| Clone Name | FLbaf34p02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q6L406:R1B19_SOLDE Putative late blight resistance protein homol... | 40 | 0.021 | 2 | Q6L440:R1A3_SOLDE Putative late blight resistance protein homolo... | 40 | 0.021 | 3 | Q9W6S3:SIN1_CHICK Stress-activated map kinase-interacting protei... | 32 | 3.4 |
|---|
>Q6L406:R1B19_SOLDE Putative late blight resistance protein homolog R1B-19 - Solanum| demissum (Wild potato) Length = 1326 Score = 39.7 bits (91), Expect = 0.021 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 2/65 (3%) Frame = +3 Query: 180 KKIVVKLELHDNKDKQKAMKAVSVLVGIDAISMDMASRKMTVLGTVDPVDVVS--KLRKG 353 +K +KL L ++D KA K + + GI+++S D +K+TV G VD +S + K Sbjct: 1210 EKKTLKLNLSHDEDIPKAFKRLFLCPGIESVSTDRKEKKLTVTGDVDAGSSISCGETEKA 1269 Query: 354 WAAYI 368 W A + Sbjct: 1270 WHARV 1274
>Q6L440:R1A3_SOLDE Putative late blight resistance protein homolog R1A-3 - Solanum| demissum (Wild potato) Length = 775 Score = 39.7 bits (91), Expect = 0.021 Identities = 17/51 (33%), Positives = 35/51 (68%) Frame = +3 Query: 180 KKIVVKLELHDNKDKQKAMKAVSVLVGIDAISMDMASRKMTVLGTVDPVDV 332 KK++++ ++ +K+ A K ++ L G+D+IS+DM +K+TV G ++ +V Sbjct: 712 KKMILQFDISHDKEIDNAFKRLASLPGVDSISIDMIEKKLTVGGDMNANEV 762
>Q9W6S3:SIN1_CHICK Stress-activated map kinase-interacting protein 1 - Gallus gallus| (Chicken) Length = 522 Score = 32.3 bits (72), Expect = 3.4 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +3 Query: 156 GRIGAMAAKKIVVKLELHDNKDKQKAMKAVSV 251 G +G A KKI V L LH N+DK + M V++ Sbjct: 167 GHVGTTATKKIDVYLPLHANQDKLQPMTVVTI 198 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 93,027,378 Number of extensions: 1661648 Number of successful extensions: 4122 Number of sequences better than 10.0: 3 Number of HSP's gapped: 4122 Number of HSP's successfully gapped: 3 Length of query: 354 Length of database: 100,686,439 Length adjustment: 114 Effective length of query: 240 Effective length of database: 69,416,809 Effective search space: 16660034160 Effective search space used: 16660034160 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)