| Clone Name | FLbaf31k10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q9Z213:ALEX_RAT Protein ALEX - Rattus norvegicus (Rat) | 33 | 1.6 | 2 | O35181:NRG3_MOUSE Pro-neuregulin-3, membrane-bound isoform precu... | 32 | 3.5 | 3 | P56975:NRG3_HUMAN Pro-neuregulin-3, membrane-bound isoform precu... | 32 | 3.5 |
|---|
>Q9Z213:ALEX_RAT Protein ALEX - Rattus norvegicus (Rat)| Length = 738 Score = 32.7 bits (73), Expect = 1.6 Identities = 22/58 (37%), Positives = 29/58 (50%) Frame = +2 Query: 173 LSVWDLQHFMVLLRPDPARTPTQLQLQEQESWLVFDFQPRNPEDALAAFSVLSRSKIP 346 LS+W V+ RP +R P QL+ Q + D QPR E AL+A + R K P Sbjct: 263 LSIWTAPQSQVMARPSKSREP-QLRASTQRDPHLSDKQPRQ-ETALSAAPLQRRQKSP 318
>O35181:NRG3_MOUSE Pro-neuregulin-3, membrane-bound isoform precursor - Mus musculus| (Mouse) Length = 713 Score = 31.6 bits (70), Expect = 3.5 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -3 Query: 182 THSASTPKTSGPGPDPEGPSAARPPRTLRTS 90 T +A+ +G GPD G AA PPR LR S Sbjct: 25 TAAAAAAAAAGGGPDGGGEGAAEPPRELRCS 55
>P56975:NRG3_HUMAN Pro-neuregulin-3, membrane-bound isoform precursor - Homo sapiens| (Human) Length = 720 Score = 31.6 bits (70), Expect = 3.5 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -3 Query: 182 THSASTPKTSGPGPDPEGPSAARPPRTLRTS 90 T +A+ +G GPD G AA PPR LR S Sbjct: 25 TAAAAAAAAAGGGPDGGGEGAAEPPRELRCS 55 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 113,095,513 Number of extensions: 2286410 Number of successful extensions: 9084 Number of sequences better than 10.0: 3 Number of HSP's gapped: 9070 Number of HSP's successfully gapped: 3 Length of query: 255 Length of database: 100,686,439 Length adjustment: 111 Effective length of query: 144 Effective length of database: 70,239,694 Effective search space: 10114515936 Effective search space used: 10114515936 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)