| Clone Name | FLbaf31a11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | P77694:YAGW_ECOLI Uncharacterized protein yagW - Escherichia coli | 35 | 2.0 |
|---|
>P77694:YAGW_ECOLI Uncharacterized protein yagW - Escherichia coli| Length = 547 Score = 34.7 bits (78), Expect = 2.0 Identities = 27/62 (43%), Positives = 29/62 (46%), Gaps = 4/62 (6%) Frame = +3 Query: 2034 GRICSGLFSLDIGYIPFTSGIEAVIEVFAKVDGPHHVRFG----AFSSGFDHEIVLFDDT 2201 G + SG +LD GYI TSG A EV KV GP V G FSS V F T Sbjct: 399 GYVGSGESALDFGYIVTTSGKTAADEVLIKVTGPAQVIGGRSYCVFSSDDGKAKVPFPAT 458 Query: 2202 FS 2207 S Sbjct: 459 LS 460 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 465,151,882 Number of extensions: 10542477 Number of successful extensions: 22476 Number of sequences better than 10.0: 1 Number of HSP's gapped: 22465 Number of HSP's successfully gapped: 1 Length of query: 864 Length of database: 100,686,439 Length adjustment: 122 Effective length of query: 742 Effective length of database: 67,222,449 Effective search space: 49879057158 Effective search space used: 49879057158 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)