| Clone Name | FLbaf28j12 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os02g30310:12002.t02724:unspliced-genomic ubiquitin-activating enzyme E1 domain-containing protein 1, putative,| expressed Length = 10798 Score = 32.7 bits (65), Expect(2) = 0.002 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +1 / +2 Query: 34 LDLVRIRLKWCVGNPNQIPLFASLPTELAISVDVASACSNRTE 162 ++LV + + V P + + PTEL ISVD+AS + E Sbjct: 10418 INLVSTKAQHWVRKPTWVLMLVFTPTELPISVDIASVHTKEVE 10546 Score = 26.7 bits (52), Expect(2) = 0.002 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +3 / +3 Query: 3 LQRQLDALNSS* 38 LQRQLDALNSS* Sbjct: 10356 LQRQLDALNSS* 10391 Score = 30.9 bits (61), Expect = 4.5 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -1 / -1 Query: 144 SRCYID*NR*LCRKGRKQWYLVWVSN 67 +R YI *N *LCR K Y W SN Sbjct: 10528 NRSYIH*NG*LCRSKHKHQYPGWFSN 10451
>LOC_Os02g42630:12002.t03848:unspliced-genomic hypothetical protein| Length = 439 Score = 33.1 bits (66), Expect = 0.92 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 / +1 Query: 52 RLKWCVGNPNQIPLFASLPTELAISVDVASACSN 153 RL+WCVG+ + + A+ T L D S CS+ Sbjct: 193 RLRWCVGSQGSVRIAATGATPLRRQGDTISGCSD 294
>LOC_Os10g19910:12010.t01490:unspliced-genomic expressed protein| Length = 2024 Score = 32.7 bits (65), Expect = 1.3 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = -1 / +2 Query: 387 VFFFFFSW*KYGIFDFACRHTSYRKVQYRFYSIYAVTVHKFYSTSDY 247 V FF+F + YG F +C H ++Q + + + V++ S S++ Sbjct: 557 VLFFYFPFHAYGFFPCSCFHVHIFRMQTKVHPNFIVSIDLQVSRSEH 697
>LOC_Os03g08900:12003.t00746:unspliced-genomic transparent testa 12 protein, putative, expressed| Length = 9295 Score = 31.8 bits (63), Expect = 2.4 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -1 / +3 Query: 324 SYRKVQYRFYSIYAVTVHKFYSTSDYGGTLINTRLLKS 211 SY + Y I A++ FY SD+ +LIN R+ +S Sbjct: 5535 SYSNIPYFLIRISAISKLYFYMESDFSFSLINMRISRS 5648
>LOC_Os10g27030:12010.t02110:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2887 Score = 27.2 bits (53), Expect(2) = 2.7 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 / +1 Query: 360 KYGIFDFACRHTSYRKVQYRFYSIYAVTVH 271 + IFD+ACR +S+ F +I+ TV+ Sbjct: 319 RIAIFDWACRTSSFEPSAELFGAIFFATVN 408 Score = 24.4 bits (47), Expect(2) = 2.7 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -2 / +1 Query: 89 GIWFGFPTHHLSR 51 G WFGF HH R Sbjct: 2551 GRWFGFGLHHCVR 2589
>LOC_Os04g33500:12004.t03026:unspliced-genomic protein kinase KIPK, putative, expressed| Length = 3802 Score = 31.3 bits (62), Expect = 3.2 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -2 / -3 Query: 116 NSVGRDANNGIWFGFPTHHLSRIRT 42 NS G NN IW G PT +++RT Sbjct: 1004 NSCGLTTNNRIWGGHPTADAAQVRT 930
>LOC_Os04g41599:12004.t03718:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 10052 Score = 24.9 bits (48), Expect(2) = 3.8 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +3 / -3 Query: 294 CKICTELSCKMCVY 335 C C LSC+MC + Sbjct: 2796 CSSCLGLSCRMCTH 2755 Score = 23.1 bits (44), Expect(2) = 3.8 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 / -2 Query: 243 RHSQRLNRTCEP*QHIYCKICT 308 RH QR +C + C++CT Sbjct: 2968 RHEQRCFGSCSSCLGLSCRMCT 2903
>LOC_Os06g15810:12006.t01454:unspliced-genomic integral membrane protein DUF6 containing protein, expressed| Length = 2220 Score = 30.9 bits (61), Expect = 4.5 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 / +1 Query: 387 VFFFFFSW*KYG 352 VFFFFFSW* YG Sbjct: 1237 VFFFFFSW*LYG 1272
>LOC_Os06g03120:12006.t00205:unspliced-genomic aspartic proteinase nepenthesin-2 precursor, putative, expressed| Length = 1893 Score = 30.4 bits (60), Expect = 6.1 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = +3 / +1 Query: 288 IYCKICTELSCKMCV 332 ++CK+C +L CK+C+ Sbjct: 1813 LWCKLCIKLRCKLCI 1857
>LOC_Os05g11140:12005.t00946:unspliced-genomic ATP binding protein, putative, expressed| Length = 9881 Score = 30.4 bits (60), Expect = 6.1 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -3 / +3 Query: 316 ESSVQILQYICCHGSQVLFNL*LWRNSHQHPPLKI*I 206 E + + ++ H SQVL L*L NS H K *I Sbjct: 6057 EGTALLTNFLVSHNSQVLIGL*LCPNSKSHVNAKF*I 6167
>LOC_Os12g14720:12012.t01332:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 8566 Score = 30.4 bits (60), Expect = 6.2 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 / -2 Query: 342 FACRHTSYRKVQYRFYSIYAVTVHKFYSTS 253 F T + QY FYS Y H+FYS+S Sbjct: 5247 FVITQT*LKASQYYFYSCYL*KSHRFYSSS 5158
>LOC_Os09g39650:12009.t03430:unspliced-genomic ATP binding protein, putative, expressed| Length = 4205 Score = 30.4 bits (60), Expect = 6.2 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 / -1 Query: 288 YAVTVHKFYSTSDYGGTLINT 226 Y + VH F STS +GG INT Sbjct: 158 YLIVVHHFSSTSLHGGICINT 96
>LOC_Os02g10970:12002.t00945:unspliced-genomic peptidyl-prolyl cis-trans isomerase 1, putative, expressed| Length = 8089 Score = 30.4 bits (60), Expect = 6.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 / +1 Query: 387 VFFFFFSW*KYGIFDFACRHTSYRKVQYR 301 + FFF +*K+ + CRH SYR + R Sbjct: 7066 ILIFFFHF*KFKLKCIFCRHMSYRGSRQR 7152
>LOC_Os01g70060:12001.t06308:unspliced-genomic expressed protein| Length = 13788 Score = 30.4 bits (60), Expect = 6.2 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +1 / -1 Query: 172 LCFPVMQFWIGRFRF*E 222 +C V+ FWIGRFR+ E Sbjct: 9963 ICRTVLSFWIGRFRYQE 9913
>LOC_Os09g07300:12009.t003571:unspliced-genomic BIG, putative, expressed| Length = 17713 Score = 29.9 bits (59), Expect = 8.4 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 / +1 Query: 125 QSM*HLLVLTERRNVSCVFQSCNFG 199 Q *H+LVL++ SC+FQ FG Sbjct: 11188 QDF*HILVLSQSYKHSCIFQCSFFG 11262
>LOC_Os03g56580:12003.t04917:unspliced-genomic NAC domain-containing protein 42, putative, expressed| Length = 2284 Score = 29.9 bits (59), Expect = 8.4 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 / -2 Query: 48 DPAQMVCWKPKPDTIVCVPS 107 DP Q CW P P +I+ P+ Sbjct: 165 DPLQTPCWSPSPRSIIIEPT 106
>LOC_Os12g36560:12012.t03337:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3226 Score = 29.9 bits (59), Expect = 8.5 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 / +3 Query: 213 SESPDPKLHDWKTQLTFLRSVRTSRC 136 S P P+ W+T +F R R SRC Sbjct: 2457 SRRPRPRRSGWRTTCSFARQRRRSRC 2534
>LOC_Os06g34950:12006.t03192:unspliced-genomic hypothetical protein| Length = 1412 Score = 29.9 bits (59), Expect = 8.5 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = -1 / +3 Query: 387 VFFFFFSW*KYGIFDFACRHTSYRKVQYRFYSIYAVTVHKFYSTSDY 247 V FF+ + YG F +C H ++Q + + + V++ S S++ Sbjct: 372 VLFFYLPFHAYGFFPCSCFHVHIFRMQTKVHPKFIVSIDLQVSRSEH 512
>LOC_Os03g53280:12003.t04650:unspliced-genomic beige/BEACH domain containing protein, expressed| Length = 17474 Score = 29.9 bits (59), Expect = 8.5 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 / -2 Query: 93 QWYLVWVSNTPFEPDPHEVKMSLV 22 +WYL T F P+P EV++ L+ Sbjct: 1993 RWYLFRAGRTEFFPEPPEVQLQLI 1922 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 165,992,753 Number of extensions: 2746240 Number of successful extensions: 9226 Number of sequences better than 10.0: 19 Length of query: 129 Length of database: 55,613,886 Length adjustment: 47 Effective length of query: 82 Effective length of database: 52,968,820 Effective search space: 4343443240 Effective search space used: 4343443240 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)