| Clone Name | FLbaf36c11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | P56182:RRP1_HUMAN RRP1-like protein - Homo sapiens (Human) | 35 | 2.9 | 2 | A5HBG1:LT_POVWU Large T antigen - WU polyomavirus (WUPyV) | 33 | 8.6 |
|---|
>P56182:RRP1_HUMAN RRP1-like protein - Homo sapiens (Human)| Length = 461 Score = 34.7 bits (78), Expect = 2.9 Identities = 19/64 (29%), Positives = 37/64 (57%), Gaps = 6/64 (9%) Frame = -1 Query: 213 GEKGHTLSSRRMCCRPAGAMLASSGDLVQQQRPDDKDAGA------RDVLAPRDNQLAAR 52 GE+G LS +R PAG++ + + ++Q DD+D+G + +A R ++A+R Sbjct: 254 GERGDALSQKRSEKPPAGSICRAEPEAGEEQAGDDRDSGGPVLQFDYEAVANRLFEMASR 313 Query: 51 RASP 40 +++P Sbjct: 314 QSTP 317
>A5HBG1:LT_POVWU Large T antigen - WU polyomavirus (WUPyV)| Length = 648 Score = 33.1 bits (74), Expect = 8.6 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 1/89 (1%) Frame = +2 Query: 2321 SVFYSDQFSSYLVGYTKETLTEIYRKLGVFKLKTNISLKWHYYTKMLALQQNMHRH-MWY 2497 +VF + +++++ TKE +Y+KL + K K N + + YY L RH + Sbjct: 166 AVFSNRTLTAFVIHTTKEKAETLYKKL-LSKFKCNFASRHSYYNTALVFILTPFRHRVSA 224 Query: 2498 IRHVVLGYNITCKIQLF*CSMCSNTWNKY 2584 + + GY C I C +N + Y Sbjct: 225 VNNFCKGY---CTISFLFCKGVNNAYGLY 250 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 629,957,426 Number of extensions: 14094704 Number of successful extensions: 33020 Number of sequences better than 10.0: 2 Number of HSP's gapped: 32905 Number of HSP's successfully gapped: 2 Length of query: 1205 Length of database: 100,686,439 Length adjustment: 125 Effective length of query: 1080 Effective length of database: 66,399,564 Effective search space: 71711529120 Effective search space used: 71711529120 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)