| Clone Name | FLbaf35i16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q4FZU8:FA65A_RAT Protein FAM65A - Rattus norvegicus (Rat) | 29 | 9.0 |
|---|
>Q4FZU8:FA65A_RAT Protein FAM65A - Rattus norvegicus (Rat)| Length = 1217 Score = 29.3 bits (64), Expect = 9.0 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +3 Query: 153 SKNRPIIDSTKPLPPQATFRGP-YVNTGSRDIGPDPT 260 S +P++ +PLP Q TFR P +++GS D P T Sbjct: 398 STPKPLVQQPEPLPVQVTFRRPESLSSGSMDEEPPLT 434 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 105,934,955 Number of extensions: 2473147 Number of successful extensions: 5129 Number of sequences better than 10.0: 1 Number of HSP's gapped: 5129 Number of HSP's successfully gapped: 1 Length of query: 180 Length of database: 100,686,439 Length adjustment: 106 Effective length of query: 74 Effective length of database: 71,611,169 Effective search space: 5299226506 Effective search space used: 5299226506 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)