| Clone Name | FLbaf28o10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | P32660:ATC5_YEAST Probable phospholipid-transporting ATPase DNF1... | 32 | 2.5 | 2 | Q6DCC7:LYSM4_XENLA LysM and putative peptidoglycan-binding domai... | 31 | 5.5 |
|---|
>P32660:ATC5_YEAST Probable phospholipid-transporting ATPase DNF1 - Saccharomyces| cerevisiae (Baker's yeast) Length = 1571 Score = 32.3 bits (72), Expect = 2.5 Identities = 19/57 (33%), Positives = 25/57 (43%) Frame = +2 Query: 104 RVVGSPGTWSGMALRLSQCVFAAASNFALHSAFGYSDYSAFFYLNVVLILQLMWSLG 274 R+ G+P W+ VF A F L F Y + FFY V I++ MW G Sbjct: 1371 RIYGAPSFWA---------VFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQHG 1418
>Q6DCC7:LYSM4_XENLA LysM and putative peptidoglycan-binding domain-containing protein 4| - Xenopus laevis (African clawed frog) Length = 289 Score = 31.2 bits (69), Expect = 5.5 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = -1 Query: 177 EAAAKTHCDSRSAMPLHVPGLPTTRFICLGSACCGEDDGVSW 52 EAAA+TH + L P LP TR + G D G+ W Sbjct: 168 EAAAQTHDLFNESFALDSPSLPPTRILGQKQPASGADWGIRW 209 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 141,509,292 Number of extensions: 2977257 Number of successful extensions: 6979 Number of sequences better than 10.0: 2 Number of HSP's gapped: 6969 Number of HSP's successfully gapped: 2 Length of query: 286 Length of database: 100,686,439 Length adjustment: 112 Effective length of query: 174 Effective length of database: 69,965,399 Effective search space: 12173979426 Effective search space used: 12173979426 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)