| Clone Name | FLbaf26k21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | P10541:E1A_ADE40 Early E1A 27 kDa protein - Human adenovirus 40 ... | 32 | 2.3 | 2 | Q1RMR2:RU17_BOVIN U1 small nuclear ribonucleoprotein 70 kDa - Bo... | 31 | 6.8 | 3 | Q8TAX7:MUC7_HUMAN Mucin-7 precursor - Homo sapiens (Human) | 30 | 8.8 | 4 | Q8R4K8:PAPP1_MOUSE Pappalysin-1 precursor - Mus musculus (Mouse) | 30 | 8.8 |
|---|
>P10541:E1A_ADE40 Early E1A 27 kDa protein - Human adenovirus 40 (HAdV-40)| Length = 249 Score = 32.3 bits (72), Expect = 2.3 Identities = 26/86 (30%), Positives = 36/86 (41%), Gaps = 8/86 (9%) Frame = +1 Query: 19 QATKKQLLH*LLPSRRSQDEERKGRE*YFQRFPRRVKRERSRTEDVHGPITGAGQE---- 186 +A+++ LH L EE +E FP R+ E + +G G+E Sbjct: 33 EASEEMSLHDLFDVEVDGFEEDANQEAVDGMFPERLLSEAESAAESGSGDSGVGEELLPV 92 Query: 187 --DLACHR--LPPRPPANSWAEEAEE 252 DL C+ LPP P A EAEE Sbjct: 93 DLDLKCYEDGLPPSDPETDEATEAEE 118
>Q1RMR2:RU17_BOVIN U1 small nuclear ribonucleoprotein 70 kDa - Bos taurus (Bovine)| Length = 439 Score = 30.8 bits (68), Expect = 6.8 Identities = 31/109 (28%), Positives = 43/109 (39%), Gaps = 7/109 (6%) Frame = +1 Query: 1 ERRLRRQATKKQLLH*LLPSRRSQDEERKGRE*YFQRFPRRVKRERSRTEDVHGPITGAG 180 +RR R ++ K+ + +D +RK R R R +RER R E++ G G G Sbjct: 261 DRRRRSRSRDKEERRRSRERSKDKDRDRKRRS---SRSRERARRERERKEELRGGGGGGG 317 Query: 181 Q--EDLACHRLPP--RPPAN---SWAEEAEEGGEDVRVPRRAHHVGDAE 306 E PP PP + EE G D RR H + E Sbjct: 318 DMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDRDRDRRRSHRSERE 366
>Q8TAX7:MUC7_HUMAN Mucin-7 precursor - Homo sapiens (Human)| Length = 377 Score = 30.4 bits (67), Expect = 8.8 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 5/25 (20%) Frame = -3 Query: 719 SACVSFSEGSSSD-----RRHHHNS 660 SAC SFSEG D RRHHH S Sbjct: 14 SACFSFSEGRERDHELRHRRHHHQS 38
>Q8R4K8:PAPP1_MOUSE Pappalysin-1 precursor - Mus musculus (Mouse)| Length = 1624 Score = 30.4 bits (67), Expect = 8.8 Identities = 21/59 (35%), Positives = 25/59 (42%), Gaps = 3/59 (5%) Frame = +1 Query: 115 PRRVKRERSRTEDVH---GPITGAGQEDLACHRLPPRPPANSWAEEAEEGGEDVRVPRR 282 PRRV+R+ GP T A + PP PP +W E VRVPRR Sbjct: 25 PRRVRRDPRAVRPPRPAAGPATCATRAARGRRASPPPPPGGAW--------EAVRVPRR 75 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 137,553,149 Number of extensions: 3120005 Number of successful extensions: 8965 Number of sequences better than 10.0: 4 Number of HSP's gapped: 8957 Number of HSP's successfully gapped: 4 Length of query: 275 Length of database: 100,686,439 Length adjustment: 112 Effective length of query: 163 Effective length of database: 69,965,399 Effective search space: 11404360037 Effective search space used: 11404360037 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)