46), Expect(3) = 3e-05 Identities = 7/18 (38%), Positives = 7/18 (38%) Frame = +2 / +3 Query: 1559 WRCRGCWARGLRAWCWRW 1612 W G W R W W W Sbjct: 687 WWTWGWWRTWWRRWSWWW 740 Score = 35.4 bits (71), Expect(2) = 0.001 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 / +3 Query: 1592 RAWCWRWSGRFWYWRRGQRPW*SW 1663 R WCWRW + W++R W W Sbjct: 540 RTWCWRWIWQRWWFRWWHWSWHWW 611 Score = 28.1 bits (55), Expect(2) = 0.001 Identities = 11/34 (32%), Positives = 13/34 (38%) Frame = +2 / +3 Query: 1511 WWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRW 1612 WW + W+R W R W R WRW Sbjct: 357 WWVWWRRWWRARWWRRWWLRRRWWVWQRRRGWRW 458 Score = 30.4 bits (60), Expect(2) = 0.099 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 / +3 Query: 1595 AWCWRWSGRFWYWRRGQRPW 1654 +W W W GR+ +W +R W Sbjct: 729 SWWWHWEGRWTWWWFRKRWW 788 Score = 26.3 bits (51), Expect(2) = 0.099 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +2 / +3 Query: 1481 WGNWQHDGCTWWRRFTSWFRCW 1546 W +W W R+ SW+R W Sbjct: 585 WWHWSWHWWWLW*RWRSWWRHW 650 Score = 28.6 bits (56), Expect(2) = 0.13 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 / +3 Query: 1511 WWRRFTSWFRCWICGHWR 1564 +W+R+ SW W G WR Sbjct: 999 FWKRWRSWGWWWTWGRWR 1052 Score = 27.6 bits (54), Expect(2) = 0.13 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 / +3 Query: 1592 RAWCWRWSGRFWYWRRGQRPW 1654 R+W W W G + +W +R W Sbjct: 1128 RSWWWLWQGWWNWWWFRERWW 1190 Score = 31.3 bits (62), Expect(2) = 0.33 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 / +3 Query: 1508 TWWRRFTSWFRCW 1546 TWWRR+ W+R W Sbjct: 1209 TWWRRWWRWWRIW 1247 Score = 23.5 bits (45), Expect(2) = 0.33 Identities = 6/13 (46%), Positives = 7/13 (53%) Frame = +2 / +3 Query: 1592 RAWCWRWSGRFWY 1630 R W WRW W+ Sbjct: 1257 RQWDWRWFWEGWW 1295 Score = 29.9 bits (59), Expect(2) = 0.59 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 / +3 Query: 1562 RCRGCWARGLRAWCWRWSGRFWYWRRGQRPW*SW 1663 R R W R R W W R W WR W W Sbjct: 1200 RWRTWWRRWWRWWRIWWRWRQWDWRWFWEGWWIW 1301 Score = 29.0 bits (57), Expect(2) = 0.59 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 / +3 Query: 1511 WWRRFTSWFRCWICGHWR 1564 WWRR W R W WR Sbjct: 321 WWRRRRRWLRRWWWVWWR 374 Score = 29.0 bits (57), Expect(2) = 0.60 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +2 / +3 Query: 1598 WCWRWSGRFWYWRRGQRPW*SW 1663 W W W + WR R W* W Sbjct: 594 WSWHWWWLW*RWRSWWRHW*GW 659 Score = 24.9 bits (48), Expect(2) = 0.60 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +2 / +3 Query: 1511 WWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRW 1612 WWRR+ R W+ R + +G R W W Sbjct: 393 WWRRWWLRRRWWVWQRRRGWRWFRQGRRFW*RWW 494 Score = 26.7 bits (52), Expect(2) = 1.1 Identities = 7/22 (31%), Positives = 11/22 (50%) Frame = +2 / +3 Query: 1598 WCWRWSGRFWYWRRGQRPW*SW 1663 W W+ +W++R PW W Sbjct: 1140 WLWQGWWNWWWFRERWWPWGRW 1205 Score = 26.3 bits (51), Expect(2) = 1.1 Identities = 10/30 (33%), Positives = 11/30 (36%) Frame = +2 / +3 Query: 1511 WWRRFTSWFRCWICGHWRCRGCWARGLRAW 1600 WW + W R G W G W R W Sbjct: 981 WWNWWWFWKRWRSWGWWWTWGRWRSWWRQW 1070 Score = 26.7 bits (52), Expect(2) = 1.5 Identities = 12/44 (27%), Positives = 12/44 (27%) Frame = +2 / +3 Query: 1481 WGNWQHDGCTWWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRW 1612 W W WW W W W G W R W W Sbjct: 1107 WQLW*RRRSWWWLWQGWWNWWWFRERWWPWGRWRTWWRRWWRWW 1238 Score = 25.8 bits (50), Expect(2) = 1.5 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +2 / +3 Query: 1604 WRWSGRFWYWRRGQRPW 1654 WRW +W WR+ W Sbjct: 1227 WRWWRIWWRWRQWDWRW 1277 Score = 26.3 bits (51), Expect(2) = 2.0 Identities = 9/28 (32%), Positives = 11/28 (39%) Frame = +2 / +3 Query: 1478 GWGNWQHDGCTWWRRFTSWFRCWICGHW 1561 GW +W W + W R W G W Sbjct: 846 GWWSWWRHWQRRWTWWWFW*RWWSWGWW 929 Score = 25.8 bits (50), Expect(2) = 2.0 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +2 / +3 Query: 1598 WCWRWSGRFWYWRRGQRPW*SW 1663 W W GR+ WR Q W W Sbjct: 930 WTWWGRGRWSRWRHWQGWWNWW 995 Score = 31.3 bits (62), Expect(2) = 2.6 Identities = 13/52 (25%), Positives = 14/52 (26%) Frame = +2 / +3 Query: 1475 GGWGNWQHDGCTWWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWY 1630 G W W WW W W W G W R W W+ Sbjct: 699 GWWRTWWRRWSWWWHWEGRWTWWWFRKRWWSWGRWRTWWRRRSWWRHWEGWW 854 Score = 25.4 bits (49), Expect(2) = 2.6 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +2 / +3 Query: 1604 WRWSGRFWYWRRGQRPW*SW 1663 WR G +W W R + W W Sbjct: 1011 WRSWGWWWTWGRWRSWWRQW 1070 Score = 26.7 bits (52), Expect(2) = 4.8 Identities = 11/41 (26%), Positives = 13/41 (31%) Frame = +2 / +3 Query: 1532 WFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW 1654 W W WR W W W W + W+ R W Sbjct: 690 WTWGWWRTWWRRWSWWWHWEGRWTWWWFRKRWWSWGRWRTW 812 Score = 24.0 bits (46), Expect(2) = 4.8 Identities = 7/22 (31%), Positives = 8/22 (36%) Frame = +2 / +3 Query: 1481 WGNWQHDGCTWWRRFTSWFRCW 1546 W W H WW + W W Sbjct: 576 WFRWWHWSWHWWWLW*RWRSWW 641
>LOC_Os10g31380:12010.t02464:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative| Length = 655 Score = 38.2 bits (77), Expect(3) = 6e-05 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 / +1 Query: 1562 RCRGCWARGLRAWCWRWSGRFWY 1630 RCR W R + WCWRW W+ Sbjct: 448 RCRWRWRRRVWLWCWRWIWSSWW 516 Score = 23.5 bits (45), Expect(3) = 6e-05 Identities = 6/12 (50%), Positives = 6/12 (50%) Frame = +2 / +1 Query: 1511 WWRRFTSWFRCW 1546 WW R W CW Sbjct: 349 WWWRRWVWLWCW 384 Score = 22.6 bits (43), Expect(3) = 6e-05 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = +2 / +1 Query: 1475 GGWGNWQHDGCTWWR 1519 GG G W WWR Sbjct: 202 GGGGRWWRWRWRWWR 246 Score = 30.9 bits (61), Expect(2) = 0.078 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +2 / +1 Query: 1550 CGHWRCRGCWARGLRAWCWRWSGRFWY 1630 C W R W R + WCWR W+ Sbjct: 328 CEWWWRRWWWRRWVWLWCWRGIWSSWW 408 Score = 26.3 bits (51), Expect(2) = 0.078 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +2 / +1 Query: 1457 GEKAAEGGWGNWQHDGCTWWRRFTSWFRCWICGHW 1561 G A GG G G WWR W+R + W Sbjct: 163 GPYYAGGGGGGGGGGGGRWWRWRWRWWRWLLWTIW 267 Score = 25.8 bits (50), Expect(2) = 2.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 / +3 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGR 1621 RR W W W R A CWRW GR Sbjct: 90 RRRRRWRWWWGRWWWPNRRICALLWTLLCWRWWGR 194 Score = 25.8 bits (50), Expect(2) = 2.8 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +2 / +1 Query: 1604 WRWSGRFWYW 1633 WRW R+W W Sbjct: 220 WRWRWRWWRW 249 Score = 25.4 bits (49), Expect(2) = 9.2 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = +2 / +1 Query: 1604 WRWSGRFWYW 1633 WRW R W W Sbjct: 457 WRWRRRVWLW 486 Score = 24.4 bits (47), Expect(2) = 9.2 Identities = 9/32 (28%), Positives = 11/32 (34%) Frame = +2 / +1 Query: 1505 CTWWRRFTSWFRCWICGHWRCRGCWARGLRAW 1600 C W W+R W W CW +W Sbjct: 310 C*WRSSCEWWWRRWWWRRWVWLWCWRGIWSSW 405
>LOC_Os03g19600:12003.t01725:unspliced-genomic PE_PGRS family protein, putative, expressed| Length = 2044 Score = 39.6 bits (80), Expect(2) = 7e-05 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 / +3 Query: 1544 WICGHWRCRGCWARGLRAWCWRWSGRFWYW 1633 W C W CW R W RW R W+W Sbjct: 561 WWCRRWAW*WCWRRRWTWWWCRWRWRTWWW 650 Score = 28.1 bits (55), Expect(2) = 7e-05 Identities = 10/30 (33%), Positives = 11/30 (36%) Frame = +2 / +3 Query: 1481 WGNWQHDGCTWWRRFTSWFRCWICGHWRCR 1570 W W WR W+ CW W CR Sbjct: 483 WRTWWWCWRRTWRWSRWWWWCWRRPRWWCR 572 Score = 41.8 bits (85), Expect(2) = 1e-04 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = +2 / +3 Query: 1511 WWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWR 1636 WW R+ W R W R R W R W WR +W WR Sbjct: 1233 WWTRWWCWRRWWTRRWCRRRPWWWCRSRWWVWRRCRCWWRWR 1358 Score = 30.4 bits (60), Expect(2) = 1e-04 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +2 / +3 Query: 1481 WGNWQHDGCTWWRRFTSW 1534 W +W+ C WW R+ +W Sbjct: 153 WWSWRRWWCRWWFRWRAW 206 Score = 31.3 bits (62), Expect(2) = 0.003 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 / +3 Query: 1508 TWWRRFTSWFRCWICGHWRCRGCW 1579 TWW R W W C W G W Sbjct: 1359 TWWWRRRRWRTRWWCWRWCRSGWW 1430 Score = 30.9 bits (61), Expect(2) = 0.003 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 / +3 Query: 1604 WRWSGRFWYWRRGQRPW 1654 WRW R W WRR + W Sbjct: 1461 WRWRTRRWCWRRWRTWW 1511 Score = 32.2 bits (64), Expect(2) = 0.022 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 / +3 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWR 1609 RR W R WRC W R WCWR Sbjct: 1167 RRSWWWCRSRGRARWRCWYRWRWWTRWWCWR 1259 Score = 26.7 bits (52), Expect(2) = 0.022 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 / +3 Query: 1607 RWSGRFWYWRRGQRPW*SW 1663 RW R+W WR + W W Sbjct: 1380 RWRTRWWCWRWCRSGWWVW 1436 Score = 36.8 bits (74), Expect(2) = 0.026 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = +2 / +3 Query: 1532 WFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW 1654 W CW WR R R R W WR +W+ R + W Sbjct: 1440 WCWCWYRWRWRTRRWCWRRWRTWWWRRRRPWWWCRSRRWLW 1562 Score = 27.2 bits (53), Expect(2) = 0.026 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +2 / +3 Query: 1490 WQHDGCTWWRRFTSWFRCW 1546 W+ WW R +W+ CW Sbjct: 666 WRWSRWWWWCRRWAWWWCW 722 Score = 40.9 bits (83), Expect = 0.030 Identities = 18/61 (29%), Positives = 20/61 (32%) Frame = +2 / +3 Query: 1481 WGNWQHDGCTWWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW*S 1660 W W+ C W R W R W C G W W W W WR + W Sbjct: 1317 WWVWRRCRCWWRWRTWWWRRRRWRTRWWCWRWCRSGWWVWWWCWCWYRWRWRTRRWCWRR 1496 Query: 1661 W 1663 W Sbjct: 1497 W 1499 Score = 33.6 bits (67), Expect(2) = 0.040 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 / +3 Query: 1544 WICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW*SW 1663 W C R W R W RW R W RG+ W W Sbjct: 711 WWCWRRRWTWWWCRRRPWWGCRWRWRA*RWCRGRTRWWCW 830 Score = 24.4 bits (47), Expect(2) = 0.040 Identities = 8/22 (36%), Positives = 9/22 (40%) Frame = +2 / +3 Query: 1481 WGNWQHDGCTWWRRFTSWFRCW 1546 W W WW R +W CW Sbjct: 531 WWWWCWRRPRWWCRRWAW*WCW 596 Score = 29.5 bits (58), Expect(2) = 0.098 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = +2 / +3 Query: 1508 TWWRRFTSWFRCWICGHWRCRGCWAR 1585 +WWRR+ W+ W W W R Sbjct: 273 SWWRRWRRWWFRWRAWSWWWPWRWVR 350 Score = 27.2 bits (53), Expect(2) = 0.098 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +2 / +3 Query: 1604 WRWSGRFWYWRRGQR 1648 WRW +W WRR R Sbjct: 477 WRWRTWWWCWRRTWR 521 Score = 28.1 bits (55), Expect(2) = 1.1 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +2 / +3 Query: 1592 RAWCWRWSGRFWY 1630 R WCWRW W+ Sbjct: 1392 RWWCWRWCRSGWW 1430 Score = 26.7 bits (52), Expect(2) = 1.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 / +3 Query: 1604 WRWSGRFWYWRRGQRPW 1654 WRW R+W+ RR W Sbjct: 837 WRWWTRWWHRRRWWTRW 887 Score = 26.3 bits (51), Expect(2) = 1.1 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 / +3 Query: 1514 WRRFTSWFRCWICGHWRCRGCW 1579 WRR +W+ C W CR W Sbjct: 720 WRRRWTWWWCRRRPWWGCRWRW 785 Score = 24.9 bits (48), Expect(2) = 1.1 Identities = 10/30 (33%), Positives = 11/30 (36%) Frame = +2 / +3 Query: 1514 WRRFTSWFRCWICGHWRCRGCWARGLRAWC 1603 W R+ W R W W R R WC Sbjct: 1218 WYRWRWWTRWWCWRRWWTRRWCRRRPWWWC 1307 Score = 31.3 bits (62), Expect(2) = 1.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +2 / +3 Query: 1595 AWCWRWSGRFWYWRRGQRPW 1654 AW W W R+ +W +RPW Sbjct: 705 AWWWCWRRRWTWWWCRRRPW 764 Score = 29.5 bits (58), Expect(2) = 1.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 / +3 Query: 1604 WRWSGRFWYWRR 1639 WRW R+W WRR Sbjct: 1227 WRWWTRWWCWRR 1262 Score = 28.1 bits (55), Expect(2) = 1.7 Identities = 11/31 (35%), Positives = 11/31 (35%) Frame = +2 / +3 Query: 1511 WWRRFTSWFRCWICGHWRCRGCWARGLRAWC 1603 WW R W R W W R R WC Sbjct: 855 WWHRRRWWTRWWHRRRWWTRWWCRRRSWWWC 947 Score = 26.3 bits (51), Expect(2) = 1.7 Identities = 11/34 (32%), Positives = 13/34 (38%) Frame = +2 / +3 Query: 1499 DGCTWWRRFTSWFRCWICGHWRCRGCWARGLRAW 1600 +G WRR W+R W R W R W Sbjct: 96 EGDVGWRRRLRWWRWLWWWWWSWRRWWCRWWFRW 197 Score = 28.6 bits (56), Expect(2) = 3.5 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = +2 / +3 Query: 1535 FRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWR 1636 +RCW W R R R W W +W+ R Sbjct: 969 WRCWCRWRWWTRWWRRRRWRTRRWCWRRSWWWCR 1070 Score = 22.6 bits (43), Expect(2) = 3.5 Identities = 6/12 (50%), Positives = 6/12 (50%) Frame = +2 / +3 Query: 1511 WWRRFTSWFRCW 1546 WW R W R W Sbjct: 885 WWHRRRWWTRWW 920 Score = 34.1 bits (68), Expect = 3.5 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = +2 / +3 Query: 1514 WRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYW 1633 WR ++ W+ W R W R W RW R W W Sbjct: 309 WRAWSWWWPWRWVRWWEGRWSWRRRRSWWWSRWRWRAW*W 428 Score = 26.7 bits (52), Expect(2) = 4.7 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +2 / +3 Query: 1592 RAWCWRWSGRFWYWRRGQRPW 1654 R+W W W G W RR + W Sbjct: 216 RSWRWVWRG*RWRPRRRRWSW 278 Score = 24.0 bits (46), Expect(2) = 4.7 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = +2 / +3 Query: 1514 WRRFTSWFRCWICGHWRCRGCWARGLRAWCWR 1609 W + SW R W +R R R W WR Sbjct: 144 WWWWWSWRRWWCRWWFRWRAWSWRRSWRWVWR 239 Score = 33.1 bits (66), Expect = 6.6 Identities = 13/46 (28%), Positives = 18/46 (39%) Frame = +2 / +3 Query: 1514 WRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRP 1651 W + + +R W W CR W W W W+W +RP Sbjct: 420 W*WWWARWRSWWWPRWWCRWRWRTWWWCWRRTWRWSRWWWWCWRRP 557 Score = 27.6 bits (54), Expect(2) = 8.5 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 / +3 Query: 1598 WCWRWSGRFWYWRRGQRPW 1654 WCWR +W+ R R W Sbjct: 588 WCWRRRWTWWWCRWRWRTW 644 Score = 22.1 bits (42), Expect(2) = 8.5 Identities = 5/9 (55%), Positives = 7/9 (77%) Frame = +2 / +3 Query: 1511 WWRRFTSWF 1537 WW R+ SW+ Sbjct: 429 WWARWRSWW 455
>LOC_Os07g32700:12007.t02952:unspliced-genomic conserved hypothetical protein| Length = 891 Score = 34.5 bits (69), Expect(2) = 2e-04 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 / +3 Query: 1598 WCWRWSGRFWYWRR 1639 WCWRW +W+W R Sbjct: 687 WCWRWRRPWWWWWR 728 Score = 31.3 bits (62), Expect(2) = 2e-04 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 / +3 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRW 1612 RR W R W WR R W R W W Sbjct: 474 RRAWRWRRWWFWRRWRWRDWWWRWQGRRVWSW 569 Score = 28.6 bits (56), Expect(2) = 0.62 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 / +3 Query: 1511 WWRRFTSWFRCWICGHWRCRGCWARGLRAWCWR 1609 WW R SW R WR R RG R WR Sbjct: 570 WWCRRCSWRRRRNGQRWRWRVWRRRGQRWRVWR 668 Score = 25.4 bits (49), Expect(2) = 0.62 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = +2 / +3 Query: 1607 RWSGRFWYWRRGQRPW*SWEVHG 1675 RW W WR + W W HG Sbjct: 669 RWCHGRWCWRWRRPWWWWWRRHG 737 Score = 33.6 bits (67), Expect = 4.8 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 / +3 Query: 1532 WFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWR 1636 W R W W CR G RAW WR + WR Sbjct: 417 WSRRWFRSRWWCRRWKWYGRRAWRWRRWWFWRRWR 521
>LOC_Os07g30020:12007.t02692:unspliced-genomic phosphoribosylanthranilate transferase, putative, expressed| Length = 5448 Score = 36.3 bits (73), Expect(2) = 4e-04 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = +3 / +3 Query: 1116 FKVKTKVIDDNLNPEWNETFELIVEDKETQSVIFEVYDEDNLQQD 1250 +K+KT+ + N PEW+E F E ++ S+ V D+D ++ D Sbjct: 3048 YKMKTRHFEKNQRPEWDEVFAFPREVMQSTSLEVIVKDKDFIRDD 3182 Score = 28.6 bits (56), Expect(2) = 4e-04 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 / +3 Query: 1023 LSVTVVKAISLKNKELIGKSDPYVTLYV 1106 L V VVKA L + ++ G DPYV +++ Sbjct: 2958 LFVRVVKARDLPHMDITGSLDPYVEVHL 3041
>LOC_Os12g08670:12012.t00749:unspliced-genomic C2 domain containing protein| Length = 3489 Score = 46.0 bits (94), Expect = 0.001 Identities = 23/71 (32%), Positives = 33/71 (46%) Frame = +3 / +1 Query: 1023 LSVTVVKAISLKNKELIGKSDPYVTLYVRPMFKVKTKVIDDNLNPEWNETFELIVEDKET 1202 L V V+KA L + + G DPYV + + T+ N NPEWNETF + + Sbjct: 598 LFVRVIKARKLPDMDANGSLDPYVEVKFGAYNRGVTRCFKRNKNPEWNETFAFSFQHDKI 777 Query: 1203 QSVIFEVYDED 1235 S ++ D Sbjct: 778 PSPTVDIVVND 810
>LOC_Os04g59520:12004.t05408:unspliced-genomic phosphoribosylanthranilate transferase, putative, expressed| Length = 4001 Score = 33.1 bits (66), Expect(2) = 0.001 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +3 / +2 Query: 957 RVVVPLGVNVDTSELELKPEGKLSVTVVKAISLKNKELIGKSDPYV 1094 R V + ++ ++P L V+VVKA L N ++ G DPYV Sbjct: 1052 RAAVAAAAKIASTYDMVEPMSYLYVSVVKARDLPNMDITGALDPYV 1189 Score = 30.4 bits (60), Expect(2) = 0.001 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +3 / +2 Query: 1116 FKVKTKVIDDNLNPEWNETFELIVEDKETQSVIFEVYDEDNLQQD 1250 FK T+ ++ N NP W + F + ++ + V D+D L+ D Sbjct: 1208 FKGVTRHLEKNPNPVWRQVFAFSRDHLQSSQLEVVVKDKDVLKDD 1342
>LOC_Os05g30750:12005.t02674:unspliced-genomic phosphoribosylanthranilate transferase, putative, expressed| Length = 4393 Score = 32.7 bits (65), Expect(2) = 0.001 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 / +1 Query: 1116 FKVKTKVIDDNLNPEWNETFELIVEDKETQSVIFEVYDEDNLQQD 1250 +K T+ + NPEWN+ F E ++ V V D+D ++ D Sbjct: 1705 YKGTTRHFEKKTNPEWNQVFAFSKERIQSSVVEIIVKDKDFVKDD 1839 Score = 30.4 bits (60), Expect(2) = 0.001 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +3 / +1 Query: 1023 LSVTVVKAISLKNKELIGKSDPYV 1094 L V VVKA L +K++ G DPYV Sbjct: 1615 LYVRVVKAKDLPSKDITGSCDPYV 1686
>LOC_Os02g17860:12002.t01580:unspliced-genomic expressed protein| Length = 5462 Score = 38.2 bits (77), Expect(2) = 0.003 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +2 / +2 Query: 1514 WRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW 1654 WR R W CG WR + W G WRW G W R R W Sbjct: 3788 WRYCWGTRRRW*CGGWRAQRRWWCGGWRARWRW*GARWRTR*RWRWW 3928 Score = 24.0 bits (46), Expect(2) = 0.003 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 / +3 Query: 1472 EGGWGNWQHDGCT 1510 EGG G W +DG T Sbjct: 3759 EGGGGGWLYDGGT 3797 Score = 25.8 bits (50), Expect(3) = 0.016 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 / +2 Query: 1538 RCWICGHWRCRGCW 1579 R W CG WR R W Sbjct: 3965 RRWWCGGWRARWRW 4006 Score = 25.4 bits (49), Expect(3) = 0.016 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 / +3 Query: 1472 EGGWGNWQHDGCT 1510 EGG G W +DG T Sbjct: 3912 EGGGGGWLYDGAT 3950 Score = 24.0 bits (46), Expect(3) = 0.016 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 / +2 Query: 1559 WRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW* 1657 WR G R R W W +WY R + W* Sbjct: 3998 WRW*GARWRTRRRWWW*LVV*WWYCRGTRWRW* 4096 Score = 25.4 bits (49), Expect(3) = 0.28 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 / +3 Query: 1472 EGGWGNWQHDGCT 1510 EGG G W +DG T Sbjct: 3558 EGGGGGWLYDGAT 3596 Score = 23.1 bits (44), Expect(3) = 0.28 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 / +2 Query: 1538 RCWICGHWRCR 1570 R W CG WR R Sbjct: 3692 RRWWCGGWRAR 3724 Score = 22.1 bits (42), Expect(3) = 0.28 Identities = 7/18 (38%), Positives = 8/18 (44%) Frame = +2 / +2 Query: 1571 GCWARGLRAWCWRWSGRF 1624 G W R WC W R+ Sbjct: 3827 GGWRAQRRWWCGGWRARW 3880 Score = 29.5 bits (58), Expect(2) = 0.74 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 / +2 Query: 1514 WRRFTSWFRCWICGHWRCRGCWARGLRAWCWRW 1612 WR R W CG WR R W R RW Sbjct: 3467 WRYCWGTRRRWWCGGWRARWRW*GARRRTR*RW 3565 Score = 24.0 bits (46), Expect(2) = 0.74 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 / +3 Query: 1472 EGGWGNWQHDGCT 1510 EGG G W +DG T Sbjct: 3438 EGGGGGWLYDGGT 3476 Score = 28.1 bits (55), Expect(2) = 1.8 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 / +2 Query: 1514 WRRFTSWFRCWICGHWRCRGCW 1579 WR R W CG WR R W Sbjct: 4262 WRYCRGTRRRW*CGGWRARWRW 4327 Score = 24.0 bits (46), Expect(2) = 1.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 / +3 Query: 1472 EGGWGNWQHDGCT 1510 EGG G W +DG T Sbjct: 4233 EGGGGGWLYDGGT 4271 Score = 25.8 bits (50), Expect(2) = 3.2 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 / +2 Query: 1538 RCWICGHWRCRGCW 1579 R W CG WR R W Sbjct: 4889 RRWWCGGWRARWRW 4930 Score = 25.4 bits (49), Expect(2) = 3.2 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 / +3 Query: 1472 EGGWGNWQHDGCT 1510 EGG G W +DG T Sbjct: 4755 EGGGGGWLYDGAT 4793 Score = 27.6 bits (54), Expect(3) = 3.3 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +2 / +2 Query: 1568 RGCWARGLRAWCWRWSGRFWYWRRGQRPW*SW 1663 R CW R WC W R+ + +R * W Sbjct: 3470 RYCWGTRRRWWCGGWRARWRW*GARRRTR*RW 3565 Score = 25.8 bits (50), Expect(3) = 3.3 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 / +2 Query: 1538 RCWICGHWRCRGCW 1579 R W CG WR R W Sbjct: 3170 RRWWCGGWRARWRW 3211 Score = 25.4 bits (49), Expect(3) = 3.3 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 / +3 Query: 1472 EGGWGNWQHDGCT 1510 EGG G W +DG T Sbjct: 2916 EGGGGGWLYDGAT 2954 Score = 25.4 bits (49), Expect(2) = 7.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 / +3 Query: 1472 EGGWGNWQHDGCT 1510 EGG G W +DG T Sbjct: 4353 EGGGGGWLYDGAT 4391 Score = 25.4 bits (49), Expect(2) = 7.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 / +3 Query: 1472 EGGWGNWQHDGCT 1510 EGG G W +DG T Sbjct: 4554 EGGGGGWLYDGAT 4592 Score = 24.4 bits (47), Expect(2) = 7.8 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 / +2 Query: 1544 WICGHWRCR 1570 W+CG WR R Sbjct: 4493 WLCGGWRAR 4519 Score = 24.4 bits (47), Expect(2) = 7.8 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 / +2 Query: 1544 WICGHWRCR 1570 W+CG WR R Sbjct: 4694 WLCGGWRAR 4720
>LOC_Os01g72230:12001.t06511:unspliced-genomic GTPase activating protein, putative, expressed| Length = 3922 Score = 35.0 bits (70), Expect(2) = 0.003 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +3 / +1 Query: 1110 PMFKVKTKVIDDNLNPEWNETFELIVED 1193 P +KTKVI +LNP WNE L + D Sbjct: 3040 PF*SMKTKVIKSSLNPVWNERILLSIPD 3123 Score = 26.7 bits (52), Expect(2) = 0.003 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +3 / +2 Query: 1218 EVYDEDNLQQDKRLGVAKLAVNNIV 1292 +VYD+D D R+G A++ + +V Sbjct: 3245 QVYDKDTFTTDDRMGEAEINIQPLV 3319
>LOC_Os01g08530:12001.t00731:unspliced-genomic fibroin heavy chain precursor, putative, expressed| Length = 1461 Score = 35.0 bits (70), Expect(3) = 0.004 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 / +3 Query: 1598 WCWRWSGRFWYWRRGQRPW*SW 1663 WCWR +W+ R +RPW W Sbjct: 1086 WCWRRVRNWWWKRVRRRPWRRW 1151 Score = 26.7 bits (52), Expect(3) = 0.004 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +2 / +3 Query: 1481 WGNWQHDGCTWWRR 1522 W W GC WW R Sbjct: 687 WWVWCRRGCGWWHR 728 Score = 24.4 bits (47), Expect(3) = 0.004 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 / +3 Query: 1514 WRRFTSWFRCW 1546 WRRF +RCW Sbjct: 858 WRRFWRRWRCW 890 Score = 34.1 bits (68), Expect(3) = 0.021 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 / +3 Query: 1559 WRCRGCWARGLRAWCWRWSGRFWYWRRG 1642 WR CW R R RW + W W RG Sbjct: 366 WRWCWCWIRKRRGCRCRWWSQGWRWSRG 449 Score = 24.9 bits (48), Expect(3) = 0.021 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 / +3 Query: 1514 WRRFTSWFRCWICGHWRCR 1570 WR + W R W W CR Sbjct: 198 WRCWCRWRRGWWHWRWGCR 254 Score = 24.4 bits (47), Expect(3) = 0.021 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = +2 / +3 Query: 1625 WYWRRGQRPW*SW 1663 W+W R +R W W Sbjct: 621 WWWGRTRRRWNGW 659 Score = 28.1 bits (55), Expect(2) = 0.25 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 / +3 Query: 1598 WCWRWSGRFWYWRRGQRPW 1654 WCWRW G R +R W Sbjct: 774 WCWRWHGGRHRRRCWRRRW 830 Score = 27.2 bits (53), Expect(2) = 0.25 Identities = 11/33 (33%), Positives = 12/33 (36%) Frame = +2 / +3 Query: 1481 WGNWQHDGCTWWRRFTSWFRCWICGHWRCRGCW 1579 WG + WWR W R W R R W Sbjct: 552 WGQIRRRWNGWWRWVWRWCRRWSWWWGRTRRRW 650 Score = 32.7 bits (65), Expect(2) = 0.70 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +2 / +3 Query: 1544 WICGHWRCRGCWARGLRAWCWRWSGRFW 1627 W+ WRCR W R ++W R + + W Sbjct: 1326 WVRSRWRCRDGWWRWCQSWRRRRTQKRW 1409 Score = 25.8 bits (50), Expect(2) = 0.70 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = +2 / +3 Query: 1451 NRGEKAAEGGWGNWQHDGCTWWRRFTSWFR 1540 ++G + + GGW W C W W+R Sbjct: 423 SQGWRWSRGGWWRWIWWWCRGWWWHWCWWR 512 Score = 26.7 bits (52), Expect(2) = 0.81 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 / +3 Query: 1559 WRCRGCWARGLRAWC 1603 WRCR RG R WC Sbjct: 168 WRCRCRRWRGWRCWC 212 Score = 26.7 bits (52), Expect(2) = 0.81 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 / +3 Query: 1598 WCWRWSGRFWYWR 1636 W WRW R++ WR Sbjct: 231 WHWRWGCRWFGWR 269 Score = 35.4 bits (71), Expect = 1.4 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = +2 / +3 Query: 1487 NWQHDGCTWWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW 1654 +W+ C +R R W G RG W R + WC W + +WR +R W Sbjct: 363 SWRWCWCWIRKRRGCRCRWWSQGWRWSRGGWWRWIWWWCRGWWWHWCWWRFRRRCW 530 Score = 29.0 bits (57), Expect(2) = 1.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +2 / +3 Query: 1577 WARGLRAWCWRWSGRFWYWRRGQRPW*SW 1663 W R + WC RWS + RR W W Sbjct: 582 WWRWVWRWCRRWSWWWGRTRRRWNGWWQW 668 Score = 23.5 bits (45), Expect(2) = 1.5 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +2 / +3 Query: 1511 WWRRFTSWFRCWICGHWRC 1567 WW R W CW RC Sbjct: 471 WWCRGWWWHWCWWRFRRRC 527 Score = 35.0 bits (70), Expect = 1.9 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 / +3 Query: 1532 WFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW*SW 1663 W W G W W R WC RWS + RR W W Sbjct: 462 WIWWWCRGWWWHWCWWRFRRRCWCRRWSWWWGQIRRRWNGWWRW 593 Score = 25.4 bits (49), Expect(2) = 6.5 Identities = 7/23 (30%), Positives = 10/23 (43%) Frame = +2 / +3 Query: 1481 WGNWQHDGCTWWRRFTSWFRCWI 1549 WG + WW+ W R W+ Sbjct: 627 WGRTRRRWNGWWQWVWRWCRWWV 695 Score = 24.9 bits (48), Expect(2) = 6.5 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 / +3 Query: 1598 WCWRWSGRFWYWRRGQRPW 1654 W WRW R+ R +R W Sbjct: 762 WHWRWCWRWHGGRHRRRCW 818 Score = 32.7 bits (65), Expect = 9.1 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 / +3 Query: 1538 RCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW*SW 1663 RC WRC W RG W W W WR +R W Sbjct: 177 RCRRWRGWRCWCRWRRGWWHWRWGCRWFGWRWRWRRRLRREW 302
>LOC_Os03g44170:12003.t03805:unspliced-genomic glutathione S-transferase parA, putative, expressed| Length = 1202 Score = 31.3 bits (62), Expect(2) = 0.004 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 / +1 Query: 1550 CGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQR 1648 CG WR A RW+ W WRR +R Sbjct: 511 CGRWRRSSAGGGTSAAAARRWATWTWRWRRSRR 609 Score = 30.4 bits (60), Expect(2) = 0.004 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +2 / +1 Query: 1457 GEKAAEGGWGNWQHDGCTWWRRFTSWFR 1540 G + A W+ G +WWRR W R Sbjct: 445 GRRRAPRARRRWRRRGASWWRRCGRWRR 528
>LOC_Os12g35710:12012.t03259:unspliced-genomic extensin-like protein, putative, expressed| Length = 2620 Score = 28.1 bits (55), Expect(3) = 0.004 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +2 / -2 Query: 1481 WGNWQHDGCTWWRRFTSW 1534 W W+ D C WR F W Sbjct: 1617 WWRWRVDWCGGWRGFYRW 1564 Score = 27.2 bits (53), Expect(3) = 0.004 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 / -2 Query: 1601 CWRWSGRFWYWRRGQR 1648 CWRW G W+ R R Sbjct: 1545 CWRWRGFDWWGWRAHR 1498 Score = 22.1 bits (42), Expect(3) = 0.004 Identities = 5/7 (71%), Positives = 5/7 (71%) Frame = +2 / -2 Query: 1559 WRCRGCW 1579 WR GCW Sbjct: 1560 WRAHGCW 1540 Score = 31.3 bits (62), Expect(2) = 0.32 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 / -2 Query: 1481 WGNWQHDGCTWWRRFTSW 1534 W W+ D C WRRF W Sbjct: 1809 WWRWRVDWCWGWRRFYRW 1756 Score = 23.5 bits (45), Expect(2) = 0.32 Identities = 5/11 (45%), Positives = 7/11 (63%) Frame = +2 / -2 Query: 1598 WCWRWSGRFWY 1630 WC W G +W+ Sbjct: 1644 WCGGWRGFYWW 1612 Score = 27.6 bits (54), Expect(2) = 0.43 Identities = 13/43 (30%), Positives = 15/43 (34%) Frame = +2 / -2 Query: 1544 WICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW*SWEVH 1672 W WR R R R + W W W R + W W H Sbjct: 2061 WGFHRWRWRTDRRRRWRRFYWWWWRAHWCRGRWEFYWWRWRDH 1933 Score = 26.7 bits (52), Expect(2) = 0.43 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 / -2 Query: 1502 GCTWWRRFTSWFRCWICGHW 1561 G WWRR W R W +W Sbjct: 2202 GMYWWRR*DHWRRRWG*MYW 2143 Score = 24.0 bits (46), Expect(3) = 0.53 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +2 / -2 Query: 1481 WGNWQHDGCTWWRRFTSW 1534 W + D C WRRF W Sbjct: 1857 WWRRRVDWCWGWRRFYWW 1804 Score = 23.1 bits (44), Expect(3) = 0.53 Identities = 6/12 (50%), Positives = 6/12 (50%) Frame = +2 / -2 Query: 1577 WARGLRAWCWRW 1612 W R WCW W Sbjct: 1809 WWRWRVDWCWGW 1774 Score = 22.6 bits (43), Expect(3) = 0.53 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +2 / -2 Query: 1592 RAWCWRWSGRFWYWRRGQRPW 1654 R + WRW + W RG W Sbjct: 1770 RFYRWRWRVDWCRWWRGFYRW 1708 Score = 28.1 bits (55), Expect(2) = 6.2 Identities = 9/26 (34%), Positives = 11/26 (42%) Frame = +2 / -2 Query: 1577 WARGLRAWCWRWSGRFWYWRRGQRPW 1654 W R WCW W +W+ R W Sbjct: 1857 WWRRRVDWCWGWRRFYWWRWRVDWCW 1780 Score = 22.1 bits (42), Expect(2) = 6.2 Identities = 8/27 (29%), Positives = 10/27 (37%) Frame = +2 / -2 Query: 1481 WGNWQHDGCTWWRRFTSWFRCWICGHW 1561 W H WW + +R CG W Sbjct: 1950 WRWRDHRRGWWWGFYQWGWRAHRCGRW 1870
>LOC_Os12g01210:12012.t00020:unspliced-genomic HCF152, putative, expressed| Length = 2464 Score = 28.1 bits (55), Expect(3) = 0.010 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 / +2 Query: 1607 RWSGRFWYWRRGQRPW 1654 R SGR W W RG R W Sbjct: 1973 RCSGRRWRWWRGWRRW 2020 Score = 25.8 bits (50), Expect(3) = 0.010 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +2 / +2 Query: 1478 GWGNWQHDGCTWWRRFTSW 1534 GW G WWRR W Sbjct: 1712 GWQWTGRRGTCWWRRTAGW 1768 Score = 22.1 bits (42), Expect(3) = 0.010 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 / +2 Query: 1559 WRCRGCWARGLR 1594 WR G W RG R Sbjct: 1832 WRRTGAWRRGSR 1867
>LOC_Os11g01210:12011.t00021:unspliced-genomic HCF152, putative| Length = 1632 Score = 28.1 bits (55), Expect(3) = 0.010 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 / +2 Query: 1607 RWSGRFWYWRRGQRPW 1654 R SGR W W RG R W Sbjct: 1382 RCSGRRWRWWRGWRRW 1429 Score = 25.8 bits (50), Expect(3) = 0.010 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +2 / +2 Query: 1478 GWGNWQHDGCTWWRRFTSW 1534 GW G WWRR W Sbjct: 1121 GWRWTGRRGTCWWRRTAGW 1177 Score = 22.1 bits (42), Expect(3) = 0.010 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 / +2 Query: 1559 WRCRGCWARGLR 1594 WR G W RG R Sbjct: 1241 WRRTGAWRRGSR 1276
>LOC_Os07g11530:12007.t01026:unspliced-genomic latency associated nuclear antigen, putative| Length = 453 Score = 35.9 bits (72), Expect(2) = 0.013 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +2 / +2 Query: 1592 RAWCWRWSGRFWYWRRGQRPW 1654 R W WRW GR + +RGQR W Sbjct: 311 RRWRWRWRGRR*WRQRGQRRW 373 Score = 24.0 bits (46), Expect(2) = 0.013 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +2 / +3 Query: 1433 GVRKESNRGEKAAEGGWGNWQHDGCTWWRRFTSWFRCWICGHWRCRG 1573 G R RG + G W G RR W R WR RG Sbjct: 126 GGRGSRRRGGRGRGGRGSRWTDGGEDDRRRGRRWRRWRRGRRWRQRG 266
>LOC_Os07g36150:12007.t03287:unspliced-genomic formin homology 2 domain-containing protein 5, putative, expressed| Length = 5926 Score = 41.8 bits (85), Expect = 0.016 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 / -2 Query: 1559 WRCRGCWARGLRAWCWRWSGRFW 1627 WR R WAR R W WRW FW Sbjct: 3507 WRWRARWARASRFWWWRWRCSFW 3439
>LOC_Os07g07870:12007.t00666:unspliced-genomic lipid binding protein, putative| Length = 782 Score = 33.1 bits (66), Expect(2) = 0.017 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +2 / -3 Query: 1505 CTWWRRFTSWFRCWICGHWRCRGCW 1579 C WW F CW+ RC CW Sbjct: 537 CRWWTWFILVCLCWLIS*CRCIWCW 463 Score = 26.3 bits (51), Expect(2) = 0.017 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 / -3 Query: 1598 WCWRWS 1615 WCWRWS Sbjct: 471 WCWRWS 454
>LOC_Os08g23900:12008.t02161:unspliced-genomic latency associated nuclear antigen, putative| Length = 453 Score = 36.3 bits (73), Expect(2) = 0.017 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +2 / +2 Query: 1592 RAWCWRWSGRFWYWRRGQRPW 1654 R W WRW GR + +RGQR W Sbjct: 311 RRWRWRWRGRRRWRQRGQRRW 373 Score = 23.1 bits (44), Expect(2) = 0.017 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +2 / +3 Query: 1433 GVRKESNRGEKAAEGGWGNWQHDGCTWWRRFTSWFRCWICGHWRCRG 1573 G R RG + G W G RR W R WR RG Sbjct: 126 GGRGSRRRGGQGRGGRGSRWTDGGEDDRRRGRRWRRRRRGRRWRQRG 266
>LOC_Os10g33230:12010.t02625:unspliced-genomic heterogeneous nuclear ribonucleoprotein 27C, putative, expressed| Length = 5337 Score = 32.2 bits (64), Expect(2) = 0.021 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = +2 / +1 Query: 1544 WICGHWRCRGCWARGLRAWCWRWSGRFWYW 1633 W G W + R + WCW W + +W Sbjct: 1387 WRKGRWCWQSSCWRWIWVWCWLWKREWRFW 1476 Score = 26.7 bits (52), Expect(2) = 0.021 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 / +1 Query: 1514 WRRFTSWFRCWICGHWR 1564 WRR W WI G WR Sbjct: 1342 WRRCIVW*SWWIWGLWR 1392
>LOC_Os10g31460:12010.t02469:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 8917 Score = 41.4 bits (84), Expect = 0.022 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 / +2 Query: 1514 WRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYW 1633 W R S R W W C G W R R W WS R W Sbjct: 3659 WFRVRSSRRVWTVWRWICSGWWPRWRRRWWTEWSRRQRIW 3778 Score = 37.7 bits (76), Expect = 0.28 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +2 / +2 Query: 1484 GNWQHDGCTWWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYW 1633 G W G W R R WI WR R R R W +R RFW W Sbjct: 3395 GRWFRLGIWLWLRIWPGGR*WIIC*WRWRRRRWRRWREWWFRIWFRFWVW 3544 Score = 28.6 bits (56), Expect(2) = 3.1 Identities = 9/29 (31%), Positives = 10/29 (34%) Frame = +2 / +1 Query: 1478 GWGNWQHDGCTWWRRFTSWFRCWICGHWR 1564 GW WW R W W+ WR Sbjct: 8458 GWRTRWRWWTKWWIRIWVWLWLWVWSSWR 8544 Score = 22.6 bits (43), Expect(2) = 3.1 Identities = 6/14 (42%), Positives = 8/14 (57%) Frame = +2 / +1 Query: 1598 WCWRWSGRFWYWRR 1639 W WRW +W+R Sbjct: 8590 WRWRWWTERSWWQR 8631 Score = 26.7 bits (52), Expect(2) = 7.5 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +2 / +2 Query: 1505 CTWWRRFTSWFRCWICGHWRCRGCW 1579 C WRR W R W W G W Sbjct: 224 C*RWRRRRWWRRWWWVKRWFWLGIW 298 Score = 23.1 bits (44), Expect(2) = 7.5 Identities = 6/15 (40%), Positives = 8/15 (53%) Frame = +2 / +2 Query: 1610 WSGRFWYWRRGQRPW 1654 W R+W+W R W Sbjct: 347 WRRRWWWWWRWAEWW 391
>LOC_Os07g09730:12007.t00847:unspliced-genomic hypothetical protein| Length = 1188 Score = 41.4 bits (84), Expect = 0.022 Identities = 21/49 (42%), Positives = 24/49 (48%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW*SW 1663 RR+ S +R W G WRC ARG R GR WRR +R SW Sbjct: 1001 RRWRSRWRWWGTGGWRCGRGGARGRCGCTTRGRGRARRWRRWKRAAASW 1147
>LOC_Os06g40020:12006.t03699:unspliced-genomic ATP-dependent RNA helicase ded-1, putative, expressed| Length = 5143 Score = 41.4 bits (84), Expect = 0.022 Identities = 18/48 (37%), Positives = 22/48 (45%) Frame = +2 / +2 Query: 1511 WWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW 1654 W + W +C G W R LR W WR R+W+WRR R W Sbjct: 4340 WKKPEVWWRGQQVCRQRFPPGQWRRLLRWWWWRRLLRWWWWRRLLRWW 4483 Score = 35.0 bits (70), Expect = 1.9 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 / +2 Query: 1577 WARGLRAWCWRWSGRFWYWRRGQRPW 1654 W R LR W WR R+W+W PW Sbjct: 4433 WRRLLRWWWWRRLLRWWWWLLRWWPW 4510
>LOC_Os06g21310:12006.t01948:unspliced-genomic glycine-rich cell wall structural protein precursor, putative| Length = 1017 Score = 41.4 bits (84), Expect = 0.022 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 / +3 Query: 1532 WFRCWICGHWRCRGCWARGLRAWCWRW 1612 W W+ WRC CW R W W W Sbjct: 876 WLWWWVWSWWRCTVCWRIWCRCWLWWW 956
>LOC_Os03g25950:12003.t02288:unspliced-genomic hypothetical protein| Length = 2170 Score = 31.8 bits (63), Expect(3) = 0.024 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 / -1 Query: 101 SNHRQPQLTPPPLVNPDCSIESRAQVKRR 187 S+ R P L PPP P C+ SR + ++R Sbjct: 1480 SSRRLPPLRPPPAAAPACAPRSRPRERKR 1394 Score = 29.0 bits (57), Expect(3) = 0.024 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 / -1 Query: 1433 GVRKESNRGEKAAEGGWGNWQHD 1501 G R+ + GE+ EGG G+WQ + Sbjct: 529 GGRELAAAGERVGEGGGGSWQRE 461 Score = 23.5 bits (45), Expect(3) = 0.024 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 / -1 Query: 1610 WSGRFWYWRRGQRP 1651 W G +W R G+RP Sbjct: 172 WCGWWWCERNGERP 131
>LOC_Os07g40510:12007.t03709:unspliced-genomic formin-2, putative, expressed| Length = 6892 Score = 34.1 bits (68), Expect(2) = 0.028 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +2 / -3 Query: 1577 WARGLRAWCWRWSGRFWYWRRGQRPW*SW 1663 W RG++ CWRW GR+ + W W Sbjct: 476 WRRGIKMCCWRWWGRWRSIKACSWKWRWW 390 Score = 24.4 bits (47), Expect(2) = 0.028 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +2 / -3 Query: 1502 GCTWWRRFTSWFRCW 1546 G WWR + S +R W Sbjct: 632 GWRWWRTWASTWRWW 588 Score = 30.4 bits (60), Expect(2) = 0.41 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 / -3 Query: 1598 WCWRWSGRFWYWRR 1639 W WRW R W W R Sbjct: 554 WWWRWRARGWRWGR 513 Score = 24.0 bits (46), Expect(2) = 0.41 Identities = 8/31 (25%), Positives = 10/31 (32%) Frame = +2 / -3 Query: 1514 WRRFTSWFRCWICGHWRCRGCWARGLRAWCW 1606 WR + W C + W R W W Sbjct: 713 WRGWRRWSTCTATWRRKRWSTWTTTWRGWRW 621 Score = 25.8 bits (50), Expect(2) = 4.3 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 / -3 Query: 1598 WCWRWSGRFWYWRRGQRPW 1654 W W F +WRR R W Sbjct: 236 WAWSTRTWFQWWRRWWRRW 180 Score = 24.9 bits (48), Expect(2) = 4.3 Identities = 7/17 (41%), Positives = 8/17 (47%) Frame = +2 / -3 Query: 1562 RCRGCWARGLRAWCWRW 1612 +C W G W WRW Sbjct: 296 KCSRGWG*GRGRWRWRW 246
>LOC_Os01g41120:12001.t03634:unspliced-genomic protein binding protein, putative, expressed| Length = 2099 Score = 40.9 bits (83), Expect = 0.030 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 / -1 Query: 1577 WARGLRAWCWRWSGRFWYWRRGQRPW 1654 W R R W WRW R +WRRG R W Sbjct: 1373 WRRRWRWWWWRWRRR*RWWRRG*RRW 1296 Score = 34.5 bits (69), Expect = 2.6 Identities = 16/45 (35%), Positives = 20/45 (44%) Frame = +2 / -1 Query: 1514 WRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQR 1648 WR +R W R R W R R WR R+W+WR +R Sbjct: 1463 WRWRRRRWRRWRWWRRRWRWWWRRRRRGRRWRRRWRWWWWRWRRR 1329
>LOC_Os12g13890:12012.t01256:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 1067 Score = 29.5 bits (58), Expect(2) = 0.031 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 / +1 Query: 1589 LRAWCWRWSGRFWYWRRGQRPW 1654 +R W W WSG + +W R W Sbjct: 532 IRVWFWIWSGWWSFWWRLWTRW 597 Score = 29.0 bits (57), Expect(2) = 0.031 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 / +1 Query: 1490 WQHDGCTWWRRFTSWFR 1540 W G WWR +T W+R Sbjct: 436 WSR*GSFWWRLWTRWWR 486 Score = 29.9 bits (59), Expect(2) = 0.076 Identities = 9/28 (32%), Positives = 10/28 (35%) Frame = +2 / +1 Query: 1481 WGNWQHDGCTWWRRFTSWFRCWICGHWR 1564 W W W R W R W+ WR Sbjct: 601 WRRWWRTRWWKWIRLRIWIRFWLWSRWR 684 Score = 27.2 bits (53), Expect(2) = 0.076 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +2 / +1 Query: 1559 WRCRGCWARGLRAWCWRWSGRFW 1627 WR R + LR W W W R W Sbjct: 730 WRPRRWFR*RLRLWIWVWWRRRW 798 Score = 27.2 bits (53), Expect(2) = 3.7 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +2 / +1 Query: 1589 LRAWCWRWSGRFWYWRRGQRPW 1654 +R W W W + WRR + W Sbjct: 298 IRLWIWLWPRWWSIWRRLWKRW 363 Score = 24.0 bits (46), Expect(2) = 3.7 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +2 / +1 Query: 1511 WWRRFTSWFRCW 1546 W RR++ W+R W Sbjct: 214 WTRRWSFWWRLW 249 Score = 26.7 bits (52), Expect(2) = 6.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 / +1 Query: 1586 GLRAWCWRWSGRFWYWRRGQRPW*SW 1663 G R W W W+GR+ + R W W Sbjct: 253 GWRRWRWWWTGRW*WIRLWIWLWPRW 330 Score = 23.5 bits (45), Expect(2) = 6.6 Identities = 7/19 (36%), Positives = 8/19 (42%) Frame = +2 / +1 Query: 1484 GNWQHDGCTWWRRFTSWFR 1540 G W WWR + W R Sbjct: 208 GLWTRRWSFWWRLWAGWRR 264
>LOC_Os06g43120:12006.t04002:unspliced-genomic zinc finger C-x8-C-x5-C-x3-H type family protein, expressed| Length = 7923 Score = 29.9 bits (59), Expect(2) = 0.037 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 / -2 Query: 1598 WCWRWSGRFWYW 1633 W W WSGR+++W Sbjct: 197 WWWWWSGRWYWW 162 Score = 28.1 bits (55), Expect(2) = 0.037 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 / -2 Query: 1550 CGHWRCRGCWARGLRAWCWRW 1612 C W CW RG W W W Sbjct: 254 CWWWWW*WCWTRGGGWWWWWW 192
>LOC_Os11g47060:12011.t04181:unspliced-genomic expressed protein| Length = 372 Score = 30.9 bits (61), Expect(2) = 0.044 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 / +3 Query: 1559 WRCRGCWARGLRAWCWRWSGR 1621 WR RG G R W W+W R Sbjct: 75 WRRRGRGGEGERRWWWKWRWR 137 Score = 27.2 bits (53), Expect(2) = 0.044 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 / +3 Query: 1598 WCWRWSGRFWYWRRGQ 1645 W WRW GR RRG+ Sbjct: 120 WKWRWRGRAANTRRGR 167
>LOC_Os03g55470:12003.t04811:unspliced-genomic expressed protein| Length = 4418 Score = 30.4 bits (60), Expect(2) = 0.052 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 / -3 Query: 1592 RAWCWRWSGRFWYWRRGQR 1648 R W WRWS R W R +R Sbjct: 288 RHWRWRWSWRIWTGRARRR 232 Score = 27.2 bits (53), Expect(2) = 0.052 Identities = 13/44 (29%), Positives = 16/44 (36%) Frame = +2 / -3 Query: 1433 GVRKESNRGEKAAEGGWGNWQHDGCTWWRRFTSWFRCWICGHWR 1564 G R+ A G W+ WR TSW+ W WR Sbjct: 510 GGRRRRTASGAATRSGGRAWRPRWRWSWRSPTSWWWWWRRRRWR 379
>LOC_Os10g31330:12010.t02459:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 1267 Score = 31.3 bits (62), Expect(2) = 0.055 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 / +1 Query: 1592 RAWCWRWSGRFWYWRR 1639 R WCWR R W W R Sbjct: 577 RWWCWRLRARVWLWFR 624 Score = 26.3 bits (51), Expect(2) = 0.055 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 / +1 Query: 1514 WRRFTSWFRCWIC 1552 W R W RCW C Sbjct: 499 WARLWLWCRCWWC 537 Score = 26.7 bits (52), Expect(2) = 2.7 Identities = 9/24 (37%), Positives = 10/24 (41%) Frame = +2 / +1 Query: 1553 GHWRCRGCWARGLRAWCWRWSGRF 1624 G W C W W WRW R+ Sbjct: 634 GCWWCSWWWLWKWWRWRWRWRPRW 705 Score = 24.9 bits (48), Expect(2) = 2.7 Identities = 9/26 (34%), Positives = 10/26 (38%) Frame = +2 / +1 Query: 1490 WQHDGCTWWRRFTSWFRCWICGHWRC 1567 W C W R W+R W W C Sbjct: 511 WLWCRCWWCWRVW*WWRRWWWPRWWC 588 Score = 25.8 bits (50), Expect(2) = 4.9 Identities = 9/23 (39%), Positives = 9/23 (39%) Frame = +2 / +1 Query: 1544 WICGHWRCRGCWARGLRAWCWRW 1612 W C WR W R R W W Sbjct: 409 WRCCRWRVWAWWRRRRRWW*GWW 477 Score = 24.9 bits (48), Expect(2) = 4.9 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 / +1 Query: 1598 WCWRWSGRFWYWRRGQRPW 1654 W W R+W WR R W Sbjct: 556 WRRWWWPRWWCWRLRARVW 612
>LOC_Os06g51440:12006.t04827:unspliced-genomic expressed protein| Length = 956 Score = 29.5 bits (58), Expect(2) = 0.056 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 / +3 Query: 1604 WRWSGRFWYWRRGQRPW*SWEV 1669 WRW R W+WR+ + W + V Sbjct: 306 WRWWLRRWWWRQLWKRWHGFRV 371 Score = 28.1 bits (55), Expect(2) = 0.056 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +2 / +3 Query: 1511 WWRRFTSWFRCWICGHWRCRGCWARGLR 1594 W+R + +RCW WR R W R R Sbjct: 168 WFRIWFWQWRCWRRWLWRWRWVWQRRRR 251 Score = 29.5 bits (58), Expect(3) = 0.23 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 / +3 Query: 1604 WRWSGRFWYWRR 1639 WRW R W+WRR Sbjct: 519 WRWWQRRWWWRR 554 Score = 25.8 bits (50), Expect(3) = 0.23 Identities = 10/33 (30%), Positives = 11/33 (33%) Frame = +2 / +3 Query: 1514 WRRFTSWFRCWICGHWRCRGCWARGLRAWCWRW 1612 W R W W WR W + W W W Sbjct: 384 WFRL*LWGPRWRWRSWRRGWWWIWLWQRWLWIW 482 Score = 23.1 bits (44), Expect(3) = 0.23 Identities = 11/61 (18%), Positives = 28/61 (45%) Frame = +3 / +2 Query: 642 QIIMDIDFRWGGDPSIILAVDARVASLPIQLKDLQVFTVVRVVFQLSEEIPCISAFVVAL 821 ++ M+++ + + ARV ++ + ++ + V VV E + + VVA+ Sbjct: 206 EVAMEVEVGMAAEEEKAMVHTARVMAMVLAMEVVAVVATEVVVAAAMEAVAWVQGMVVAM 385 Query: 822 L 824 + Sbjct: 386 V 388 Score = 29.9 bits (59), Expect(2) = 1.5 Identities = 9/25 (36%), Positives = 10/25 (40%) Frame = +2 / +3 Query: 1559 WRCRGCWARGLRAWCWRWSGRFWYW 1633 W R W R W W W + W W Sbjct: 402 WGPRWRWRSWRRGWWWIWLWQRWLW 476 Score = 22.6 bits (43), Expect(2) = 1.5 Identities = 7/19 (36%), Positives = 8/19 (42%) Frame = +2 / +3 Query: 1490 WQHDGCTWWRRFTSWFRCW 1546 WQ WW R W + W Sbjct: 291 WQWRWWRWWLRRWWWRQLW 347
>LOC_Os06g40704:12006.t04931:unspliced-genomic ZAC, putative, expressed| Length = 3604 Score = 39.1 bits (79), Expect(2) = 0.059 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +3 / +1 Query: 1119 KVKTKVIDDNLNPEWNETFELIVEDK 1196 K KTKVI NLNP WNE L V K Sbjct: 2746 KAKTKVIKSNLNPVWNEVLTLSVPQK 2823 Score = 24.4 bits (47), Expect(2) = 0.059 Identities = 7/16 (43%), Positives = 7/16 (43%) Frame = +2 / +1 Query: 1571 GCWARGLRAWCWRWSG 1618 GC W W WSG Sbjct: 3190 GCRMWSAERWTWSWSG 3237
>LOC_Os03g07120:12003.t00578:unspliced-genomic expressed protein| Length = 4833 Score = 30.9 bits (61), Expect(2) = 0.069 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 / +1 Query: 1388 GHVSSIYQGRTTGSPGVRKESNRGEKAAEGGWG 1486 G V +++ G GVR++ RGE+ GG G Sbjct: 1390 GVVGAVHHRAVQGDDGVRQDRGRGEEHVRGGEG 1488 Score = 26.3 bits (51), Expect(2) = 0.069 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = +2 / +3 Query: 1571 GCWARGLRAWCWRWSG 1618 G W +W WRW G Sbjct: 1578 GSWRPACGSWRWRWPG 1625
>LOC_Os07g48910:12007.t04519:unspliced-genomic collagen-like protein 2, putative, expressed| Length = 1705 Score = 34.5 bits (69), Expect(2) = 0.074 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 / +1 Query: 1544 WICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQR 1648 W C WR W R + W RW R W RR +R Sbjct: 913 WRCWWWRWSRRWFRRRQRWRLRWWWRRWRRRRCRR 1017 Score = 22.6 bits (43), Expect(2) = 0.074 Identities = 9/30 (30%), Positives = 11/30 (36%) Frame = +2 / +1 Query: 1478 GWGNWQHDGCTWWRRFTSWFRCWICGHWRC 1567 GW + + C W W R WRC Sbjct: 832 GWWSGRRCRCRGWPWRWRWCRWRGRNRWRC 921 Score = 34.1 bits (68), Expect(2) = 0.13 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +2 / +1 Query: 1583 RGLRAWCWRWSGRFWYWRRGQRPW*SW 1663 R R C RWS R++ WRR R W W Sbjct: 583 RWSRRRCRRWSWRWFRWRRRSRRWCWW 663 Score = 22.1 bits (42), Expect(2) = 0.13 Identities = 11/32 (34%), Positives = 11/32 (34%) Frame = +2 / +1 Query: 1514 WRRFTSWFRCWICGHWRCRGCWARGLRAWCWR 1609 W R RCW R W R R W R Sbjct: 502 WSRRRRRCRCWWWSGSGRRCWWRRWSRRWSRR 597 Score = 29.9 bits (59), Expect(2) = 0.24 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 / +1 Query: 1559 WRCRGCWARGLRAWCWRWSGRFWYWR 1636 WR R W R R C RW R WR Sbjct: 967 WRLRWWWRRWRRRRCRRWLRRRQGWR 1044 Score = 28.6 bits (56), Expect(2) = 0.24 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 / +1 Query: 1607 RWSGRFWYWRRGQRPW 1654 R GR++ WRR +RPW Sbjct: 1147 RRQGRWFRWRRRRRPW 1194 Score = 26.7 bits (52), Expect(2) = 0.24 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +2 / +1 Query: 1490 WQHDGCTWWRRFTSWFRCWICGHWRCRGCWARGLRAWCWR 1609 W W+RR W W WR R C R WR Sbjct: 925 WWRWSRRWFRRRQRWRLRWWWRRWRRRRCRRWLRRRQGWR 1044 Score = 25.4 bits (49), Expect(2) = 0.24 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 / +1 Query: 1505 CTWWRRFTSWFR 1540 C WWR WFR Sbjct: 919 CWWWRWSRRWFR 954 Score = 34.5 bits (69), Expect(2) = 0.80 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 / +1 Query: 1583 RGLRAWCWRWSGRFWYWRRGQRPW 1654 R R W W SGR +WRR R W Sbjct: 517 RRCRCWWWSGSGRRCWWRRWSRRW 588 Score = 24.0 bits (46), Expect(2) = 0.80 Identities = 10/32 (31%), Positives = 11/32 (34%) Frame = +2 / +1 Query: 1475 GGWGNWQHDGCTWWRRFTSWFRCWICGHWRCR 1570 G W W+ W W R W WR R Sbjct: 265 GRWWIWRGRWWWSWPWRRHWRRVWWWERWRLR 360 Score = 34.1 bits (68), Expect = 3.5 Identities = 16/48 (33%), Positives = 19/48 (39%) Frame = +2 / +1 Query: 1505 CTWWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQR 1648 C WW R W CR R W WRWS R++ R+ R Sbjct: 829 CGWWSGRRCRCRGWPWRWRWCRWRGRNRWRCWWWRWSRRWFRRRQRWR 972 Score = 27.2 bits (53), Expect(2) = 4.8 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 / +1 Query: 1520 RFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWR 1636 R W W WR R W W RW R WR Sbjct: 856 RCRGWPWRWRWCRWRGRNRWRCWWWRWSRRWFRRRQRWR 972 Score = 26.7 bits (52), Expect(2) = 4.8 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 / +1 Query: 1592 RAWCWRWSGRFWYWRRGQRPW 1654 R W WRW W R R W Sbjct: 862 RGWPWRWRWCRWRGRNRWRCW 924 Score = 24.0 bits (46), Expect(2) = 4.8 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = +2 / +1 Query: 1577 WARGLRAWCW 1606 W R R WCW Sbjct: 745 WRRWSRRWCW 774 Score = 23.5 bits (45), Expect(2) = 4.8 Identities = 7/22 (31%), Positives = 8/22 (36%) Frame = +2 / +1 Query: 1481 WGNWQHDGCTWWRRFTSWFRCW 1546 W W W R+ W R W Sbjct: 703 WRRWSRRRSRRWCRWRRWSRRW 768 Score = 26.7 bits (52), Expect(2) = 6.4 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +2 / +1 Query: 1604 WRWSGRFWYWRRGQRPW*SW 1663 WRW R +WR+ RP W Sbjct: 394 WRWRWRRVWWRKRWRPRWWW 453 Score = 23.5 bits (45), Expect(2) = 6.4 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +2 / +1 Query: 1589 LRAWCWRW 1612 LR WCW W Sbjct: 355 LRWWCWCW 378
>LOC_Os10g31440:12010.t02468:unspliced-genomic lipoprotein, putative, expressed| Length = 1037 Score = 39.6 bits (80), Expect = 0.078 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +2 / +2 Query: 1535 FRCWICGHWRCRGCWARGLRAWCWRWSGR 1621 +R W WR RG + G+R W W WSGR Sbjct: 140 WR*WRGRWWRVRGWFWMGIRLWLWVWSGR 226
>LOC_Os10g17950:12010.t01351:unspliced-genomic protein kinase, putative| Length = 6088 Score = 39.6 bits (80), Expect = 0.078 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +2 / -1 Query: 1514 WRRFTSWFRCWICGHWRCRGCWARGLRAWCWR 1609 W R+ S + W+CG RGC R R WC R Sbjct: 226 WSRWRSRW*YWVCGRSAWRGCCGRWCRRWCSR 131
>LOC_Os12g06150:12012.t00501:unspliced-genomic plant-specific domain TIGR01568 family protein, expressed| Length = 1379 Score = 29.5 bits (58), Expect(4) = 0.081 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 / -2 Query: 1625 WYWRRGQRPW*SWEVHGED 1681 W+WRR W SW GED Sbjct: 625 WWWRRWWWWWPSWPHRGED 569 Score = 25.4 bits (49), Expect(4) = 0.081 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 / -1 Query: 1511 WWRRFTSWFRCWICGHWRC 1567 W RR W CW C RC Sbjct: 1049 WRRR*HWWRHCWWCWCSRC 993 Score = 22.1 bits (42), Expect(4) = 0.081 Identities = 5/12 (41%), Positives = 7/12 (58%) Frame = +2 / -1 Query: 1598 WCWRWSGRFWYW 1633 W W R+W+W Sbjct: 977 WWWWLRRRWWWW 942 Score = 22.1 bits (42), Expect(4) = 0.081 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 / -3 Query: 1701 ISRKSGSSSTVPQPDQPSA 1757 + S SSS+ P+ QPSA Sbjct: 450 VENLSSSSSSSPEKAQPSA 394
>LOC_Os03g14349:12003.t01225:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 4360 Score = 31.8 bits (63), Expect(2) = 0.094 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 / +3 Query: 1547 ICGHWRCRGCWARGLRAWCWRWS 1615 +C RCR C R R WC WS Sbjct: 3 VCAWSRCRCCCWRRWRRWCATWS 71 Score = 24.9 bits (48), Expect(2) = 0.094 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 / +3 Query: 1601 CWRWSGRFWYWRRGQR 1648 CWRW R W R Q+ Sbjct: 75 CWRWCTRSWSRCREQQ 122 Score = 34.1 bits (68), Expect = 3.5 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = +2 / +3 Query: 1490 WQHDGCTWWRRFTSWFRCWICGHWRCRGCWAR 1585 W C WRR+ W W C C W+R Sbjct: 12 WSRCRCCCWRRWRRWCATWSCCWRWCTRSWSR 107
>LOC_Os02g35660:12002.t03204:unspliced-genomic helix-loop-helix DNA-binding domain containing protein, expressed| Length = 4351 Score = 32.7 bits (65), Expect(2) = 0.094 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 / +1 Query: 1562 RCRGCWARGLRAWCWRWSGRFWYWRRGQRP 1651 RC C ARG + WRW R+ + R RP Sbjct: 3895 RCSTCRARGSASCRWRWRRRYRHRRGRPRP 3984 Score = 24.0 bits (46), Expect(2) = 0.094 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 / +2 Query: 1415 RTTGSPGVRKESNRGEKAAEGG 1480 R+ G+PG R+ G A+GG Sbjct: 3815 RSAGAPGRRRHVRAGGGEADGG 3880
>LOC_Os01g69020:12001.t06256:unspliced-genomic fibroin heavy chain precursor, putative, expressed| Length = 1375 Score = 28.1 bits (55), Expect(3) = 0.10 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 / +2 Query: 1583 RGLRAWCWRWSGRFWYWRRGQR 1648 R R WCW W R+ RR +R Sbjct: 875 RRRRRWCWCWCWRWCGSRRSRR 940 Score = 27.2 bits (53), Expect(3) = 0.10 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 / +2 Query: 1532 WFRCWICGHWRCRGCWARGLRAWCWR 1609 W R W RC G R WCWR Sbjct: 476 WRRRWRWCWRRCEGRCWRRRWRWCWR 553 Score = 25.4 bits (49), Expect(3) = 0.10 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 / +1 Query: 752 YRCSCCISTVRRDS 793 +RC CC +T RR S Sbjct: 142 WRCFCCSATTRRPS 183 Score = 29.5 bits (58), Expect(2) = 0.82 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 / +2 Query: 1598 WCWRWSGRFWYWRRGQRPW 1654 WCWRW R + R +R W Sbjct: 266 WCWRWRWRRRWHRS*RRRW 322 Score = 24.0 bits (46), Expect(2) = 0.82 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 / +1 Query: 1538 RCWICGHWRCRGCWA 1582 RCW WRC C A Sbjct: 121 RCWAWRCWRCFCCSA 165 Score = 26.7 bits (52), Expect(2) = 2.7 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 / +2 Query: 1598 WCWRWSG 1618 WCWRW G Sbjct: 902 WCWRWCG 922 Score = 24.9 bits (48), Expect(2) = 2.7 Identities = 10/33 (30%), Positives = 11/33 (33%) Frame = +2 / +2 Query: 1514 WRRFTSWFRCWICGHWRCRGCWARGLRAWCWRW 1612 W W W RC+ R WCW W Sbjct: 812 WCGSRRWSSRWHRS*RRCQRRRRRRRWCWCWCW 910
>LOC_Os07g09840:12007.t00858:unspliced-genomic hypothetical protein| Length = 1203 Score = 39.1 bits (79), Expect = 0.11 Identities = 20/49 (40%), Positives = 23/49 (46%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW*SW 1663 RR+ S +R W G WRC ARG R GR WRR + SW Sbjct: 1004 RRWRSRWRWWETGGWRCGRGGARGRCGCTTRGRGRARRWRRWRSAAASW 1150
>LOC_Os03g14620:12003.t01251:unspliced-genomic expressed protein| Length = 1470 Score = 39.1 bits (79), Expect = 0.11 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 / +3 Query: 1511 WWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRR 1639 W RR SW R WR G W R L W R + W+ RR Sbjct: 1044 WHRRHGSWGRRLCWRRWRRHGSWGRWLHWWR*RHRRQRWWHRR 1172 Score = 30.4 bits (60), Expect(2) = 1.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 / +3 Query: 1562 RCRGCWARGLRAWCWRWSGRFWYWRRGQRPW*SW 1663 R G W R L WR R +W R R W W Sbjct: 1293 RRHGSWGRRLCWRRWRRHRRRGWWHRRHRSWGRW 1394 Score = 22.6 bits (43), Expect(2) = 1.1 Identities = 7/24 (29%), Positives = 10/24 (41%) Frame = +2 / +3 Query: 1481 WGNWQHDGCTWWRRFTSWFRCWIC 1552 W +H WW R + W+C Sbjct: 1128 WWR*RHRRQRWWHRRHGSWGRWLC 1199 Score = 35.0 bits (70), Expect(2) = 1.3 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +2 / +3 Query: 1562 RCRGCWARGLRAWCWRWSGRFWYWRRGQRPW*SW 1663 R G W R L WR R+W+W R W W Sbjct: 1167 RRHGSWGRWLCWRRWRRHRRWWWWHRRHGSWGRW 1268 Score = 33.6 bits (67), Expect(2) = 1.3 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 / +3 Query: 1511 WWRRFTSWFRCWICGHWRCRGCWARGLRAW 1600 W RR SW R WR G W R L W Sbjct: 822 WHRRHGSWGRRLCWRRWRRHGSWGRWLHWW 911 Score = 24.0 bits (46), Expect(2) = 1.3 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +2 / +3 Query: 1577 WARGLRAWCWRWSGRFWYWRR 1639 W R L W R R+W+ RR Sbjct: 1383 WGRWLHWWR*RHRRRWWWHRR 1445 Score = 22.6 bits (43), Expect(2) = 1.3 Identities = 9/23 (39%), Positives = 9/23 (39%) Frame = +2 / +3 Query: 1511 WWRRFTSWFRCWICGHWRCRGCW 1579 W RR SW R WR W Sbjct: 747 WHRRHGSWGRWLCWRRWRRHRRW 815
>LOC_Os02g24100:12002.t02108:unspliced-genomic hypothetical protein| Length = 609 Score = 39.1 bits (79), Expect = 0.11 Identities = 19/67 (28%), Positives = 25/67 (37%) Frame = +2 / +2 Query: 1439 RKESNRGEKAAEGGWGNWQHDGCTWWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSG 1618 R+ + R + A GW TW RR + W G R W+R + W S Sbjct: 122 RRRTGRVQWGAGSGWRGRSASAATWRRRASGGGEVWEHGSRRVTANWSRAAGSGWWSRSA 301 Query: 1619 RFWYWRR 1639 WRR Sbjct: 302 SAATWRR 322
>LOC_Os01g70060:12001.t06308:unspliced-genomic expressed protein| Length = 13788 Score = 29.0 bits (57), Expect(2) = 0.12 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 / -2 Query: 1604 WRWSGRFWYWRRGQRPW 1654 WRW GR W RG W Sbjct: 12956 WRWRGRCRLWWRGMLRW 12906 Score = 27.2 bits (53), Expect(2) = 0.12 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +2 / -2 Query: 1505 CTWWRRFTSWFRCW 1546 C WWR W R W Sbjct: 12995 CRWWRGDWRWIRSW 12954
>LOC_Os03g64330:12003.t05643:unspliced-genomic aquaporin PIP2.8, putative, expressed| Length = 1099 Score = 35.4 bits (71), Expect(2) = 0.12 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 / +3 Query: 1505 CTWWRRFTSWFRCWIC 1552 C WRRF S +RCW+C Sbjct: 657 CRCWRRFPSGWRCWLC 704 Score = 25.4 bits (49), Expect(2) = 0.12 Identities = 8/23 (34%), Positives = 10/23 (43%) Frame = +2 / +3 Query: 698 C*CSSCITAYSAQGSPGLYRCSC 766 C C+ C + G PG C C Sbjct: 597 CWCTRCSRRRTRSGRPGTLTCRC 665
>LOC_Os06g32750:12006.t02972:unspliced-genomic conserved hypothetical protein| Length = 495 Score = 36.3 bits (73), Expect(2) = 0.14 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +2 / +1 Query: 1592 RAWCWRWSGRFWYWRRGQRPW 1654 R W WRW GR + +RGQR W Sbjct: 406 RRWRWRWRGRRRWRQRGQRRW 468 Score = 23.1 bits (44), Expect(2) = 0.14 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +2 / +3 Query: 1433 GVRKESNRGEKAAEGGWGNWQHDGCTWWRRFTSWFRCWICGHWRCRG 1573 G R RG + G W G RR W R WR RG Sbjct: 126 GGRGSRRRGGQGRGGRGSRWTDGGEDDRRRGRRWRRRRRGRRWRQRG 266
>LOC_Os04g59020:12004.t05361:unspliced-genomic integral membrane protein, expressed| Length = 1048 Score = 30.9 bits (61), Expect(2) = 0.14 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +2 / +1 Query: 1511 WWRRFTSWFRCWICGHWRCRGCWARGLRAW 1600 W R+ W RCW G GC +R W Sbjct: 445 WRSRWAPWCRCWRPGSSSTTGCGSRWWWRW 534 Score = 25.4 bits (49), Expect(2) = 0.14 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 / +1 Query: 1604 WRWSGRFWYWRR 1639 W W R W WRR Sbjct: 520 WWWRWRAWRWRR 555
>LOC_Os10g42870:12010.t03511:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 3057 Score = 38.6 bits (78), Expect = 0.15 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 / +2 Query: 1529 SWFRCWICGHWRCRGCWARG 1588 +W CW C WR R CW RG Sbjct: 2453 AWGGCWRCRRWRWRPCWRRG 2512
>LOC_Os12g29160:12012.t02626:unspliced-genomic fibroin heavy chain precursor, putative| Length = 4576 Score = 28.6 bits (56), Expect(2) = 0.17 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +2 / +1 Query: 1574 CWARGLRAWCWRWSGRFWYWRRGQR 1648 CW+ R WCW +++ RG R Sbjct: 3268 CWSHIGRCWCWSGCRCWFFANRGWR 3342 Score = 27.2 bits (53), Expect(2) = 0.17 Identities = 9/23 (39%), Positives = 9/23 (39%) Frame = +2 / +1 Query: 1532 WFRCWICGHWRCRGCWARGLRAW 1600 W W WRC W G R W Sbjct: 3130 WNPLWWRCAWRCTRWWWSGCRCW 3198 Score = 28.1 bits (55), Expect(2) = 0.23 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 / +1 Query: 1598 WCWRWSGRFWYW 1633 WCW GR W W Sbjct: 3718 WCWSHIGRCWCW 3753 Score = 27.2 bits (53), Expect(2) = 0.23 Identities = 9/29 (31%), Positives = 10/29 (34%) Frame = +2 / +1 Query: 1490 WQHDGCTWWRRFTSWFRCWICGHWRCRGC 1576 W +WW W W C W GC Sbjct: 3556 WFFISRSWWWNPLWWRCAWRCTRWCWSGC 3642 Score = 32.2 bits (64), Expect(2) = 0.32 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 / +1 Query: 1598 WCWRWSGRFWYWR 1636 W W W G +W+WR Sbjct: 4312 WFWWWCGTYWWWR 4350 Score = 29.0 bits (57), Expect(2) = 0.32 Identities = 11/34 (32%), Positives = 11/34 (32%) Frame = +2 / +1 Query: 1505 CTWWRRFTSWFRCWICGHWRCRGCWARGLRAWCW 1606 CTW W C W CW R W W Sbjct: 3697 CTWRCT*WCWSHIGRCWCWSGCRCWLFANRGWRW 3798 Score = 28.6 bits (56), Expect(2) = 6.2 Identities = 11/34 (32%), Positives = 11/34 (32%) Frame = +2 / +1 Query: 1505 CTWWRRFTSWFRCWICGHWRCRGCWARGLRAWCW 1606 CTW W C W CW R W W Sbjct: 3244 CTWRCT*WCWSHIGRCWCWSGCRCWFFANRGWRW 3345 Score = 28.1 bits (55), Expect(2) = 6.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 / +1 Query: 1598 WCWRWSGRFWYWRR 1639 W WRW +W+W R Sbjct: 4339 WWWRWYCLWWWW*R 4380
>LOC_Os09g38040:12009.t03278:unspliced-genomic nudix hydrolase 23, chloroplast precursor, putative, expressed| Length = 3169 Score = 32.2 bits (64), Expect(2) = 0.17 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 / -2 Query: 1553 GHWRCRGCWARGLRAWCWRWSGRFWYW 1633 G WR R W RG R W W R +W Sbjct: 177 GGWRRRRRWRRGERRAAWWWRWRRRWW 97 Score = 23.5 bits (45), Expect(2) = 0.17 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 / -3 Query: 1663 GSSWGGL*QGTWAYLVRVV 1719 G GG+*+G W + + VV Sbjct: 113 GGGGGGI*RGAWRWWILVV 57
>LOC_Os01g08470:12001.t00725:unspliced-genomic protein binding protein, putative, expressed| Length = 2275 Score = 29.9 bits (59), Expect(2) = 0.18 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 / -2 Query: 1559 WRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW 1654 WR R W R C RW + WRR +R W Sbjct: 1377 WRWRWRWW*RRRR*CRRWRWGWRRWRRRRR*W 1282 Score = 25.8 bits (50), Expect(2) = 0.18 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 / -2 Query: 1490 WQHDGCTWWRRFTSWFRCW 1546 W D C WRR+ W W Sbjct: 1413 WVEDWCRRWRRWWRWRWRW 1357 Score = 27.2 bits (53), Expect(2) = 0.79 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 / -2 Query: 1604 WRWSGRFWYWRRGQRPW*SWEVHGED 1681 WRW R W RR W W G D Sbjct: 1326 WRWGWRRWRRRRR*WWWRRWWRQGRD 1249 Score = 26.3 bits (51), Expect(2) = 0.79 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = +2 / -2 Query: 1511 WWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRW 1612 WW R +R + W R R + WC RW Sbjct: 1488 WWWRQLRTWRMRLWRGWWRRRRRLRWVEDWCRRW 1387
>LOC_Os11g44400:12011.t03968:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 10149 Score = 35.9 bits (72), Expect(2) = 0.20 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +1 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 6283 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 6381 Score = 27.2 bits (53), Expect(2) = 0.20 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 / +1 Query: 468 KLWPFVSQAATAVVKESVEPLL 533 K W V++ AVVK ++EP L Sbjct: 226 KKWSLVNKKCLAVVKNTIEPTL 291
>LOC_Os10g38060:12010.t03060:unspliced-genomic phospholipase D beta 1, putative, expressed| Length = 9066 Score = 38.2 bits (77), Expect = 0.20 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +3 / +3 Query: 1023 LSVTVVKAISLKNKELIGKSDPYVTLYVRPMFKVKTKVIDDNLNPEWNETF 1175 L ++ A+ K SDPYVT+ V +T V+ +N NP W + F Sbjct: 1185 LGPRLIGAVGSKMSSANMTSDPYVTIQVSYATVARTYVVPNNENPVWTQNF 1337
>LOC_Os07g49330:12007.t04561:unspliced-genomic phosphoinositide-specific phospholipase C, putative, expressed| Length = 3157 Score = 38.2 bits (77), Expect = 0.20 Identities = 18/59 (30%), Positives = 31/59 (52%) Frame = +3 / +2 Query: 1125 KTKVIDDNLNPEWNETFELIVEDKETQSVIFEVYDEDNLQQDKRLGVAKLAVNNIVPEI 1301 +T+ I+DN P W E F + E + EV++ D ++D G L V++++P I Sbjct: 2639 RTRAIEDNWVPVWEEDFTFKLTVPEIALLRVEVHEYDMSEKDDFGGQTVLPVSDLIPGI 2815
>LOC_Os08g05420:12008.t00436:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5377 Score = 38.2 bits (77), Expect = 0.20 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 / +1 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG+++W WS Sbjct: 2476 RRSINWTRCWRTTELRCTQVASRGIKSWIPLWS 2574
>LOC_Os03g50130:12003.t04357:unspliced-genomic microsomal glutathione S-transferase 3, putative, expressed| Length = 1982 Score = 38.2 bits (77), Expect = 0.20 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 / +3 Query: 1559 WRCRGCWARGLRAWCWRWS 1615 WRCR R WCWRWS Sbjct: 111 WRCRSS*PRNTGTWCWRWS 167
>LOC_Os01g43950:12001.t03907:unspliced-genomic expressed protein| Length = 1111 Score = 38.2 bits (77), Expect = 0.20 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 / +1 Query: 1538 RCWICGHWRCRGCWARGLRAWCW 1606 R W WRC G W RG R W W Sbjct: 499 R*WWMRRWRCCGSWCRGARRWRW 567
>LOC_Os12g41390:12012.t03815:unspliced-genomic homocysteine S-methyltransferase 3, putative, expressed| Length = 3866 Score = 37.3 bits (75), Expect(2) = 0.21 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 / -1 Query: 1589 LRAWCWRWSGRFWYWRRGQRPW 1654 LRAW W W W +RRG+R W Sbjct: 122 LRAWIWIWICARWIYRRGRRIW 57 Score = 24.4 bits (47), Expect(2) = 0.21 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 / -2 Query: 103 QPPTASINPPTARKPR 150 QPP A ++PP R+ R Sbjct: 253 QPPAAGLHPPPHRRRR 206
>LOC_Os03g26750:12003.t02357:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6564 Score = 30.9 bits (61), Expect(2) = 0.22 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 / -2 Query: 1574 CWARGLRAWCWRWSGRFW 1627 C R LR W WRWS W Sbjct: 2405 CEFRMLRGWWWRWSIMLW 2352 Score = 24.4 bits (47), Expect(2) = 0.22 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = +2 / -2 Query: 1622 FWYWRRGQR 1648 +W+WRRG+R Sbjct: 2267 WWWWRRGRR 2241
>LOC_Os07g26390:12007.t02335:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4524 Score = 30.9 bits (61), Expect(2) = 0.23 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 / -1 Query: 1574 CWARGLRAWCWRWSGRFW 1627 C R LR W WRWS W Sbjct: 252 CEFRMLRGWWWRWSIMLW 199 Score = 24.4 bits (47), Expect(2) = 0.23 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = +2 / -1 Query: 1622 FWYWRRGQR 1648 +W+WRRG+R Sbjct: 114 WWWWRRGRR 88
>LOC_Os08g23120:12008.t02084:unspliced-genomic heterogeneous nuclear ribonucleoprotein A3, putative, expressed| Length = 4236 Score = 30.9 bits (61), Expect(2) = 0.23 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +2 / +1 Query: 1592 RAWCWRWSGRFWYWRRGQRPW*SW 1663 R+WCW W W +R W* W Sbjct: 3697 RSWCWCWLWHGWTLWC*RRLW*QW 3768 Score = 24.4 bits (47), Expect(2) = 0.23 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +2 / +1 Query: 1511 WWRRFTSWFRCW 1546 WW R+ W CW Sbjct: 3616 WWFRWCIWA*CW 3651
>LOC_Os12g37100:12012.t03390:unspliced-genomic expressed protein| Length = 3701 Score = 32.7 bits (65), Expect(2) = 0.23 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 / +1 Query: 1529 SWFRCWICGHWRCRGCWAR 1585 SW RC G W CRG W R Sbjct: 448 SWARCGGAGRWCCRGGWWR 504 Score = 22.6 bits (43), Expect(2) = 0.23 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 / +1 Query: 1580 ARGLRAWCWRW 1612 AR R+WC RW Sbjct: 523 ARCRRSWCARW 555
>LOC_Os06g10870:12006.t00964:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 858 Score = 30.9 bits (61), Expect(2) = 0.23 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 / +3 Query: 1559 WRCRGCWARGLRAWCWRWSGRFWYW 1633 W C G W+R W + S R W+W Sbjct: 735 WICSGRWSRWWWRWWAKRSRR*WFW 809 Score = 28.6 bits (56), Expect(2) = 0.23 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 / +3 Query: 1490 WQHDGCTWWRRFTSWFRCW 1546 W G WWRR WF W Sbjct: 210 WGWWGWRWWRRTKWWFWIW 266 Score = 29.5 bits (58), Expect(2) = 0.62 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +2 / +3 Query: 1547 ICGHWRCRGCWARGLRAWCWRWSGRFWY 1630 IC WR R W R + W W G +++ Sbjct: 594 ICSRWRPRWRWWRWTKWWIWSGLGVWFW 677 Score = 24.4 bits (47), Expect(2) = 0.62 Identities = 7/17 (41%), Positives = 8/17 (47%) Frame = +2 / +3 Query: 1511 WWRRFTSWFRCWICGHW 1561 WW R FR W+ W Sbjct: 501 WWFRIWFRFRFWLWSSW 551
>LOC_Os03g47470:12003.t04106:unspliced-genomic ATP binding protein, putative| Length = 1605 Score = 25.8 bits (50), Expect(3) = 0.24 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 / +2 Query: 1553 GHWRCRGCW 1579 G WRCRG W Sbjct: 1361 GAWRCRGTW 1387 Score = 22.6 bits (43), Expect(3) = 0.24 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 / +3 Query: 1454 RGEKAAEGGWGNW 1492 R AAE GW W Sbjct: 1281 RARTAAEAGWQRW 1319 Score = 22.6 bits (43), Expect(3) = 0.24 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 / +2 Query: 1571 GCWARGLRAWCWRWSGRF 1624 G W RG R+ RW R+ Sbjct: 1466 GSWRRGCRS*ARRWRRRW 1519
>LOC_Os09g37100:12009.t03185:unspliced-genomic phospholipase D delta, putative, expressed| Length = 6176 Score = 37.7 bits (76), Expect = 0.28 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +3 / +3 Query: 1080 SDPYVTLYVRPMFKVKTKVIDDNLNPEWNETF 1175 SDPYVTL V +T+VI ++ +P W+E F Sbjct: 537 SDPYVTLSVAGAVVARTRVIPNDQDPVWDERF 632
>LOC_Os10g28230:12010.t02177:unspliced-genomic histone H2A variant 2, putative, expressed| Length = 1375 Score = 37.7 bits (76), Expect = 0.28 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = -2 / +3 Query: 1638 RRQYQNLPDQRQHQALSPRAQHPRQRQCPQIQHLNQLVKRRHQVHP 1501 RRQ Q P H P A+HPR R + +RRH HP Sbjct: 825 RRQRQQGPQGEAHHPAPPAARHPRGRGARHPHQGHHSRRRRHPAHP 962
>LOC_Os08g33120:12008.t03055:unspliced-genomic THO complex subunit 4, putative, expressed| Length = 4783 Score = 37.7 bits (76), Expect = 0.28 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +2 / +3 Query: 1478 GWGNWQHDGCTWWRRFTSWFRCWICGHWRCRGCWAR 1585 G G W WWR + W+ WIC W+ R +R Sbjct: 411 G*G*WWWPCSRWWRWWRWWWERWICAAWKIRDASSR 518
>LOC_Os07g10250:12007.t00899:unspliced-genomic ATP-dependent RNA helicase DED1, putative, expressed| Length = 6296 Score = 37.7 bits (76), Expect = 0.28 Identities = 15/50 (30%), Positives = 18/50 (36%) Frame = +2 / +2 Query: 1505 CTWWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW 1654 C WW W W R ++ GL W RW +W W PW Sbjct: 704 CGWWPSLGGHCEWWWWWWWWERRWFSPGLWCWWPRWRRWWWRWCMELPPW 853 Score = 27.6 bits (54), Expect(2) = 4.3 Identities = 9/25 (36%), Positives = 10/25 (40%) Frame = +2 / +2 Query: 1574 CWARGLRAWCWRWSGRFWYWRRGQR 1648 CW R W WRW W G + Sbjct: 794 CWWPRWRRWWWRWCMELPPWGLGPK 868 Score = 23.1 bits (44), Expect(2) = 4.3 Identities = 8/23 (34%), Positives = 9/23 (39%) Frame = +2 / +2 Query: 1478 GWGNWQHDGCTWWRRFTSWFRCW 1546 GW C WW + W R W Sbjct: 707 GWWPSLGGHCEWWWWWWWWERRW 775
>LOC_Os04g35739:12004.t03244:unspliced-genomic glycine-rich protein, putative| Length = 603 Score = 37.7 bits (76), Expect = 0.28 Identities = 18/47 (38%), Positives = 20/47 (42%) Frame = +2 / +3 Query: 1511 WWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRP 1651 WWRR +R W WR R W R RW R +WRR P Sbjct: 360 WWRRRRWRWRRWRRRRWRWRWRWRWRRRWRWRRWWRRAVWWRRVDAP 500
>LOC_Os02g48100:12002.t04394:unspliced-genomic ATP-dependent DNA helicase recG, putative, expressed| Length = 3581 Score = 37.7 bits (76), Expect = 0.28 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 / -3 Query: 1481 WGNWQHDGCTWWRRFTSWFRCWICG 1555 WGN DGC W+R ++W C++ G Sbjct: 1002 WGN*MRDGCDWFR**STWRSCYVLG 928
>LOC_Os02g28630:12002.t02557:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3926 Score = 35.9 bits (72), Expect(2) = 0.28 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 1025 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 1123 Score = 25.4 bits (49), Expect(2) = 0.28 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 / +3 Query: 1439 RKESNRGEKAAEGGWGNWQHDGC 1507 R RGEKAA G G +H C Sbjct: 222 RARFRRGEKAARVGNGGGRHGEC 290
>LOC_Os01g24030:12001.t02126:unspliced-genomic AMP binding protein, putative, expressed| Length = 2197 Score = 31.3 bits (62), Expect(2) = 0.31 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 / +2 Query: 1466 AAEGGWGNWQHDGCTWWRRFTSWFRCWICGHWRC 1567 AA G W+ WWRR R C WRC Sbjct: 1799 AARGCRDTWRRGRWWWWRRSFRRRRRGRCRRWRC 1900 Score = 29.0 bits (57), Expect(2) = 0.31 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +2 / +2 Query: 719 TAYSAQGSPGLYRCSCCISTVRRDSLHLCFCCCSPRR 829 +A S + S +R SCC + R S C SPR+ Sbjct: 500 SARSTRASTPPWRPSCCATPRPRSSSSTALCSASPRK 610
>LOC_Os12g40050:12012.t03684:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4999 Score = 29.9 bits (59), Expect(2) = 0.31 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 / +2 Query: 743 PGLYRCSCCISTVRRDSLHLCFC 811 PG + C+CC + + + H C C Sbjct: 3107 PGRFLCACCC*SSKHPACHFCCC 3175 Score = 24.9 bits (48), Expect(2) = 0.31 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 / +2 Query: 806 FCCCSPRR 829 FCCCSP R Sbjct: 3164 FCCCSPTR 3187
>LOC_Os04g58720:12004.t05333:unspliced-genomic phosphoribosylanthranilate transferase, putative, expressed| Length = 4299 Score = 27.6 bits (54), Expect(2) = 0.31 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 / +3 Query: 1023 LSVTVVKAISLKNKELIGKSDPYVTLYV 1106 L V VVKA L + ++ G DPYV + V Sbjct: 1740 LFVRVVKARDLPDMDVTGSLDPYVEVRV 1823 Score = 27.2 bits (53), Expect(2) = 0.31 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +3 / +3 Query: 1128 TKVIDDNLNPEWNETFELIVEDKETQSVIFEVYDEDNLQQD 1250 T+ + NPEWN F + + + V D+D L+ D Sbjct: 1842 TRHFEKQKNPEWNAVFAFSRDRMQATILEVVVKDKDLLKDD 1964
>LOC_Os07g31720:12007.t02859:unspliced-genomic ZAC, putative, expressed| Length = 2291 Score = 32.2 bits (64), Expect(2) = 0.32 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +3 / +1 Query: 1119 KVKTKVIDDNLNPEWNETFELIV 1187 KVKT V N NP WNE +L V Sbjct: 1381 KVKTSVQKKNSNPVWNEVLQLAV 1449 Score = 28.1 bits (55), Expect(2) = 0.32 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 / +2 Query: 1218 EVYDEDNLQQDKRLGVAKLAVNNI 1289 EV+DED D +GVA+ V +I Sbjct: 1634 EVFDEDKFTADDSMGVAEFNVTDI 1705
>LOC_Os12g38690:12012.t03549:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class, expressed| Length = 1614 Score = 37.3 bits (75), Expect = 0.38 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG+++W WS Sbjct: 701 RRPINWTRCWRTTELRCTQVASRGIKSWIPLWS 799
>LOC_Os08g18000:12008.t01670:unspliced-genomic F-box domain containing protein, expressed| Length = 17103 Score = 37.3 bits (75), Expect = 0.38 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / -1 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 11049 RRHINWTRCWRTTELRCTQVASRGTKSWIPLWS 10951
>LOC_Os08g04860:12008.t00380:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3233 Score = 37.3 bits (75), Expect = 0.38 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG+++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGIKSWIPLWS 502
>LOC_Os03g46910:12003.t04055:unspliced-genomic pyruvate kinase isozyme A, chloroplast precursor, putative, expressed| Length = 4097 Score = 37.3 bits (75), Expect = 0.38 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 / +1 Query: 1568 RGCWARGLRAWCWRWSGRFW 1627 RG W G R+WC RW R W Sbjct: 244 RGSWGSGRRSWCARWGPRAW 303
>LOC_Os01g72210:12001.t06509:unspliced-genomic HYP1, putative, expressed| Length = 4473 Score = 37.3 bits (75), Expect = 0.38 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 / +1 Query: 1559 WRCRGCWARGLRAWCWRW 1612 W RGCW R W WRW Sbjct: 55 WTRRGCWRRRRSTWAWRW 108
>LOC_Os01g64160:12001.t05784:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 37.3 bits (75), Expect = 0.38 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG+++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGIKSWIPLWS 502
>LOC_Os08g01054:12008.t00005:unspliced-genomic HUA2, putative, expressed| Length = 10090 Score = 28.1 bits (55), Expect(2) = 0.39 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +2 / -2 Query: 1478 GWGNWQHDGCTWWRRFTSWFRCWICGHWRCRGCWARGLRAW 1600 G W D WW R W R G WR W + W Sbjct: 6375 GRNRWGLDWQGWWGRLRRWARW*RWGWWRRWQRW*KWWWRW 6253 Score = 26.3 bits (51), Expect(2) = 0.39 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 / -2 Query: 1598 WCWRWSGRFWYWRRGQR 1648 W WRW W+ RR +R Sbjct: 6267 WWWRWRCSRWW*RRQRR 6217
>LOC_Os07g09510:12007.t00825:unspliced-genomic vegetative cell wall protein gp1 precursor, putative, expressed| Length = 4862 Score = 29.9 bits (59), Expect(2) = 0.41 Identities = 11/35 (31%), Positives = 14/35 (40%) Frame = +2 / -2 Query: 1475 GGWGNWQHDGCTWWRRFTSWFRCWICGHWRCRGCW 1579 G W W+ W RR+T +C RG W Sbjct: 3304 GSWIKWRRKHWWWTRRYTKGCHLHLCWR*SRRGWW 3200 Score = 24.4 bits (47), Expect(2) = 0.41 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = +2 / -2 Query: 1586 GLRAWCWRWSGRFWYWRRGQRPW*SWEVH 1672 G+ + +W W+W R ++ SW H Sbjct: 3190 GINSRSHKWWPCIWWWWRWRKSGNSWS*H 3104
>LOC_Os03g40830:12003.t03505:unspliced-genomic subtilisin-like protease precursor, putative, expressed| Length = 3184 Score = 30.9 bits (61), Expect(2) = 0.43 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 / +2 Query: 1598 WCWRWSGRFWYWRRGQRPW*SW 1663 W WRW W RRG+R +W Sbjct: 131 WRWRWRRWLWRRRRGRRTSSTW 196 Score = 23.5 bits (45), Expect(2) = 0.43 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 / +2 Query: 1502 GCTWWRRFTSWFR 1540 GC WWR W R Sbjct: 113 GCCWWRWRWRWRR 151 Score = 32.7 bits (65), Expect = 9.1 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 / +2 Query: 1598 WCWRWSGRFWYWRR 1639 W WRW R W WRR Sbjct: 125 WRWRWRWRRWLWRR 166
>LOC_Os03g12470:12003.t01046:unspliced-genomic OsWAK25 - OsWAK receptor-like protein kinase, expressed| Length = 4367 Score = 31.8 bits (63), Expect(3) = 0.43 Identities = 17/50 (34%), Positives = 21/50 (42%) Frame = +2 / +3 Query: 1421 TGSPGVRKESNRGEKAAEGGWGNWQHDGCTWWRRFTSWFRCWICGHWRCR 1570 TG+PG+ + S R G W + W R TSW R G R R Sbjct: 3843 TGTPGLSRPSTRWPSWRFGAWRSTAR*DLPWLRSPTSWNRFRSAGGRRPR 3992 Score = 25.4 bits (49), Expect(3) = 0.43 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 / +1 Query: 299 PRDAAAHQEARRQGCGYHG 355 PRD + HQ RR +HG Sbjct: 3103 PRDRSRHQRLRRGPAPWHG 3159 Score = 24.4 bits (47), Expect(3) = 0.43 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +2 / +2 Query: 107 HRQPQLTPPPLVNPDCSIESRAQVKR 184 H PQL PP P C++ + + R Sbjct: 383 HPAPQLLPPAQRVPGCALHRQLRAHR 460
>LOC_Os12g13860:12012.t01253:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1500 Score = 32.2 bits (64), Expect(2) = 0.45 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = +2 / +3 Query: 1511 WWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWR 1636 WW W R W R W R W RW R +W+ Sbjct: 1134 WWTGRW*WIRVWFRLR*RWWSVWCRLWARWWRRWWWRARWWK 1259 Score = 22.1 bits (42), Expect(2) = 0.45 Identities = 6/18 (33%), Positives = 8/18 (44%) Frame = +2 / +3 Query: 1481 WGNWQHDGCTWWRRFTSW 1534 WG + WWR + W Sbjct: 1065 WGLRRRRWSFWWRLWAGW 1118 Score = 29.0 bits (57), Expect(2) = 1.1 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 / +3 Query: 1589 LRAWCWRWSGRFWYWRRGQRPW*SW 1663 +R W W WSGR+ R+ W W Sbjct: 1275 IRVWFWIWSGRWSLRRKLWARWWWW 1349 Score = 24.0 bits (46), Expect(2) = 1.1 Identities = 8/22 (36%), Positives = 9/22 (40%) Frame = +2 / +3 Query: 1481 WGNWQHDGCTWWRRFTSWFRCW 1546 W W WWRR+ R W Sbjct: 1191 WSVWCRLWARWWRRWWWRARWW 1256
>LOC_Os10g31420:12010.t02467:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 934 Score = 31.8 bits (63), Expect(2) = 0.46 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 / +3 Query: 1598 WCWRWSGRFWYW 1633 W WRW G++W W Sbjct: 378 WWWRWWGKWWVW 413 Score = 22.6 bits (43), Expect(2) = 0.46 Identities = 8/22 (36%), Positives = 9/22 (40%) Frame = +2 / +3 Query: 1481 WGNWQHDGCTWWRRFTSWFRCW 1546 W W+ W F WFR W Sbjct: 255 WRWWRWTKRWIWVWFWIWFRLW 320 Score = 34.5 bits (69), Expect = 2.6 Identities = 16/58 (27%), Positives = 20/58 (34%) Frame = +2 / +3 Query: 1490 WQHDGCTWWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW*SW 1663 W+ WWR W W +R W + WC R R +W R W W Sbjct: 240 WRWWRWRWWRWTKRWIWVWFWIWFRLWSGWWIWVPWWCVRSRRRSRWWWRWWGKWWVW 413
>LOC_Os02g22130:12002.t02001:unspliced-genomic GTPase activating protein, putative, expressed| Length = 2966 Score = 36.8 bits (74), Expect = 0.52 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +3 / +2 Query: 1119 KVKTKVIDDNLNPEWNETFELIVED 1193 K+KT+VI NPEWN+ L +ED Sbjct: 761 KLKTRVIKKTTNPEWNDELTLSIED 835
>LOC_Os02g10480:12002.t00896:unspliced-genomic GTPase activating protein, putative, expressed| Length = 3410 Score = 36.8 bits (74), Expect = 0.52 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +3 / +2 Query: 1092 VTLYVRPMFKVKTKVIDDNLNPEWNETFELIV 1187 ++ Y+R + K +T VI NLNP WNE +L V Sbjct: 2501 ISPYLRCVQKAQTSVIKANLNPVWNEELKLSV 2596
>LOC_Os08g36340:12008.t03374:unspliced-genomic potassium transporter 4, putative, expressed| Length = 10963 Score = 36.8 bits (74), Expect = 0.52 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +2 / +2 Query: 1502 GCTWWRRFTSWFRCWICGHWRCRGCWA 1582 G WWRR+T+ C C W RGC A Sbjct: 2690 GTCWWRRWTARTGCRPCAGWGQRGCTA 2770
>LOC_Os07g29850:12007.t02675:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 9423 Score = 36.8 bits (74), Expect = 0.52 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWTTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os06g20980:12006.t01915:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 522 Score = 36.8 bits (74), Expect = 0.52 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 167 RRPINWIRCWRTTELRCTQVASRGTKSWIPLWS 265
>LOC_Os05g13940:12005.t01170:unspliced-genomic early nodulin 75 protein, putative, expressed| Length = 1900 Score = 36.8 bits (74), Expect = 0.52 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = +2 / -2 Query: 1511 WWRRFTSWFRCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW 1654 +W RF W W+ R R GLR W W W ++++R R W Sbjct: 1077 FWFRFWLWLWFWLGLRLRLRLRVWLGLRLWLWLWLWLWFWFRFWLRLW 934
>LOC_Os05g12740:12005.t01100:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 3065 Score = 36.8 bits (74), Expect = 0.52 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 / +2 Query: 1490 WQHDGCTWWRRFTSWFRCWICGHWRCRGCW 1579 W+ C WW RCW C WR R W Sbjct: 2861 WRWWCCWWWWEGKGRCRCWCCPWWRWRWGW 2950
>LOC_Os01g24540:12001.t02175:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3095 Score = 36.8 bits (74), Expect = 0.52 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 167 RRPINWIRCWRTTELRCTQVASRGTKSWIPLWS 265
>LOC_Os01g07830:12001.t00663:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 36.8 bits (74), Expect = 0.52 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRAINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os01g07070:12001.t00587:unspliced-genomic loricrin, putative, expressed| Length = 5483 Score = 36.8 bits (74), Expect = 0.52 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 / +1 Query: 1559 WRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW 1654 WR W RG R W W FW WR Q+ W Sbjct: 1195 WRV**IWWRGWRLQSWWWRF*FWRWRWLQQRW 1290 Score = 34.5 bits (69), Expect = 2.6 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +2 / +1 Query: 1478 GWGNWQHDGCTWWRRFTSWFRCWICGHWRC 1567 GW W +WW + W R W HW+C Sbjct: 1744 GWRPWCTSTLSWWWWWWWWRRRWRRIHWQC 1833 Score = 27.2 bits (53), Expect(2) = 7.8 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +2 / +1 Query: 1604 WRWSGRFWYWRRGQRPW*SW 1663 W W + WRR +R W* W Sbjct: 274 WWWRRIWRRWRRVRRRW*RW 333 Score = 22.6 bits (43), Expect(2) = 7.8 Identities = 7/16 (43%), Positives = 7/16 (43%) Frame = +2 / +1 Query: 1514 WRRFTSWFRCWICGHW 1561 WRR W CG W Sbjct: 220 WRRRRGRIWWWWCGRW 267 Score = 28.6 bits (56), Expect(2) = 9.7 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +2 / +1 Query: 1559 WRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW 1654 W +A G R WC +W+W +R W Sbjct: 1717 WVWWSAYAWGWRPWCTSTLSWWWWWWWWRRRW 1812 Score = 27.6 bits (54), Expect(2) = 9.7 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +2 / +1 Query: 1508 TWWRRFTSWFRCWICGHWRCRGCW 1579 +WW RF W W+ WR W Sbjct: 1237 SWWWRF*FWRWRWLQQRWRRLQLW 1308
>LOC_Os01g54714:12001.t04887:unspliced-genomic conserved hypothetical protein| Length = 5956 Score = 30.4 bits (60), Expect(2) = 0.55 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 / +1 Query: 1550 CGHWRCRGCWARGLRAWCWRW 1612 C R R CW R W W W Sbjct: 5212 CNRRRWRRCWTRPRSGWWWWW 5274 Score = 23.5 bits (45), Expect(2) = 0.55 Identities = 8/25 (32%), Positives = 11/25 (44%) Frame = +2 / +1 Query: 1490 WQHDGCTWWRRFTSWFRCWICGHWR 1564 W+ D WW + +R G WR Sbjct: 5134 WRFDSLWWWG*WRRRWRVLDLGWWR 5208
>LOC_Os06g06290:12006.t00515:unspliced-genomic alpha-L-fucosidase 2 precursor, putative, expressed| Length = 3627 Score = 28.1 bits (55), Expect(2) = 0.57 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 / -1 Query: 1565 CRGCWARGLRAWCWRWSGRFWYWRRGQR 1648 CR R R W RW W RRG+R Sbjct: 1398 CRSRSWRRCRRW*GRWGSSRWGARRGRR 1315 Score = 25.8 bits (50), Expect(2) = 0.57 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 / -1 Query: 1505 CTWWRRFTSWFRCWICGHWRCR 1570 CTW SW CG WR R Sbjct: 1488 CTWIGARRSWS*ADCCGWWRGR 1423
>LOC_Os07g49290:12007.t04557:unspliced-genomic DNA binding protein, putative, expressed| Length = 2695 Score = 28.6 bits (56), Expect(2) = 0.58 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 / -1 Query: 1562 RCRGCWARGLRAWCWR 1609 R G WA+G AW WR Sbjct: 226 RRSGAWAQGQGAWAWR 179 Score = 25.4 bits (49), Expect(2) = 0.58 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = +2 / -3 Query: 1487 NWQHDGCTWWRRFTSWFR 1540 +W D WW R+ W R Sbjct: 317 DWDWDWVGWWWRWMVWMR 264
>LOC_Os02g02700:12002.t00169:unspliced-genomic AMP binding protein, putative, expressed| Length = 2200 Score = 29.5 bits (58), Expect(2) = 0.59 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 / +1 Query: 1616 GRFWYWRRGQRPW*SWEVHGEDCDRA 1693 GR+W+WRRG R C RA Sbjct: 1894 GRWWWWRRGCRRRRRGRCRSSSCGRA 1971 Score = 24.4 bits (47), Expect(2) = 0.59 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 / +1 Query: 1466 AAEGGWGNWQHDGCTWWRR 1522 A G G W+ WWRR Sbjct: 1861 AGRGCRGTWRRGRWWWWRR 1917
>LOC_Os07g32060:12007.t02891:unspliced-genomic anthocyanidin 5,3-O-glucosyltransferase, putative, expressed| Length = 1848 Score = 28.1 bits (55), Expect(2) = 0.59 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 / +3 Query: 1490 WQHDGCTWWRRFTSWFRC 1543 W G TWWRR + RC Sbjct: 1329 WTGSGATWWRRRSWSARC 1382 Score = 25.8 bits (50), Expect(2) = 0.59 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 / +3 Query: 1562 RCRGCWARGLRAWCWRWSGRFWYWRRGQRPW 1654 RC W R R WR R RR PW Sbjct: 1377 RCGA*WTRDRRRGGWRGRRRRRRRRRAGTPW 1469
>LOC_Os06g21140:12006.t01931:unspliced-genomic glycine-rich cell wall structural protein precursor, putative,| expressed Length = 994 Score = 29.5 bits (58), Expect(2) = 0.62 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 / +3 Query: 1598 WCWRWSGRFWYWRR 1639 W WRW R ++WRR Sbjct: 645 WWWRWLWRRFWWRR 686 Score = 24.4 bits (47), Expect(2) = 0.62 Identities = 6/13 (46%), Positives = 7/13 (53%) Frame = +2 / +3 Query: 1511 WWRRFTSWFRCWI 1549 WW R W R W+ Sbjct: 576 WW*RLRRWIRRWL 614
>LOC_Os10g18380:12010.t01386:unspliced-genomic hypothetical protein| Length = 1040 Score = 30.4 bits (60), Expect(2) = 0.69 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 / +1 Query: 1598 WCWRWSGRFWYWRRGQR 1648 W WRW R W RR QR Sbjct: 418 WAWRWRHRRWRPRRRQR 468 Score = 27.6 bits (54), Expect(2) = 0.69 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +2 / +2 Query: 1547 ICGHWRCRGCWARGLRAWCWRWSGR 1621 +C C + L AWCW W R Sbjct: 215 VCQELCCSSWRKQDLVAWCWGWHQR 289
>LOC_Os11g40450:12011.t03586:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 12498 Score = 28.1 bits (55), Expect(2) = 0.70 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 / +2 Query: 1475 GGWGNWQHDGCTWWRRFTSWFR 1540 GG G W G WRR+ W+R Sbjct: 902 GGNGGWIGGGSGGWRRWKWWWR 967 Score = 25.4 bits (49), Expect(2) = 0.70 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 / +2 Query: 1598 WCWRWSGRFWYWRRGQRPW 1654 W RW +W W R PW Sbjct: 998 WWRRWFLCWWEWPRLGEPW 1054
>LOC_Os10g06140:12010.t00483:unspliced-genomic OsWAK105 - OsWAK receptor-like protein kinase, expressed| Length = 5254 Score = 36.3 bits (73), Expect = 0.71 Identities = 18/63 (28%), Positives = 26/63 (41%) Frame = -3 / +3 Query: 1742 RLGNSGAATTLTRYAQVPCHSPPHELPSFTKAAAHGANTRTYQTSASTKP*AHEPNTPGN 1563 R+G + AAT T + P SP P + A A+ TS P P+ PG Sbjct: 528 RMGTAVAATPTTADSSTPAASPTATTPGARRMAGAPASAAAMSTSRRASPTTSSPSGPGR 707 Query: 1562 ASA 1554 ++ Sbjct: 708 VAS 716
>LOC_Os12g14190:12012.t01284:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3018 Score = 36.3 bits (73), Expect = 0.72 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW +RC +RG ++W WS Sbjct: 404 RRPINWTRCWRITEFRCIQAASRGTKSWIPFWS 502
>LOC_Os08g42240:12008.t03953:unspliced-genomic conserved hypothetical protein| Length = 580 Score = 36.3 bits (73), Expect = 0.72 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +2 / +1 Query: 1592 RAWCWRWSGRFWYWRRGQRPW 1654 R W WRW GR + +RGQR W Sbjct: 277 RRWRWRWRGRRRWRQRGQRRW 339
>LOC_Os04g44930:12004.t05471:unspliced-genomic expressed protein| Length = 3206 Score = 36.3 bits (73), Expect = 0.72 Identities = 14/48 (29%), Positives = 20/48 (41%) Frame = +2 / -3 Query: 1538 RCWICGHWRCRGCWARGLRAWCWRWSGRFWYWRRGQRPW*SWEVHGED 1681 RC IC W G +R +R+ W + W W W + G+D Sbjct: 378 RCAICAWWDVGGIASRSMRSL*WALTTSVWRWDSTAAQWRGIGIDGDD 235
>LOC_Os02g11636:12002.t00962:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 1167 Score = 36.3 bits (73), Expect = 0.72 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG + W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKGWILLWS 502
>LOC_Os01g64550:12001.t05822:unspliced-genomic hypothetical protein| Length = 1222 Score = 36.3 bits (73), Expect = 0.72 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 / -1 Query: 1589 LRAWCWRWSGRFWYWRRGQRPW*SW 1663 LRA C+RWSGR W RG +W Sbjct: 1087 LRARCYRWSGRLRQWHRGMDQCLAW 1013
>LOC_Os08g12300:12008.t01110:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 8191 Score = 29.0 bits (57), Expect(2) = 0.72 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 / -3 Query: 1583 RGLRAWCWRWSGRFW 1627 R LR W WRWS W Sbjct: 4418 RMLRGWWWRWSIMLW 4374 Score = 24.4 bits (47), Expect(2) = 0.72 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = +2 / -3 Query: 1622 FWYWRRGQR 1648 +W+WRRG+R Sbjct: 4289 WWWWRRGRR 4263
>LOC_Os12g24450:12012.t02172:unspliced-genomic retrotransposon protein, putative, LINE subclass| Length = 6131 Score = 30.4 bits (60), Expect(2) = 0.74 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +2 / +2 Query: 1538 RCWICGHWRCRGCWARGLRAWCWRWSGR 1621 R W C WRC W+ C+ GR Sbjct: 512 RFWCCSWWRCGAWWSCFFSCCCFLAEGR 595 Score = 23.1 bits (44), Expect(2) = 0.74 Identities = 6/14 (42%), Positives = 8/14 (57%) Frame = +2 / +2 Query: 1505 CTWWRRFTSWFRCW 1546 C+WWR W C+ Sbjct: 383 CSWWRIPCGWRCCF 424
>LOC_Os08g12080:12008.t01088:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5908 Score = 29.0 bits (57), Expect(2) = 0.74 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 / -1 Query: 1583 RGLRAWCWRWSGRFW 1627 R LR W WRWS W Sbjct: 1795 RMLRGWWWRWSIMLW 1751 Score = 24.4 bits (47), Expect(2) = 0.74 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = +2 / -1 Query: 1622 FWYWRRGQR 1648 +W+WRRG+R Sbjct: 1666 WWWWRRGRR 1640
>LOC_Os02g24670:12002.t02164:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5638 Score = 29.0 bits (57), Expect(2) = 0.74 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 / -2 Query: 1583 RGLRAWCWRWSGRFW 1627 R LR W WRWS W Sbjct: 1680 RVLRGWWWRWSIMLW 1636 Score = 24.4 bits (47), Expect(2) = 0.74 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = +2 / -2 Query: 1622 FWYWRRGQR 1648 +W+WRRG+R Sbjct: 1551 WWWWRRGRR 1525
>LOC_Os05g17780:12005.t01547:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4956 Score = 29.0 bits (57), Expect(2) = 0.75 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 / -1 Query: 1583 RGLRAWCWRWSGRFW 1627 R LR W WRWS W Sbjct: 1758 RMLRGWWWRWSIMLW 1714 Score = 24.4 bits (47), Expect(2) = 0.75 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = +2 / -1 Query: 1622 FWYWRRGQR 1648 +W+WRRG+R Sbjct: 1629 WWWWRRGRR 1603
>LOC_Os11g26050:12011.t02221:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4515 Score = 29.0 bits (57), Expect(2) = 0.75 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 / -1 Query: 1583 RGLRAWCWRWSGRFW 1627 R LR W WRWS W Sbjct: 243 RVLRGWWWRWSIMLW 199 Score = 24.4 bits (47), Expect(2) = 0.75 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = +2 / -1 Query: 1622 FWYWRRGQR 1648 +W+WRRG+R Sbjct: 114 WWWWRRGRR 88
>LOC_Os02g22500:12002.t02037:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3777 Score = 29.0 bits (57), Expect(2) = 0.76 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 / -1 Query: 1583 RGLRAWCWRWSGRFW 1627 R LR W WRWS W Sbjct: 210 RVLRGWWWRWSIMLW 166 Score = 24.4 bits (47), Expect(2) = 0.76 Identities = 6/9 (66%), Positives = 9/9 (100%) Frame = +2 / -1 Query: 1622 FWYWRRGQR 1648 +W+WRRG+R Sbjct: 81 WWWWRRGRR 55
>LOC_Os06g02180:12006.t00112:unspliced-genomic CSLD2 - cellulose synthase-like family D, expressed| Length = 5259 Score = 31.3 bits (62), Expect(2) = 0.89 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 / +2 Query: 1559 WRCRGCWARGLRAWCWRWSGRFWYWRR 1639 W+C R W WRW R WRR Sbjct: 1541 WQCHLAQGERGRQWRWRWRRRRAGWRR 1621 Score = 28.6 bits (56), Expect(2) = 0.89 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 / +1 Query: 791 SLHLCFCCCSPRR 829 S+H CCC PRR Sbjct: 196 SIHTVLCCCGPRR 234
>LOC_Os03g48260:12003.t04183:unspliced-genomic expressed protein| Length = 5287 Score = 33.1 bits (66), Expect(2) = 0.90 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +2 / -3 Query: 743 PGLYRCSCCISTVRRDSLHLCFCCCSP 823 P CC + S H C CCC+P Sbjct: 5000 PANLHLDCCNKSCHHQSDHPCLCCCTP 4920 Score = 26.7 bits (52), Expect(2) = 0.90 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 / -1 Query: 1577 WARGLRAWCWRWSG 1618 WAR L WRWSG Sbjct: 61 WARVLGIRAWRWSG 20
>LOC_Os01g22590:12001.t01991:unspliced-genomic polygalacturonase, putative, expressed| Length = 2829 Score = 23.5 bits (45), Expect(3) = 0.93 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +2 / -3 Query: 1607 RWSGRFWYWRRGQRP 1651 RW R W RG+RP Sbjct: 907 RWKRRRWLCCRGRRP 863 Score = 23.1 bits (44), Expect(3) = 0.93 Identities = 7/16 (43%), Positives = 7/16 (43%) Frame = +2 / -3 Query: 1559 WRCRGCWARGLRAWCW 1606 WRC CW R W Sbjct: 976 WRCWWCWCLRRRVRRW 929 Score = 22.1 bits (42), Expect(3) = 0.93 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 / -3 Query: 1514 WRRFTSWFRCWIC 1552 WRR W R W C Sbjct: 1006 WRRRGRWQRRWRC 968 Score = 27.6 bits (54), Expect(2) = 1.4 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 / -3 Query: 1598 WCWRWSGRFWYWRRGQRPW 1654 WC R R W+ RRG+ W Sbjct: 958 WCLRRRVRRWWHRRGELRW 902 Score = 24.9 bits (48), Expect(2) = 1.4 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 / -3 Query: 1559 WRCRGCWARGLRAW 1600 WR RG W R R W Sbjct: 1006 WRRRGRWQRRWRCW 965
>LOC_Os12g43470:12012.t04015:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3335 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os12g41040:12012.t03781:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 11286 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 1331 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 1429
>LOC_Os12g37220:12012.t03402:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3332 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os12g37030:12012.t03383:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5797 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +3 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 2868 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 2966
>LOC_Os12g36470:12012.t03328:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3305 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os12g35730:12012.t03261:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os12g35660:12012.t03254:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3306 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os12g34160:12012.t03105:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 11116 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 1838 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 1936
>LOC_Os12g32740:12012.t02969:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os12g31600:12012.t02864:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os12g31140:12012.t02819:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os12g31030:12012.t02808:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVVSRGTKSWIPLWS 502
>LOC_Os12g30630:12012.t02770:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 12906 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 3029 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 3127
>LOC_Os12g30390:12012.t02746:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2802 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os12g28560:12012.t02566:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3354 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +3 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 405 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 503
>LOC_Os12g28450:12012.t02555:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 996 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os12g27640:12012.t02476:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 6047 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 3119 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 3217
>LOC_Os12g27270:12012.t02440:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 10577 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 1184 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 1282
>LOC_Os12g26630:12012.t02376:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class, expressed| Length = 3304 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os12g26080:12012.t02324:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5247 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +3 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 2319 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 2417
>LOC_Os12g24680:12012.t02192:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 6864 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 167 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 265
>LOC_Os12g24260:12012.t02155:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 8284 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 167 RRPINWTRCWRTTQLRCTQIASRGTKSWIPLWS 265
>LOC_Os12g23250:12012.t02058:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3332 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os12g16850:12012.t01538:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3306 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os12g16780:12012.t01531:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3305 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os12g14780:12012.t01337:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3054 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 167 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 265
>LOC_Os12g13920:12012.t01259:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 10789 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 2333 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 2431
>LOC_Os12g12490:12012.t01118:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 6264 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +1 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 2992 RRPINWTRCWRTTELRCTQVVSRGTKSWIPLWS 3090
>LOC_Os12g12210:12012.t01090:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os12g01650:12012.t00064:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3332 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os11g46840:12011.t04159:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3096 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 167 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 265
>LOC_Os11g45650:12011.t04092:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3319 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os11g44440:12011.t03972:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 12554 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 2906 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 3004
>LOC_Os11g44160:12011.t03944:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 7068 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +3 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 1986 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 2084
>LOC_Os11g43470:12011.t03877:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 1089 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os11g42190:12011.t03750:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 7095 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 389 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 487
>LOC_Os11g40950:12011.t03634:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPKNWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os11g40700:12011.t03612:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 1245 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWLPLWS 502
>LOC_Os11g38700:12011.t03413:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os11g38560:12011.t03399:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 1197 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os11g38462:12011.t03389:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os11g37460:12011.t03287:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3330 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 2732 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 2830
>LOC_Os11g36990:12011.t03243:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3322 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +3 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 393 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 491
>LOC_Os11g35480:12011.t03095:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3306 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os11g32140:12011.t02811:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4913 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 1985 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 2083
>LOC_Os11g30070:12011.t02611:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os11g29660:12011.t02570:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3305 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os11g26380:12011.t02254:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 6340 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 2018 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 2116
>LOC_Os11g25010:12011.t02120:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class, expressed| Length = 3331 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os11g18961:12011.t01666:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os11g18550:12011.t01626:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3313 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTRELRCTQVASRGTKSWIPLWS 502
>LOC_Os11g16790:12011.t01459:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5720 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os11g15350:12011.t01364:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os11g14560:12011.t01287:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 11006 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 8081 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 8179
>LOC_Os11g14340:12011.t01265:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5014 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os11g13740:12011.t01208:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5753 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 2852 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 2950
>LOC_Os11g12840:12011.t01171:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2013 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os11g12830:12011.t01170:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2293 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os11g12770:12011.t01164:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5111 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +1 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 2209 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 2307
>LOC_Os11g10860:12011.t00974:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 9555 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os11g06640:12011.t00556:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5886 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os11g06620:12011.t00554:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 12226 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +1 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 4003 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 4101
>LOC_Os11g03960:12011.t00286:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 8118 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +3 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 3900 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 3998
>LOC_Os10g33470:12010.t02647:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3078 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os10g28990:12010.t02247:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5693 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +3 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 2763 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 2861
>LOC_Os10g27260:12010.t02132:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 15984 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +3 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 3693 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 3791
>LOC_Os10g26870:12010.t02096:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4967 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 2039 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 2137
>LOC_Os10g23290:12010.t01806:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 9679 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os10g19322:12010.t01476:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3305 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os10g19020:12010.t01449:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os10g12560:12010.t01033:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 1131 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW +RC RG ++W WS Sbjct: 389 RRPINWTRCWRTTEFRCTQVANRGTKSWIPLWS 487
>LOC_Os10g11454:12010.t00942:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 13957 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os10g11210:12010.t00922:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os10g10780:12010.t00884:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class, expressed| Length = 3421 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os10g08250:12010.t00649:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3330 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os10g07530:12010.t00610:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2926 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os10g05190:12010.t00398:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class, expressed| Length = 11494 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os10g05040:12010.t00383:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4518 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +3 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 2097 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 2195
>LOC_Os10g03470:12010.t00236:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os09g39150:12009.t03381:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 9847 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os09g37210:12009.t03195:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3317 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os09g26020:12009.t02281:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3306 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os09g21570:12009.t01891:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os09g18380:12009.t01623:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3307 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os09g17280:12009.t01515:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os09g15300:12009.t01319:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 8885 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os09g13670:12009.t01156:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class, expressed| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os09g13550:12009.t01145:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class, expressed| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os09g13500:12009.t01140:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os09g13350:12009.t01125:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3291 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os09g09000:12009.t00694:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 18207 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +3 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 8781 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 8879
>LOC_Os09g03290:12009.t00227:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2695 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 167 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 265
>LOC_Os09g02100:12009.t00111:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3332 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os08g41160:12008.t03845:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 9717 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os08g36720:12008.t03411:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3332 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os08g35780:12008.t03318:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 639 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os08g33500:12008.t03091:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os08g29180:12008.t02673:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 12963 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +3 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 3237 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 3335
>LOC_Os08g26290:12008.t02395:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os08g23580:12008.t02130:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 8290 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 4256 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 4354
>LOC_Os08g16100:12008.t01484:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os08g14670:12008.t01342:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 8127 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os08g13290:12008.t01207:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3332 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os08g12860:12008.t01164:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 1853 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +1 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 394 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 492
>LOC_Os08g12500:12008.t01129:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 9334 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 1817 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 1915
>LOC_Os08g12270:12008.t01107:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3332 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os08g10220:12008.t00907:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 1739 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os08g04880:12008.t00382:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3084 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 155 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 253
>LOC_Os08g03720:12008.t00267:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5666 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 2738 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 2836
>LOC_Os07g34770:12007.t03152:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 6709 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os07g34210:12007.t03098:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3333 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os07g34160:12007.t03093:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3332 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVVSRGTKSWIPLWS 502
>LOC_Os07g34080:12007.t03085:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3306 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os07g33820:12007.t03059:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 1113 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502
>LOC_Os07g23354:12007.t02035:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 14385 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +1 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 2596 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 2694
>LOC_Os07g18080:12007.t01667:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3306 Score = 35.9 bits (72), Expect = 0.98 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1517 RRFTSWFRCWICGHWRCRGCWARGLRAWCWRWS 1615 RR +W RCW RC +RG ++W WS Sbjct: 404 RRPINWTRCWRTTELRCTQVASRGTKSWIPLWS 502 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 731,782,689 Number of extensions: 12057547 Number of successful extensions: 74302 Number of sequences better than 10.0: 611 Length of query: 647 Length of database: 55,613,886 Length adjustment: 52 Effective length of query: 595 Effective length of database: 52,687,430 Effective search space: 31349020850 Effective search space used: 31349020850 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
