| Clone Name | FLbaf39b12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q8N290:CC053_HUMAN Putative uncharacterized protein C3orf53 - Ho... | 32 | 7.1 | 2 | Q1LH90:Y3614_RALME UPF0161 protein Rmet_3614 - Ralstonia metalli... | 32 | 9.3 | 3 | P16761:UL25_HCMVA Tegument protein UL25 - Human cytomegalovirus ... | 32 | 9.3 | 4 | Q91Y57:SIG12_MOUSE Sialic acid-binding Ig-like lectin 12 precurs... | 32 | 9.3 |
|---|
>Q8N290:CC053_HUMAN Putative uncharacterized protein C3orf53 - Homo sapiens (Human)| Length = 218 Score = 32.0 bits (71), Expect = 7.1 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +2 Query: 932 ISTPPADLCAPIKLMLPGGGGSTGATRIRCQPGEK*GTSK--RPT 1060 + PPA P+ PGGGG GA++ R QP + GT RPT Sbjct: 97 LQAPPA---VPLSRAHPGGGGGGGASQPRSQPQGRLGTCSPARPT 138
>Q1LH90:Y3614_RALME UPF0161 protein Rmet_3614 - Ralstonia metallidurans (strain CH34 /| ATCC 43123 / DSM 2839) Length = 96 Score = 31.6 bits (70), Expect = 9.3 Identities = 17/51 (33%), Positives = 23/51 (45%) Frame = +2 Query: 1082 QRSPARASWLPRPSHLCRSEKTHPLQAKELPPLPSLIGCSAAPTGSTFTGR 1234 Q AR +W+ CR + HP P+P+ G +AAP S GR Sbjct: 40 QHGAARGTWMAA----CRLCRCHPFTKGGYDPVPATHGTAAAPPASAAPGR 86
>P16761:UL25_HCMVA Tegument protein UL25 - Human cytomegalovirus (strain AD169) (HHV-5)| (Human herpesvirus 5) Length = 656 Score = 31.6 bits (70), Expect = 9.3 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = +2 Query: 1040 GTSKRPTTKERSTSQRSPARASWLPRPSHLCRSEKTHPLQAKELPPLPSL 1189 G +K+P+ K+RS+S+R P A+ PR S P + P +PSL Sbjct: 81 GAAKKPSEKKRSSSRRQPQIAAGAPRGSPATPKAGKSP-KVSRPPSVPSL 129
>Q91Y57:SIG12_MOUSE Sialic acid-binding Ig-like lectin 12 precursor - Mus musculus| (Mouse) Length = 467 Score = 31.6 bits (70), Expect = 9.3 Identities = 18/70 (25%), Positives = 28/70 (40%) Frame = -1 Query: 1038 HFSPGWQRMRVAPVDPPPPGSISLIGAHKSAGGVDITRALHVQREIQTSRGVPVVASSVL 859 + S W + + P PG + L H GGV +A H S + +S+ L Sbjct: 287 NLSWSWDNLTLCPSKLSKPGLLELFPVHLKHGGVYTCQAQHALGSQHISLSLSPQSSATL 346 Query: 858 VQHQMAGFIG 829 + M F+G Sbjct: 347 SEMMMGTFVG 356 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 223,130,535 Number of extensions: 4540717 Number of successful extensions: 15926 Number of sequences better than 10.0: 4 Number of HSP's gapped: 15840 Number of HSP's successfully gapped: 4 Length of query: 509 Length of database: 100,686,439 Length adjustment: 118 Effective length of query: 391 Effective length of database: 68,319,629 Effective search space: 26712974939 Effective search space used: 26712974939 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)