ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf29i03 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os07g37700:12007.t03439:unspliced-genomic expressed protein| Length = 231 Score = 183 bits (395), Expect = 7e-46 Identities = 72/74 (97%), Positives = 72/74 (97%) Frame = +2 / +1 Query: 140 MVFFCFLVDQRRKVRSSKPAAGICSRCGGCASVADMETATRLCYLLTVHRVTWRAIICTF 319 MVFFCFLVDQRRKVRSSKPAAGICSRCGGCASVADMETATR CYLLTVHR TWRAIICTF Sbjct: 1 MVFFCFLVDQRRKVRSSKPAAGICSRCGGCASVADMETATRFCYLLTVHRATWRAIICTF 180 Query: 320 CGAMLKSYRHYRLY 361 CGAMLKSYRHYRLY Sbjct: 181 CGAMLKSYRHYRLY 222 Score = 80.3 bits (169), Expect(2) = 1e-21 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -3 / -2 Query: 255 AVSMSATLAQPPHREQMPAAGLLLRTFRRWSTRKQKNT 142 AVSMSATLA PPHREQ+PAAGLLLRTF WST+KQKNT Sbjct: 116 AVSMSATLAHPPHREQIPAAGLLLRTFLLWSTKKQKNT 3 Score = 41.4 bits (84), Expect(2) = 1e-21 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 / -2 Query: 360 *SR*WR*DLSMAPQKVQMMA 301 *S *WR*DLSMAPQKVQMMA Sbjct: 221 *SL*WR*DLSMAPQKVQMMA 162 Score = 32.7 bits (65), Expect = 2.4 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = +1 / +3 Query: 217 VRRLRQRGGHGDG 255 VRR+R+RGGHGDG Sbjct: 78 VRRVRERGGHGDG 116
>LOC_Os12g24050:12012.t02134:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 4849 Score = 30.4 bits (60), Expect(2) = 0.22 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 / -2 Query: 61 WWWWTVQYS*LGRAPP 14 WWWW Q S R+PP Sbjct: 336 WWWWWCQRSGRRRSPP 289 Score = 23.1 bits (44), Expect(2) = 0.22 Identities = 4/4 (100%), Positives = 4/4 (100%) Frame = -2 / -2 Query: 61 WWWW 50 WWWW Sbjct: 354 WWWW 343
>LOC_Os03g47930:12003.t04156:unspliced-genomic expressed protein| Length = 12532 Score = 27.2 bits (53), Expect(2) = 0.37 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 / +2 Query: 61 WWWWTVQYS*LGRAPPVR 8 WWWW LG A P+R Sbjct: 311 WWWWWWWAELLGYALPLR 364 Score = 25.4 bits (49), Expect(2) = 0.37 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = -2 / +2 Query: 88 SPEVFDDGAWWWW 50 SP G WWWW Sbjct: 287 SPSPSGLGWWWWW 325
>LOC_Os03g12350:12003.t01034:unspliced-genomic two-component response regulator ARR1, putative, expressed| Length = 6049 Score = 28.1 bits (55), Expect(2) = 0.39 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 / +1 Query: 76 FDDGAWWWW 50 F GAWWWW Sbjct: 217 FVRGAWWWW 243 Score = 24.4 bits (47), Expect(2) = 0.39 Identities = 6/13 (46%), Positives = 7/13 (53%) Frame = -2 / +1 Query: 61 WWWWTVQYS*LGR 23 WWWW + GR Sbjct: 238 WWWWLYGFRFRGR 276
>LOC_Os03g47920:12003.t04155:unspliced-genomic hypothetical protein| Length = 3677 Score = 27.2 bits (53), Expect(2) = 0.40 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 / -2 Query: 61 WWWWTVQYS*LGRAPPVR 8 WWWW LG A P+R Sbjct: 265 WWWWWWWAELLGYALPLR 212 Score = 25.4 bits (49), Expect(2) = 0.40 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = -2 / -2 Query: 88 SPEVFDDGAWWWW 50 SP G WWWW Sbjct: 289 SPSPSGLGWWWWW 251
>LOC_Os08g13630:12008.t04276:unspliced-genomic expressed protein| Length = 2601 Score = 24.0 bits (46), Expect(4) = 0.44 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 / +3 Query: 340 LPPLPALLDPRSLTL 384 LPP P+L PRSL L Sbjct: 603 LPPNPSLRAPRSLPL 647 Score = 24.0 bits (46), Expect(4) = 0.44 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +2 / +2 Query: 395 ARDGRLHPRPVCRRRWSMHVCAS*FCLL 478 A +GR P P C WS C C + Sbjct: 881 AAEGRQRPCPECAVGWSRGKCLFFCCFV 964 Score = 21.7 bits (41), Expect(4) = 0.44 Identities = 5/14 (35%), Positives = 9/14 (64%) Frame = +1 / +3 Query: 61 RHHHQIPPARVSAI 102 +HHH PP +++ Sbjct: 240 KHHHHCPPLESASV 281 Score = 21.7 bits (41), Expect(4) = 0.44 Identities = 6/12 (50%), Positives = 11/12 (91%) Frame = +1 / +1 Query: 544 TGFLWSYVHIVL 579 TGF++ ++HI+L Sbjct: 1450 TGFIFFFIHILL 1485
>LOC_Os04g23000:12004.t02028:unspliced-genomic conserved hypothetical protein| Length = 597 Score = 26.7 bits (52), Expect(2) = 0.45 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 / -3 Query: 249 SMSATLAQPPHREQMPAAGLLLRT 178 S +T PPHR PAAG + R+ Sbjct: 529 SSPSTPPPPPHRRPRPAAGDIARS 458 Score = 25.8 bits (50), Expect(2) = 0.45 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 / -3 Query: 93 NSRRRYLMMVPGGGGQCNTAS*AA 22 +SRRR + + GGG C + + AA Sbjct: 406 SSRRRGMKVAAAGGGNCGSLASAA 335
>LOC_Os06g10470:12006.t00925:unspliced-genomic zinc finger protein, putative| Length = 786 Score = 32.2 bits (64), Expect(2) = 0.66 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 / +3 Query: 73 DDGAWWWWTVQY 38 DDG WWWW Y Sbjct: 549 DDGEWWWWCFWY 584 Score = 21.7 bits (41), Expect(2) = 0.66 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = -3 / +2 Query: 243 SATLAQPPHREQMPAAGLLLRTFRRWSTRKQKNTMPP 133 SAT A R + A RT STR + + PP Sbjct: 194 SATTAAATSRRRRRWAATRTRTSGSASTRGARTSRPP 304 Score = 33.6 bits (67), Expect = 1.3 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 / -3 Query: 50 PPPPGTIIKYLRREFQRYFWRAWRGRRSG 136 PPPP RR QR WR RGRR G Sbjct: 142 PPPPPWAAGRRRRRRQRRRWRRRRGRRGG 56
>LOC_Os05g11070:12005.t00939:unspliced-genomic helix-loop-helix DNA-binding domain containing protein, expressed| Length = 2219 Score = 34.5 bits (69), Expect = 0.68 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +2 / +2 Query: 2 GRSHRRRAA*LAVLHCPPPPGTIIKYLRREFQRYFWRAWRGRRSGG 139 GR RRRAA C PPP + +R +R ++ R ++ GG Sbjct: 719 GRRRRRRAATTTRRSCSPPPPPLATTRQRRCRRRYYYHGRDKQHGG 856
>LOC_Os04g31910:12004.t02871:unspliced-genomic expressed protein| Length = 2948 Score = 28.6 bits (56), Expect(2) = 0.74 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -2 / -1 Query: 61 WWWWTVQYS*LGRAPPVRSA 2 WWWW + + APP +A Sbjct: 212 WWWWLLPWCWSPPAPPAAAA 153 Score = 23.1 bits (44), Expect(2) = 0.74 Identities = 4/4 (100%), Positives = 4/4 (100%) Frame = -2 / -1 Query: 61 WWWW 50 WWWW Sbjct: 233 WWWW 222
>LOC_Os02g02970:12002.t00197:unspliced-genomic poly, putative, expressed| Length = 2920 Score = 28.1 bits (55), Expect(2) = 0.74 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = -2 / +1 Query: 70 DGAWWWW 50 DG WWWW Sbjct: 304 DGQWWWW 324 Score = 23.5 bits (45), Expect(2) = 0.74 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -3 / +3 Query: 159 RKQKNTMPPLLLPRQALQKYR*NSRRR 79 R ++ PP LP L +Y RRR Sbjct: 192 RSASSSCPPRALPGSRLSRYLRRRRRR 272
>LOC_Os01g12690:12001.t01135:unspliced-genomic plant-specific domain TIGR01568 family protein, expressed| Length = 1458 Score = 25.8 bits (50), Expect(2) = 0.78 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = -2 / +2 Query: 73 DDGAWWWW 50 D +WWWW Sbjct: 50 DGSSWWWW 73 Score = 25.8 bits (50), Expect(2) = 0.78 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -2 / +2 Query: 61 WWWWTVQYS*LGRA 20 WWWW Q G+A Sbjct: 71 WWWWEEQQPAAGQA 112
>LOC_Os08g13400:12008.t01218:unspliced-genomic conserved hypothetical protein| Length = 246 Score = 34.1 bits (68), Expect = 0.94 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +2 / +1 Query: 167 QRRKVRSSKPAAGICSRCGGCASVADMETATRLCYL 274 + + +S+ A G C RCGG D+E++ R+ L Sbjct: 49 EEERETASRKAPGACPRCGGAVVATDVESSRRILCL 156
>LOC_Os01g22090:12001.t01944:unspliced-genomic expressed protein| Length = 4479 Score = 34.1 bits (68), Expect = 0.94 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +2 / -2 Query: 251 TATRLCYLLTVHRVTWRAI 307 T+T LCYLL +H + WRAI Sbjct: 4328 TSTNLCYLL*LHSLVWRAI 4272
>LOC_Os10g23090:12010.t01786:unspliced-genomic homeodomain-leucine zipper transcription factor TaHDZipI-1, putative,| expressed Length = 1632 Score = 25.8 bits (50), Expect(2) = 1.0 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = -2 / -1 Query: 67 GAWWWW 50 G WWWW Sbjct: 1074 GVWWWW 1057 Score = 25.4 bits (49), Expect(2) = 1.0 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -2 / -1 Query: 61 WWWWTVQYS*LGRAPPVRSA 2 WWWW++ G A + +A Sbjct: 1065 WWWWSMAAPEYGDASSLNTA 1006
>LOC_Os06g06560:12006.t00541:unspliced-genomic soluble starch synthase 1, chloroplast precursor, putative,| expressed Length = 7750 Score = 25.4 bits (49), Expect(2) = 1.3 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = -2 / -3 Query: 67 GAWWWW 50 G WWWW Sbjct: 134 GRWWWW 117 Score = 25.4 bits (49), Expect(2) = 1.3 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -2 / -3 Query: 61 WWWWTVQYS*LGRAPPVR 8 WWWW + S L R R Sbjct: 119 WWWWWRERSGLSRGDDER 66
>LOC_Os02g57460:12002.t05318:unspliced-genomic RING-H2 finger protein ATL5G, putative, expressed| Length = 2585 Score = 26.3 bits (51), Expect(2) = 1.4 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 / +1 Query: 2 GRSHRRRAA*LAVLH 46 GR HRRRAA +A+ H Sbjct: 826 GREHRRRAASVALAH 870 Score = 24.4 bits (47), Expect(2) = 1.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 / +3 Query: 40 IALSTTTRHHHQ 75 IA T++RHHHQ Sbjct: 936 IASKTSSRHHHQ 971
>LOC_Os10g26590:12010.t02070:unspliced-genomic AP2 domain containing protein| Length = 684 Score = 27.6 bits (54), Expect(2) = 1.4 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 / +2 Query: 110 RAWRGRRSGG 139 RAWRGRR+GG Sbjct: 56 RAWRGRRTGG 85 Score = 24.9 bits (48), Expect(2) = 1.4 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 / +2 Query: 419 RPVCRRRWSMHVCAS 463 RP CRRRW AS Sbjct: 578 RPWCRRRWPTSATAS 622
>LOC_Os01g47360:12001.t04184:unspliced-genomic GATA zinc finger family protein| Length = 890 Score = 27.2 bits (53), Expect(2) = 1.5 Identities = 17/52 (32%), Positives = 21/52 (40%) Frame = -3 / -2 Query: 204 PAAGLLLRTFRRWSTRKQKNTMPPLLLPRQALQKYR*NSRRRYLMMVPGGGG 49 P A L R R WST + P R+ ++ RRR GGGG Sbjct: 253 PTATPLPRPRRAWSTACRATACSPPSRRRRTARRGTPRRRRRSTACSGGGGG 98 Score = 23.5 bits (45), Expect(2) = 1.5 Identities = 4/5 (80%), Positives = 5/5 (100%) Frame = -2 / -1 Query: 61 WWWWT 47 WWWW+ Sbjct: 107 WWWWS 93
>LOC_Os01g21900:12001.t01927:unspliced-genomic expressed protein| Length = 3155 Score = 33.1 bits (66), Expect = 1.8 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +1 / +3 Query: 550 FLWSYVHIVLCKVASLD*YSEKKK 621 + WSYV+++LC LD +EKKK Sbjct: 2733 YYWSYVYLLLCLTMFLDKKNEKKK 2804
>LOC_Os01g18620:12001.t01654:unspliced-genomic transferase family protein, expressed| Length = 2440 Score = 30.4 bits (60), Expect(2) = 1.8 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 / -1 Query: 176 KVRSSKPAAGICSRCGG 226 K ++SK +GICSRCGG Sbjct: 307 KNQTSKRESGICSRCGG 257 Score = 23.5 bits (45), Expect(2) = 1.8 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +2 / -3 Query: 2 GRSHRRRAA*LAVLHCPPPPGTIIKYLRR 88 GR R A+ A PPPPGT + RR Sbjct: 1139 GRRASRWASVPACHRRPPPPGTRPRRRRR 1053
>LOC_Os08g42570:12008.t03986:unspliced-genomic expressed protein| Length = 1625 Score = 25.8 bits (50), Expect(2) = 1.9 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 / -1 Query: 107 WRAWRGRRS 133 WRAWRG RS Sbjct: 1163 WRAWRGSRS 1137 Score = 24.4 bits (47), Expect(2) = 1.9 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +2 / -2 Query: 41 LHCPPPPGTIIKY 79 LH PPPP ++++ Sbjct: 1207 LHLPPPPALLVRH 1169
>LOC_Os10g30910:12010.t02422:unspliced-genomic expressed protein| Length = 9689 Score = 26.7 bits (52), Expect(2) = 2.2 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = -2 / +3 Query: 61 WWWWTVQYS*LGRAPPV 11 WWWW V G P V Sbjct: 234 WWWWAVAVVGCGAQPVV 284 Score = 23.1 bits (44), Expect(2) = 2.2 Identities = 4/4 (100%), Positives = 4/4 (100%) Frame = -2 / +1 Query: 61 WWWW 50 WWWW Sbjct: 154 WWWW 165
>LOC_Os05g51630:12005.t04588:unspliced-genomic HYP1, putative, expressed| Length = 8252 Score = 25.8 bits (50), Expect(2) = 2.3 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -2 / +3 Query: 97 LKLSPEVFDDGAWWWW 50 L LS + WWWW Sbjct: 3 LSLSRDFLPSFPWWWW 50 Score = 24.0 bits (46), Expect(2) = 2.3 Identities = 4/7 (57%), Positives = 6/7 (85%) Frame = -2 / +3 Query: 61 WWWWTVQ 41 WWWW ++ Sbjct: 42 WWWWRLE 62
>LOC_Os12g30610:12012.t02768:unspliced-genomic expressed protein| Length = 3535 Score = 26.7 bits (52), Expect(2) = 2.4 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -2 / -3 Query: 61 WWWWTVQYS*LGRAPPVRSA 2 WWWW + +GR R A Sbjct: 287 WWWWCGSFELVGRPRRRREA 228 Score = 23.1 bits (44), Expect(2) = 2.4 Identities = 4/4 (100%), Positives = 4/4 (100%) Frame = -2 / -3 Query: 61 WWWW 50 WWWW Sbjct: 290 WWWW 279
>LOC_Os02g36070:12002.t03244:unspliced-genomic cytochrome P450 76C4, putative, expressed| Length = 1809 Score = 32.7 bits (65), Expect = 2.4 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 / +2 Query: 263 LCYLLTVHRVTWRAIICTFCG 325 +CY TV R WR C FCG Sbjct: 71 VCYYCTVRRKQWRIARCGFCG 133
>LOC_Os02g07180:12002.t00615:unspliced-genomic expressed protein| Length = 3449 Score = 32.7 bits (65), Expect = 2.4 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 / +3 Query: 174 RRWSTRKQKNTMPPLLLPRQALQKYR*NSRR 82 RRW R+ + + PLLLPR+ ++ R* R+ Sbjct: 99 RRWRRRRPHHGLLPLLLPRRGIRSRR*PPRK 191
>LOC_Os06g01934:12006.t00089:unspliced-genomic BEL1-related homeotic protein 14, putative, expressed| Length = 6998 Score = 31.3 bits (62), Expect(2) = 2.5 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 / -2 Query: 472 TKLAGTYMHAPPPSANGTRVETAVA 398 T AGT M APPP+A+G TA + Sbjct: 472 TPSAGTLMAAPPPAADGQPTTTAAS 398 Score = 23.5 bits (45), Expect(2) = 2.5 Identities = 4/5 (80%), Positives = 5/5 (100%) Frame = -2 / -1 Query: 61 WWWWT 47 WWWW+ Sbjct: 299 WWWWS 285
>LOC_Os02g54010:12002.t04980:unspliced-genomic triacylglycerol lipase, putative, expressed| Length = 5333 Score = 26.3 bits (51), Expect(2) = 3.1 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -2 / +1 Query: 103 ISLKLSPEVFDDGAWWWW 50 I L LS ++ WWWW Sbjct: 661 IKLTLSGCAINNLGWWWW 714 Score = 23.1 bits (44), Expect(2) = 3.1 Identities = 4/4 (100%), Positives = 4/4 (100%) Frame = -2 / +1 Query: 61 WWWW 50 WWWW Sbjct: 709 WWWW 720
>LOC_Os02g56600:12002.t05232:unspliced-genomic NAC domain-containing protein 76, putative, expressed| Length = 3430 Score = 26.3 bits (51), Expect(2) = 3.2 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -2 / -1 Query: 100 SLKLSPEVFDDGAWWWW 50 SL+ P G WWWW Sbjct: 2833 SLREPPPPPVTGMWWWW 2783 Score = 23.1 bits (44), Expect(2) = 3.2 Identities = 4/4 (100%), Positives = 4/4 (100%) Frame = -2 / -1 Query: 61 WWWW 50 WWWW Sbjct: 2791 WWWW 2780
>LOC_Os04g43910:12004.t03931:unspliced-genomic auxin response factor 16, putative, expressed| Length = 2770 Score = 26.3 bits (51), Expect(2) = 3.3 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = -2 / -1 Query: 61 WWWWTVQYS*LGRAPPVR 8 WWWW+ G PV+ Sbjct: 1381 WWWWSCAIGLGGNTGPVK 1328 Score = 23.1 bits (44), Expect(2) = 3.3 Identities = 4/4 (100%), Positives = 4/4 (100%) Frame = -2 / -1 Query: 61 WWWW 50 WWWW Sbjct: 1384 WWWW 1373
>LOC_Os06g48500:12006.t04536:unspliced-genomic expressed protein| Length = 2104 Score = 26.3 bits (51), Expect(2) = 3.3 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -2 / +2 Query: 103 ISLKLSPEVFDDGAWWWW 50 + L + +V D WWWW Sbjct: 449 VDLSVVDDVSIDRWWWWW 502 Score = 23.1 bits (44), Expect(2) = 3.3 Identities = 4/4 (100%), Positives = 4/4 (100%) Frame = -2 / +2 Query: 61 WWWW 50 WWWW Sbjct: 494 WWWW 505
>LOC_Os10g34480:12010.t02744:unspliced-genomic cytochrome P450 86A2, putative, expressed| Length = 4422 Score = 32.2 bits (64), Expect = 3.4 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 / -2 Query: 50 PPPPGTIIKYLRREFQRYFWRAWRGRRSG 136 PPPP + R R +WR+WR R G Sbjct: 173 PPPPSRCARRRRPA*PRPWWRSWRSRDRG 87
>LOC_Os08g31660:12008.t02911:unspliced-genomic VQ motif family protein, expressed| Length = 1740 Score = 32.2 bits (64), Expect = 3.4 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 / -1 Query: 179 VRSSKPAAGICSRCGGCASVADMETATRL 265 VR KPAAG CS CGG + A+ + Sbjct: 1167 VRPRKPAAGSCSLCGGGRGARSLPGASNM 1081
>LOC_Os05g32590:12005.t02855:unspliced-genomic methylase, putative, expressed| Length = 2365 Score = 32.2 bits (64), Expect = 3.4 Identities = 19/53 (35%), Positives = 25/53 (47%) Frame = -3 / +1 Query: 159 RKQKNTMPPLLLPRQALQKYR*NSRRRYLMMVPGGGGQCNTAS*AARRLCDLP 1 R+++ PLLLP L ++ RRR L +VPG G A RL P Sbjct: 229 RRRRLLGRPLLLPFPLLHRHHRRRRRRVLRLVPGVPGAAAAAPRPPPRLLPGP 387
>LOC_Os02g12730:12002.t01070:unspliced-genomic beta-galactosidase precursor, putative, expressed| Length = 5211 Score = 32.2 bits (64), Expect = 3.4 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 / -2 Query: 191 KPAAGICSRCGGCASVADMETATRLCYLLTVHRVTWR 301 +PAA G ASV+ ++ R YL + H ++WR Sbjct: 398 RPAAAAGVGAGAIASVSPLQRKLRASYLSSAHPLSWR 288
>LOC_Os12g42280:12012.t03902:unspliced-genomic viviparous-14, putative, expressed| Length = 2563 Score = 29.9 bits (59), Expect(2) = 3.5 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = -3 / +1 Query: 249 SMSATLAQPPHREQMPAAGLLLRTFRRWSTRKQKNTMPPLLLP 121 SM++T A P R P T WST T PP P Sbjct: 565 SMASTPATAPTRTSSPPRATTCSTATAWSTPSASATAPPSPTP 693 Score = 23.1 bits (44), Expect(2) = 3.5 Identities = 4/4 (100%), Positives = 4/4 (100%) Frame = -2 / +1 Query: 61 WWWW 50 WWWW Sbjct: 1393 WWWW 1404
>LOC_Os03g07100:12003.t00576:unspliced-genomic lipid transfer protein, putative, expressed| Length = 2219 Score = 24.9 bits (48), Expect(3) = 3.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 / +1 Query: 98 RYFWRAWRGRRSGG 139 R++WR WR RR G Sbjct: 55 RWWWRRWRWRRWRG 96 Score = 24.0 bits (46), Expect(3) = 3.5 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +2 / +3 Query: 167 QRRKVRSSKPAAGICSRCGGCAS 235 QRR R +P +C R G A+ Sbjct: 1728 QRRTTRRRRPTRALCRRPTGAAA 1796 Score = 21.7 bits (41), Expect(3) = 3.5 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = +3 / +2 Query: 459 PASFVCSICLLICV 500 P+SF ++C++ CV Sbjct: 1877 PSSF*ITVCIISCV 1918
>LOC_Os02g46860:12002.t04272:unspliced-genomic oligopeptide transporter 4, putative, expressed| Length = 1106 Score = 26.3 bits (51), Expect(2) = 4.0 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -3 / -1 Query: 87 RRRYLMMVPGGGG 49 RRR L++ PGGGG Sbjct: 332 RRRLLLVFPGGGG 294 Score = 25.4 bits (49), Expect(2) = 4.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 / -2 Query: 460 GTYMHAPPPSANGTR 416 G +H+PPPS+ G R Sbjct: 601 GLRLHSPPPSSAGAR 557
>LOC_Os09g33790:12009.t02955:unspliced-genomic snRK1-interacting protein 1, putative, expressed| Length = 3252 Score = 27.6 bits (54), Expect(2) = 4.2 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 / +1 Query: 56 PPGTIIKYLRREFQRYFWRAWRGRRSG 136 P G + RR +R +WR WRG +G Sbjct: 220 PRGARVGGGRRGRRRPWWRRWRGAEAG 300 Score = 25.4 bits (49), Expect(2) = 4.2 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +2 / +3 Query: 158 LVDQRRKVRSSKPAAGICS 214 L+ RRK RS+KPA G+ S Sbjct: 2832 LLRLRRKQRSAKPAHGLVS 2888
>LOC_Os07g07830:12007.t00662:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2255 Score = 26.3 bits (51), Expect(2) = 4.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 / -3 Query: 64 HHHQIPPARVSAIFLESLARKE 129 HHHQ+P +F +S+ R E Sbjct: 1143 HHHQVPAFSCEDLFDQSIWRSE 1078 Score = 22.6 bits (43), Expect(2) = 4.5 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +3 / -3 Query: 27 PS*LYCTVHHHQAPS 71 P Y +HHHQ P+ Sbjct: 1167 PQIYYRRLHHHQVPA 1123
>LOC_Os10g39450:12010.t03187:unspliced-genomic ring finger protein, putative, expressed| Length = 1075 Score = 31.8 bits (63), Expect = 4.6 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = -3 / +3 Query: 252 VSMSATLAQPPHREQMPAAGLLLRTFRRWSTRKQKNTMPPLLLPRQALQKYR*NSRR 82 + + L PPHR + P A L R S R ++ + LLL R+ + R RR Sbjct: 573 IQLLLPLLPPPHRPRRPLAAQALPQVRGHSPRGRRRRLLLLLLLRRHRHRQRRRRRR 743
>LOC_Os08g06230:12008.t00513:unspliced-genomic nucleolar GTP-binding protein 1, putative, expressed| Length = 6385 Score = 31.8 bits (63), Expect = 4.6 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 / +1 Query: 47 CPPPPGTIIKYLRREFQRYFWRAWRGRRSGGMVFF 151 CPPPP T RR R W + G V F Sbjct: 106 CPPPPATATALARRLHHRRLPEGWSSLDASGTVVF 210
>LOC_Os08g05980:12008.t00490:unspliced-genomic expressed protein| Length = 234 Score = 31.8 bits (63), Expect = 4.6 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -3 / -3 Query: 87 RRRYLMMVPGGGGQCNTAS*AARRLC 10 RRR VPGG G CN+A RR C Sbjct: 118 RRRRGRRVPGGWGPCNSAPRTRRRPC 41
>LOC_Os06g24540:12006.t02265:unspliced-genomic expressed protein| Length = 3430 Score = 31.8 bits (63), Expect = 4.6 Identities = 16/63 (25%), Positives = 29/63 (46%) Frame = -2 / -3 Query: 544 CNNLQGQAS*RARLKTQINKQMEQTKLAGTYMHAPPPSANGTRVETAVARADQSASTTAG 365 C + Q QAS +R + +I +++ + G Y+ AP S + + A TT G Sbjct: 2774 CRSFQKQASGASRAEDRIGSDLQRFRTNGAYVAAPVTSGSSILNFCSAASLSGDFCTTGG 2595 Query: 364 LVE 356 ++ Sbjct: 2594 GID 2586
>LOC_Os06g09630:12006.t00841:unspliced-genomic 3-oxoacyl-synthase I, chloroplast precursor, putative, expressed| Length = 3385 Score = 31.8 bits (63), Expect = 4.6 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -3 / +2 Query: 228 QPPHREQMPAAGLLLRTFRRWSTRKQKNTMPPLL 127 Q PH + P GLLLR R R +PPLL Sbjct: 359 QLPHPLRRPDPGLLLRGLHRRQERPPPRRLPPLL 460
>LOC_Os04g29200:12004.t02614:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2499 Score = 31.8 bits (63), Expect = 4.6 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -3 / -1 Query: 186 LRTFRRWSTRKQKNTMPPLLLPRQALQKYR*NSRRR 79 LR+ R W R + +PPLL PR+ + + R +RR Sbjct: 1275 LRSRRSWPYRPRPPPLPPLLPPRRRVLRRRPRRQRR 1168
>LOC_Os03g61980:12003.t05426:unspliced-genomic CYP707A3, putative, expressed| Length = 3181 Score = 31.8 bits (63), Expect = 4.6 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = -3 / -2 Query: 255 AVSMSATLAQPPHREQMPAAGLLLRTFRRWSTRKQKNTMPPLLL 124 +VS+SA+ + PP AA L FR RK T PP LL Sbjct: 1317 SVSLSASRSPPPPPSSSSAAVPSLACFRSSVWRKSLRTSPPSLL 1186
>LOC_Os01g60480:12001.t05429:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4481 Score = 31.8 bits (63), Expect = 4.6 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +1 / +2 Query: 517 S*LGLGDCCTGFLWSYVHIVLCKVASLD* 603 +*LG CCT F+W+ +++VL ++ + * Sbjct: 1676 A*LGRDHCCTWFIWTILNLVLRPISQIQ* 1762
>LOC_Os01g43250:12001.t03841:unspliced-genomic seh1-like protein, putative, expressed| Length = 5141 Score = 31.8 bits (63), Expect = 4.6 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 / +3 Query: 38 VLHCPPPPGTIIKYLRREFQRYFWRAW 118 VL PPPP +LR E++ WR+W Sbjct: 78 VLSPPPPP*ARASHLREEWRSGRWRSW 158
>LOC_Os02g30320:12002.t02725:unspliced-genomic drought-induced protein 1, putative, expressed| Length = 1193 Score = 25.4 bits (49), Expect(2) = 4.7 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = -2 / -3 Query: 67 GAWWWW 50 G WWWW Sbjct: 591 GLWWWW 574 Score = 23.5 bits (45), Expect(2) = 4.7 Identities = 7/17 (41%), Positives = 7/17 (41%) Frame = -2 / -3 Query: 61 WWWWTVQYS*LGRAPPV 11 WWWW G PV Sbjct: 582 WWWWPRAMRRAGSGLPV 532
>LOC_Os12g36980:12012.t03378:unspliced-genomic hypothetical protein| Length = 705 Score = 25.4 bits (49), Expect(2) = 4.9 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = -2 / +1 Query: 61 WWWWTVQYS*LGRAPPVRSA 2 WWWW + + PP + A Sbjct: 505 WWWWWAGLAGALKKPPGKGA 564 Score = 23.5 bits (45), Expect(2) = 4.9 Identities = 6/13 (46%), Positives = 6/13 (46%) Frame = -2 / +1 Query: 88 SPEVFDDGAWWWW 50 SP WWWW Sbjct: 475 SPSPPPSPPWWWW 513
>LOC_Os11g44000:12011.t03930:unspliced-genomic hypothetical protein| Length = 2840 Score = 29.5 bits (58), Expect(2) = 5.1 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 / +2 Query: 167 QRRKVRSSKPAAGICSRCGGCAS 235 +RR S PAA CS CGG S Sbjct: 221 RRRSSSGSPPAASRCSSCGGSPS 289 Score = 23.1 bits (44), Expect(2) = 5.1 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +3 / +3 Query: 438 GGACMYVPASFVCSICLLICV 500 G CMY C LL+CV Sbjct: 1323 GAVCMYTRLLKPCITRLLVCV 1385
>LOC_Os11g33440:12011.t02938:unspliced-genomic expressed protein| Length = 2165 Score = 27.2 bits (53), Expect(2) = 5.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 / +2 Query: 116 WRGRRSGGMVFFCFLV 163 WR R +GG +FF FLV Sbjct: 599 WRCRCAGGGIFFLFLV 646 Score = 24.9 bits (48), Expect(2) = 5.4 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 / +3 Query: 266 CYLLTVHRVTWRAIICTFCGAM 331 C+ +TVHR WR + G+M Sbjct: 1551 CHTVTVHREAWRRPVELSPGSM 1616
>LOC_Os11g28340:12011.t02447:unspliced-genomic ER lumen protein retaining receptor, putative, expressed| Length = 3807 Score = 25.4 bits (49), Expect(2) = 5.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 / -1 Query: 222 PHREQMPAAGLLLRTFRRWSTRKQKNTMPP 133 P R +PA L++ FRR +T ++ M P Sbjct: 216 PRRGALPAQDLMVWIFRRSTTTLRRWVMSP 127 Score = 23.1 bits (44), Expect(2) = 5.8 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -3 / -2 Query: 108 QKYR*NSRRRYLMMVPGGGGQCN 40 ++ R +SRRR++ GG +CN Sbjct: 86 RRRRGSSRRRWMETEEEGGRRCN 18
>LOC_Os03g24730:12003.t02165:unspliced-genomic expressed protein| Length = 3609 Score = 26.3 bits (51), Expect(3) = 5.9 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +2 / +1 Query: 11 HRRRAA*LAVLHCPPPPGTIIKYLRREFQRYFWRAWRGRRSGGM 142 HRR+ A L + PPP + RR R R R R+ G + Sbjct: 898 HRRQRAALQLTALPPPRARARRPGRRHRHRRRSRPGRARQGGAV 1029 Score = 23.1 bits (44), Expect(3) = 5.9 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +2 / +3 Query: 209 CSRCGGCASVADMETATRLC 268 CSR CAS ++T LC Sbjct: 2091 CSR*AACASSCSTGSSTGLC 2150 Score = 21.7 bits (41), Expect(3) = 5.9 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +2 / +2 Query: 416 PRPVCRRRWSMHVCA 460 P P RR WS C+ Sbjct: 3116 PSPTPRRSWSATTCS 3160
>LOC_Os11g38980:12011.t03441:unspliced-genomic kelch motif family protein, expressed| Length = 2626 Score = 25.4 bits (49), Expect(2) = 5.9 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -2 / +3 Query: 103 ISLKLSPEVFDDGAWWWW 50 +SL L P WWWW Sbjct: 159 LSLSLLPICGARRRWWWW 212 Score = 23.1 bits (44), Expect(2) = 5.9 Identities = 4/4 (100%), Positives = 4/4 (100%) Frame = -2 / +3 Query: 61 WWWW 50 WWWW Sbjct: 204 WWWW 215
>LOC_Os09g25550:12009.t02234:unspliced-genomic expressed protein| Length = 3548 Score = 26.3 bits (51), Expect(2) = 6.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +2 / +2 Query: 62 GTIIKYLRREFQRYFWRAWRGRR 130 G I+K ++ +FW+ WR +R Sbjct: 2306 GCILKLGDQKMPVWFWKTWRNKR 2374 Score = 26.3 bits (51), Expect(2) = 6.1 Identities = 7/18 (38%), Positives = 15/18 (83%) Frame = +2 / +2 Query: 257 TRLCYLLTVHRVTWRAII 310 T +C++LTV + +WR+++ Sbjct: 2816 TTVCWMLTVRQDSWRSLL 2869
>LOC_Os07g48229:12007.t04455:unspliced-genomic vacuolar sorting receptor 1 precursor, putative, expressed| Length = 10235 Score = 30.9 bits (61), Expect(2) = 6.3 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 / +2 Query: 101 YFWRAWRGRRSGG 139 ++WR WRGRR GG Sbjct: 227 WWWRPWRGRRRGG 265 Score = 23.1 bits (44), Expect(2) = 6.3 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = +2 / +3 Query: 263 LCYLLTVHRVTWRAIIC 313 LC+++ V+WR ++C Sbjct: 2805 LCHIIVSL*VSWRKVLC 2855
>LOC_Os05g30510:12005.t02650:unspliced-genomic expressed protein| Length = 1161 Score = 25.4 bits (49), Expect(2) = 6.3 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -2 / -3 Query: 61 WWWWTVQYS*LGRAPP 14 WWWW + R+PP Sbjct: 457 WWWWRRRPRRRRRSPP 410 Score = 23.1 bits (44), Expect(2) = 6.3 Identities = 4/4 (100%), Positives = 4/4 (100%) Frame = -2 / -3 Query: 61 WWWW 50 WWWW Sbjct: 460 WWWW 449
>LOC_Os12g30940:12012.t02800:unspliced-genomic F-box domain containing protein| Length = 2388 Score = 31.3 bits (62), Expect = 6.3 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = -3 / +3 Query: 216 REQMPAAGLLLRTFRRWSTRKQKNTMPPLLLPRQALQKYR*NSRRRYL 73 R + PAAG + STR+++ PP P + L + R RR+L Sbjct: 234 RRRRPAAGATVHHQMHLSTRRRRRRRPPPPTPIRPLAQQRRRPGRRHL 377
>LOC_Os07g45770:12007.t04214:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1900 Score = 31.3 bits (62), Expect = 6.3 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 / -1 Query: 200 AGICSRCGGCASVADMETATRLCYLLTV 283 + I S C G + + + T T+LCYLL+V Sbjct: 850 SSISSICSGRSILKSIRTVTKLCYLLSV 767
>LOC_Os05g31530:12005.t02750:unspliced-genomic disease resistance protein RGA4, putative, expressed| Length = 5749 Score = 31.3 bits (62), Expect = 6.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 / +2 Query: 79 VFDDGAWWWWTVQYS*LGRA 20 VF +G WWWW Y+ +G A Sbjct: 308 VFFNGWWWWWWWVYAWIGLA 367
>LOC_Os01g72110:12001.t06500:unspliced-genomic Transposable element protein, putative, MuDR| Length = 3405 Score = 31.3 bits (62), Expect = 6.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 / +2 Query: 448 HAPPPSANGTRVETAVARADQSASTTAGLVEPV 350 H PPP +G V +ARAD ++ TA L + V Sbjct: 2021 HPPPPPPHGRVVRRLLARADPASIRTARLDDDV 2119
>LOC_Os03g60390:12003.t05278:unspliced-genomic PHD finger protein, putative, expressed| Length = 3833 Score = 28.1 bits (55), Expect(2) = 6.6 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -2 / +3 Query: 442 PPPSANGTRVETAVARADQSASTTAGLVEP 353 PPP A G +E + R D + AG VEP Sbjct: 66 PPPLAAGGGIECSSVRFDGNGPRGAGGVEP 155 Score = 24.4 bits (47), Expect(2) = 6.6 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = -2 / +3 Query: 67 GAWWWW 50 G WWWW Sbjct: 465 GWWWWW 482
>LOC_Os11g10790:12011.t00967:unspliced-genomic conserved hypothetical protein| Length = 333 Score = 24.0 bits (46), Expect(2) = 6.8 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = -2 / -3 Query: 67 GAWWWW 50 G WWWW Sbjct: 106 G*WWWW 89 Score = 24.0 bits (46), Expect(2) = 6.8 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -2 / -3 Query: 61 WWWWTVQYS*LGRAPP 14 WWWW + GR P Sbjct: 94 WWWWRRRCGGGGRRRP 47
>LOC_Os08g39350:12008.t03667:unspliced-genomic glycerophosphoryl diester phosphodiesterase family protein,| putative, expressed Length = 6221 Score = 24.4 bits (47), Expect(2) = 7.4 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = -2 / +2 Query: 67 GAWWWW 50 G WWWW Sbjct: 164 GWWWWW 181 Score = 23.5 bits (45), Expect(2) = 7.4 Identities = 6/16 (37%), Positives = 9/16 (56%) Frame = -2 / +2 Query: 61 WWWWTVQYS*LGRAPP 14 WWWW + + + PP Sbjct: 173 WWWWRWRRAAVVLRPP 220
>LOC_Os01g38530:12001.t03389:unspliced-genomic early flowering 3, putative, expressed| Length = 6081 Score = 25.4 bits (49), Expect(2) = 7.4 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 / -3 Query: 50 PPPPGTIIKYLRREFQRYFWRAWRGRRS 133 PPPP I RR Q R+ +GRR+ Sbjct: 259 PPPPPLIAASPRRNHQPTSSRSRKGRRT 176 Score = 22.6 bits (43), Expect(2) = 7.4 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 / -1 Query: 107 WRAWRGRRSGGMVFFCFLVDQRRKVR 184 WR G R GG + +RRK+R Sbjct: 120 WRGGGGARGGGRCLWWPWNGRRRKLR 43
>LOC_Os02g45630:12002.t04150:unspliced-genomic hypothetical protein| Length = 3873 Score = 24.9 bits (48), Expect(2) = 7.7 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -2 / +2 Query: 61 WWWWTVQYS*LGRAPP 14 WWWW + + L PP Sbjct: 29 WWWW*GREAPLAPLPP 76 Score = 23.1 bits (44), Expect(2) = 7.7 Identities = 4/4 (100%), Positives = 4/4 (100%) Frame = -2 / +2 Query: 61 WWWW 50 WWWW Sbjct: 20 WWWW 31
>LOC_Os08g33640:12008.t03105:unspliced-genomic expressed protein| Length = 2909 Score = 24.9 bits (48), Expect(2) = 7.9 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -2 / +1 Query: 97 LKLSPEVFDDGAWWWW 50 L+ SP WWWW Sbjct: 94 LRSSPSPSRRRRWWWW 141 Score = 23.1 bits (44), Expect(2) = 7.9 Identities = 4/4 (100%), Positives = 4/4 (100%) Frame = -2 / +1 Query: 61 WWWW 50 WWWW Sbjct: 133 WWWW 144
>LOC_Os01g39110:12001.t03444:unspliced-genomic zinc finger protein, putative, expressed| Length = 2648 Score = 24.0 bits (46), Expect(2) = 7.9 Identities = 4/8 (50%), Positives = 6/8 (75%) Frame = -2 / -2 Query: 73 DDGAWWWW 50 + +WWWW Sbjct: 1801 EKSSWWWW 1778 Score = 24.0 bits (46), Expect(2) = 7.9 Identities = 7/20 (35%), Positives = 9/20 (45%) Frame = -2 / -2 Query: 61 WWWWTVQYS*LGRAPPVRSA 2 WWWW + PP+ A Sbjct: 1771 WWWWCPGAAMAAGMPPMALA 1712
>LOC_Os06g33940:12006.t03090:unspliced-genomic NAC domain-containing protein 76, putative, expressed| Length = 2593 Score = 24.9 bits (48), Expect(2) = 8.0 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = -2 / -2 Query: 61 WWWWTVQYS*LGRAPP 14 WWWW S L A P Sbjct: 1713 WWWWPPAPSCLWSAAP 1666 Score = 23.1 bits (44), Expect(2) = 8.0 Identities = 4/4 (100%), Positives = 4/4 (100%) Frame = -2 / -2 Query: 61 WWWW 50 WWWW Sbjct: 1716 WWWW 1705
>LOC_Os12g42900:12012.t03963:unspliced-genomic anther-specific proline-rich protein APG, putative, expressed| Length = 1658 Score = 24.4 bits (47), Expect(2) = 8.2 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -2 / -3 Query: 61 WWWWTVQYS*LGRAPP 14 WWWW + GR P Sbjct: 930 WWWWLRLWLDNGRGVP 883 Score = 23.5 bits (45), Expect(2) = 8.2 Identities = 4/5 (80%), Positives = 5/5 (100%) Frame = -2 / -3 Query: 64 AWWWW 50 +WWWW Sbjct: 939 SWWWW 925
>LOC_Os12g03110:12012.t00204:unspliced-genomic zinc finger homeodomain protein 1, putative| Length = 739 Score = 30.9 bits (61), Expect = 8.7 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = -3 / +2 Query: 240 ATLAQPPHREQMPAAGLLLRTFRRWSTRKQKNTMPPLLLPRQA 112 A +A PP PAA T RW + T PP P A Sbjct: 182 APMAPPPRSSAPPAAATRASTGERWRPPRPNATAPPTPPPAPA 310
>LOC_Os11g44110:12011.t03939:unspliced-genomic hypothetical protein| Length = 839 Score = 30.9 bits (61), Expect = 8.7 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 / -3 Query: 122 GRRSGGMVFFCFLVDQRRKVRSSKPAAGICSRCGG 226 GRR C +RR S PAA CS CGG Sbjct: 588 GRRG*SSCRCCSRWRRRRSSSGSPPAASRCSSCGG 484
>LOC_Os11g08330:12011.t00724:unspliced-genomic DNA polymerase delta catalytic subunit, putative, expressed| Length = 10348 Score = 30.9 bits (61), Expect = 8.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 / -2 Query: 85 PEVFDDGAWWWWTVQYS 35 P V G+WWWW + +S Sbjct: 5505 PHVRIFGSWWWWQIHHS 5455
>LOC_Os09g07100:12009.t00506:unspliced-genomic expressed protein| Length = 616 Score = 30.9 bits (61), Expect = 8.7 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = -3 / -1 Query: 192 LLLRTFRRWSTRKQKNTMPPLLLPRQALQKYR*NSRRRYLM 70 LL R+ W R++ PPLL R A + R RRR L+ Sbjct: 277 LLARSSPEWPPRRRPVASPPLLRLRPAAVRRRYADRRRRLL 155
>LOC_Os07g11580:12007.t01031:unspliced-genomic circumsporozoite protein precursor, putative| Length = 630 Score = 30.9 bits (61), Expect = 8.7 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = -3 / -3 Query: 192 LLLRTFRRWSTRKQKNTMPPLLLPRQALQKYR*NSRRRYLM 70 LL R+ W R++ PPLL R A + R RRR L+ Sbjct: 286 LLARSSLEWPPRRRPVASPPLLRLRPAAVRRRYADRRRRLL 164
>LOC_Os06g50380:12006.t04722:unspliced-genomic protein phosphatase 2C, putative, expressed| Length = 4723 Score = 30.9 bits (61), Expect = 8.7 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 / +1 Query: 104 FWRAWRGRRSGGMVFFCFLV 163 FWR+W GG+V+FC V Sbjct: 505 FWRSWAFGGGGGIVWFCMRV 564
>LOC_Os06g44980:12006.t04185:unspliced-genomic conserved hypothetical protein| Length = 512 Score = 30.9 bits (61), Expect = 8.7 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 / +3 Query: 167 QRRKVRSSKPAAGICSRCGGCASVADMETATRLCYL 274 + K+ + A G C CGG + D+E LC+L Sbjct: 126 KEEKLLGVQKAPGSCPYCGGGVAATDVEAKWVLCFL 233
>LOC_Os06g37460:12006.t03441:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1913 Score = 30.9 bits (61), Expect = 8.7 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 / -3 Query: 80 LRREFQRYFWRAWRGRRSGG 139 +RR R FWR+W R GG Sbjct: 1911 MRRPRSRQFWRSWTDHRQGG 1852
>LOC_Os05g44220:12005.t03911:unspliced-genomic hypothetical protein| Length = 507 Score = 30.9 bits (61), Expect = 8.7 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +2 / -3 Query: 53 PPPGTIIKYLRREFQRYFWRAWRGRRSGG 139 PPPGT RR +R + W RRSGG Sbjct: 259 PPPGTPPPARRRRRRRRARQPWTRRRSGG 173
>LOC_Os05g43960:12005.t03885:unspliced-genomic no apical meristem protein, expressed| Length = 1634 Score = 30.9 bits (61), Expect = 8.7 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = +2 / -3 Query: 119 RGRRSGGMVFFCFLVDQRRKVRSSKPAAGICSRCGGCASVADMETAT 259 RGRR V + +R V ++ AAG C+ C+ A TA+ Sbjct: 1275 RGRRRDAPVAAAVALGRRAPVAAAPAAAGSCAPATACSCAASSATAS 1135
>LOC_Os05g26520:12005.t02306:unspliced-genomic transposon protein, putative, unclassified| Length = 1951 Score = 30.9 bits (61), Expect = 8.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 / +3 Query: 395 ARDGRLHPRPVCRRRW 442 A GR HPRP RRRW Sbjct: 6 AASGRRHPRPYGRRRW 53
>LOC_Os04g51680:12004.t04644:unspliced-genomic expressed protein| Length = 901 Score = 30.9 bits (61), Expect = 8.7 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 / +1 Query: 176 KVRSSKPAAGICSRCGGCASVADMETATRLCYL 274 +V + A G C RCGG D+E+ R+ L Sbjct: 181 RVVGTHKAPGACPRCGGAVVATDVESERRILCL 279
>LOC_Os04g50770:12004.t04555:unspliced-genomic myb-related protein Zm1, putative, expressed| Length = 1952 Score = 30.9 bits (61), Expect = 8.7 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 / -1 Query: 64 AWWWWTVQYS*LGRAPPVRSA 2 +WWWWT GRA RS+ Sbjct: 794 SWWWWTTTAMGTGRARRCRSS 732
>LOC_Os01g31700:12001.t02752:unspliced-genomic hypothetical protein| Length = 318 Score = 30.9 bits (61), Expect = 8.7 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 / +3 Query: 386 LICARDGRLHPRPVCRRR 439 L+ AR R HP+P CRRR Sbjct: 45 LVAARRSRPHPKPWCRRR 98
>LOC_Os01g05770:12001.t00461:unspliced-genomic expressed protein| Length = 3289 Score = 30.9 bits (61), Expect = 8.7 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 / -3 Query: 10 AQAARGLASCIALSTTTRHHHQIPP 84 AQ +RG+ L RHHHQ PP Sbjct: 653 AQLSRGVGCPPQLGLRRRHHHQAPP 579 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 232,592,020 Number of extensions: 4214566 Number of successful extensions: 27326 Number of sequences better than 10.0: 88 Length of query: 207 Length of database: 55,613,886 Length adjustment: 48 Effective length of query: 159 Effective length of database: 52,912,542 Effective search space: 8413094178 Effective search space used: 8413094178 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
