ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf29j17 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os11g11460:12011.t01034:unspliced-genomic hypothetical protein| Length = 594 Score = 36.3 bits (73), Expect(3) = 0.008 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = -1 / +2 Query: 799 RQRQRLTGHSRRCCYAALPAMNSCTRR*EPTRGRARPAGHPSTRGG 662 R+R++ G RR C++ P C R P PAG P RGG Sbjct: 125 RRRRQWGGRRRRICFSPPPLPCCCLRELPPPPS*LLPAGLPRRRGG 262 Score = 22.6 bits (43), Expect(3) = 0.008 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -3 / +1 Query: 191 TRGAAPSPRTWRPVPETTERR 129 +R P+P +W+P+ E R Sbjct: 283 SRRLDPAPSSWQPIAERRRPR 345 Score = 22.1 bits (42), Expect(3) = 0.008 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -1 / +2 Query: 61 QGRTREGGNWRRWGDREG 8 +GR RW DREG Sbjct: 449 EGREERRKKGERWRDREG 502
>LOC_Os06g14560:12006.t01331:unspliced-genomic hypothetical protein| Length = 1193 Score = 33.1 bits (66), Expect(2) = 0.012 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -3 / -2 Query: 680 PIYAGRGPCYKHTCTPTRPAKATPRSCCRG 591 P+ AGR C + CT A R CCRG Sbjct: 247 PLSAGRQSCQRRACTIGPAAACDRRWCCRG 158 Score = 30.4 bits (60), Expect(2) = 0.012 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -1 / -2 Query: 775 HSRRCCYAALPAMNSCTRR*EPTRGRARPAGHP 677 H RRC A++ A C+RR GR R HP Sbjct: 472 HHRRCPGASVVAPLGCSRRRVQHHGRIRQGCHP 374
>LOC_Os04g33300:12004.t03006:unspliced-genomic uridylate kinase, putative, expressed| Length = 2987 Score = 41.4 bits (84), Expect = 0.016 Identities = 20/41 (48%), Positives = 22/41 (53%) Frame = -1 / -2 Query: 814 SDYWERQRQRLTGHSRRCCYAALPAMNSCTRR*EPTRGRAR 692 SD QRQR G + CCYAA A+ C RR PT R R Sbjct: 457 SDPRTNQRQRCKGGATFCCYAAAVAVACCRRRRPPTPWRKR 335
>LOC_Os08g14770:12008.t01351:unspliced-genomic BIO1, putative, expressed| Length = 8232 Score = 40.9 bits (83), Expect = 0.022 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +3 / -2 Query: 108 CSASSVNPPFRRLRHRPPCPGARGGSPR 191 C+ + PP R PPCPGARGG PR Sbjct: 521 CTRAPSPPPPPHRRSSPPCPGARGGDPR 438
>LOC_Os10g28210:12010.t02175:unspliced-genomic plant-specific domain TIGR01615 family protein, expressed| Length = 1815 Score = 29.5 bits (58), Expect(2) = 0.023 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 / +3 Query: 156 PPCPGARGGSPRPIPGVRTPRS 221 PPC G SP P P TP S Sbjct: 786 PPCASPAGTSPPPTPPASTPTS 851 Score = 29.0 bits (57), Expect(2) = 0.023 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 / +1 Query: 114 ASSVNPPFRRLRHRPPCPGARG 179 A PP RRLR R PG RG Sbjct: 661 APGAQPPRRRLRPRGAAPGGRG 726
>LOC_Os05g43880:12005.t03877:unspliced-genomic gibberellin 2-beta-dioxygenase, putative, expressed| Length = 1758 Score = 30.4 bits (60), Expect(2) = 0.031 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -2 / -2 Query: 630 SPGKSHAAQLLPG*PTAALPQRGQPSPGAATTRG 529 +P SHA P P+AA G P+P ++T G Sbjct: 155 NPNLSHARTTSPAAPSAARSTTGNPAPKLSSTDG 54 Score = 27.6 bits (54), Expect(2) = 0.031 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = -1 / -3 Query: 793 RQRLTGHSRRCCYAALPAMNSCTRR*EPTRGRARPAGHPSTR 668 R+R G R +C+R TRGRARP+ +TR Sbjct: 352 RRRWRGGGTRATPCRHCGRCACSRTRTATRGRARPSPPAATR 227
>LOC_Os04g25800:12004.t02287:unspliced-genomic cytokinin-O-glucosyltransferase 2, putative| Length = 1512 Score = 28.1 bits (55), Expect(3) = 0.033 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 / +2 Query: 635 PTRPAKATPRSCCRGSLPR 579 P R A AT CCRGS+ R Sbjct: 287 P*RTASATSLRCCRGSMSR 343 Score = 23.1 bits (44), Expect(3) = 0.033 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 / +3 Query: 706 RGRARPAGHP 677 RGR R AGHP Sbjct: 240 RGRGRHAGHP 269 Score = 22.6 bits (43), Expect(3) = 0.033 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 / +2 Query: 597 PG*PTAALPQRGQPSPGAA 541 PG* P+ G+P+P A+ Sbjct: 410 PG*SACRAPRCGRPAPAAS 466 Score = 32.2 bits (64), Expect(2) = 6.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 / -3 Query: 215 RGPNAGNGTRGAAPSPRTWRPVPETTERR 129 RG AG R AA R WRP P RR Sbjct: 802 RGGGAGRRRRPAAGGRRAWRPAPAARGRR 716 Score = 22.1 bits (42), Expect(2) = 6.0 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -3 / -1 Query: 1313 PCTNAYLPTHQQHELQDHIPLPYIHALSHP 1224 P LP H + H+P P + A HP Sbjct: 1368 PYLTPLLPLHGLPYHRRHLPSPRVTADLHP 1279
>LOC_Os11g14000:12011.t01234:unspliced-genomic ANTH domain containing protein, expressed| Length = 1457 Score = 39.6 bits (80), Expect(2) = 0.036 Identities = 20/60 (33%), Positives = 26/60 (43%) Frame = -1 / +2 Query: 805 WERQRQRLTGHSRRCCYAALPAMNSCTRR*EPTRGRARPAGHPSTRGGAPATNTPALQLA 626 W R+ +R S RCC + + + + RPA STR GA A TPA A Sbjct: 269 WRRRARRRPPRSGRCCSSTASSAPATGTSSRTSAASGRPATSASTRHGAAARRTPAAAAA 448 Score = 22.6 bits (43), Expect(2) = 0.036 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 / +1 Query: 155 PVPETTERRVDGGGAA 108 P P T + DGGGAA Sbjct: 1003 PPPVTDDEDDDGGGAA 1050
>LOC_Os06g06430:12006.t00528:unspliced-genomic expressed protein| Length = 2640 Score = 31.8 bits (63), Expect(2) = 0.054 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 / +1 Query: 644 TCTPTRPAKATPRSCCRGSLPRLSHS 567 TC P+RP AT RS C + R S S Sbjct: 250 TCRPSRPPSATARSSCSAARARSSPS 327 Score = 25.4 bits (49), Expect(2) = 0.054 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 / +1 Query: 802 ERQRQRLTGHSRRCC 758 ERQ+ R H RRCC Sbjct: 160 ERQQWRSLRHRRRCC 204
>LOC_Os09g13110:12009.t01101:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 13342 Score = 39.6 bits (80), Expect = 0.058 Identities = 22/67 (32%), Positives = 28/67 (41%) Frame = -3 / +3 Query: 701 KSPPCWTPIYAGRGPCYKHTCTPTRPAKATPRSCCRGSLPRLSHSEANLALARLPRGEGA 522 ++P TP+YA PC + TP A PR CR ++P L S A Sbjct: 1497 RTPTKPTPMYAAGPPCCRRAPTPPGSHAAGPRPHCRETMPLLPRSRRPHAAGPAHGAGPC 1676 Query: 521 PLRSART 501 P R RT Sbjct: 1677 PHRRERT 1697
>LOC_Os04g40530:12004.t03615:unspliced-genomic methyltransferase, putative, expressed| Length = 1395 Score = 29.9 bits (59), Expect(3) = 0.086 Identities = 18/65 (27%), Positives = 27/65 (41%) Frame = +2 / +1 Query: 578 AAVGYPGSSCAAWLLPGELECRCVCSRGPSPRRWVSSRAGSSPRRFSAPCA*VHRRQRSV 757 A+ PG +C PG CR S + +S SSPR ++ + RS Sbjct: 313 ASASAPGGTCWTS*APGSATCRRSASSRSAASSATASTPRSSPRTHASTTSSSRTSTRSS 492 Query: 758 ATSAR 772 +S+R Sbjct: 493 GSSSR 507 Score = 27.6 bits (54), Expect(3) = 0.086 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 / +2 Query: 362 PQGEAAPSPFLPPPRIG 412 P+G P P PPPR+G Sbjct: 287 PRGARRPLPRAPPPRVG 337 Score = 22.1 bits (42), Expect(3) = 0.086 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 / +3 Query: 774 CPVSLCRCRSQ 806 C V CRC+SQ Sbjct: 1260 CEVFTCRCQSQ 1292
>LOC_Os01g47040:12001.t04153:unspliced-genomic C2 domain containing protein, expressed| Length = 1354 Score = 31.8 bits (63), Expect(2) = 0.11 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -1 / +3 Query: 706 RGRARPAGHPSTRGGAPATNTPALQLA 626 RGRA GHP R GA A+ PA A Sbjct: 174 RGRADSGGHPHLRAGAEASLRPAAAAA 254 Score = 28.6 bits (56), Expect(2) = 0.11 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -2 / +2 Query: 597 PG*PTAALPQRGQPSPGAATTRGGSP 520 P P P R P P AA T GG+P Sbjct: 380 PTTPAPPSPSRSTPRPPAAGTSGGTP 457
>LOC_Os04g04020:12004.t00290:unspliced-genomic protein transport protein Sec24-like, putative, expressed| Length = 7324 Score = 27.6 bits (54), Expect(4) = 0.12 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +2 / +2 Query: 743 RQRSVATSARMSRQSLSLSFPVVRQRAISDNYSCMR 850 R R+ A S + ++ ++S P+ RQRA C+R Sbjct: 656 RHRAAAVSGPIRHRATAVSGPLCRQRAAVSGPFCIR 763 Score = 27.2 bits (53), Expect(4) = 0.12 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 / +1 Query: 642 GVFVAGAPPRVDGCPAGRALPLVGSQRRVH 731 G F A APP P R L + QRR H Sbjct: 517 GPFAAAAPPPQAPSPVHRPLRVPSPQRRSH 606 Score = 24.9 bits (48), Expect(4) = 0.12 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 / +3 Query: 359 FPQGEAAPSPFLPPPRIGSDP 421 F A +PF+PPP+ + P Sbjct: 357 FGAASAPRAPFVPPPQAAASP 419 Score = 24.0 bits (46), Expect(4) = 0.12 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 / +1 Query: 1161 LSLYQWVADVLI*LFFPVV*WRVRES 1238 L+ +W A VL+ +F PV+ + V E+ Sbjct: 6994 LAAARWQAKVLLLIFVPVIIFLVSEN 7071
>LOC_Os05g36970:12005.t03241:unspliced-genomic plant-specific domain TIGR01568 family protein, expressed| Length = 1170 Score = 31.3 bits (62), Expect(2) = 0.14 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = +3 / -1 Query: 129 PPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPPVELI 242 PP R PP P + G+PR P P PP L+ Sbjct: 588 PPTRTSPSPPPSPPSTPGNPRTAPPTPPPPPPPPPLLL 475 Score = 24.4 bits (47), Expect(2) = 0.14 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 / -2 Query: 354 PSSPKVRPRLPPSFLLRGSARIRRG 428 P P V P LPP +L R+R G Sbjct: 434 PPPPHVLPPLPPHLVLDLVQRVRVG 360
>LOC_Os05g13520:12005.t01130:unspliced-genomic CER5, putative, expressed| Length = 5624 Score = 38.2 bits (77), Expect = 0.15 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +3 / -1 Query: 114 ASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 A + + P RR R PP GSPRP P P + PP Sbjct: 473 APASSSPARRRRGAPPSDSPTSGSPRPTPRTSPPATAPP 357
>LOC_Os04g02900:12004.t00184:unspliced-genomic pyruvate dehydrogenase E1 component alpha subunit, putative,| expressed Length = 4061 Score = 38.2 bits (77), Expect = 0.15 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +3 / +2 Query: 138 RRLRHRPPCPGARGGSPRPIPGVRTP 215 RR R RPP P GGSPRP R+P Sbjct: 356 RRSRSRPPPPSGPGGSPRPASAPRSP 433
>LOC_Os05g03320:12005.t00229:unspliced-genomic expressed protein| Length = 6207 Score = 38.2 bits (77), Expect = 0.15 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = -1 / -2 Query: 1039 HIHCAAATNVNRRRENGKVSYLQE*IKTKEQKAPR 935 +IHC T ++RRRENG+ E ++ KE+K+ R Sbjct: 5906 NIHCGQTTFLSRRRENGRAPQQTEHLRKKERKSIR 5802
>LOC_Os03g27370:12003.t02413:unspliced-genomic phospholipase D alpha 1, putative, expressed| Length = 5495 Score = 36.8 bits (74), Expect(2) = 0.16 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -3 / -1 Query: 218 PRGPNAGNGTRGAAPSPRTWR 156 PRGP G+G R APS R WR Sbjct: 3218 PRGPRRGSGCRAMAPSARPWR 3156 Score = 24.9 bits (48), Expect(2) = 0.16 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -1 / -2 Query: 1372 GVHSQQHHLHTYPINSTYKLH 1310 GVH HHLH P+ LH Sbjct: 3784 GVHVPVHHLHGAPLPVQDGLH 3722
>LOC_Os12g07730:12012.t00655:unspliced-genomic SWIRM domain containing protein, expressed| Length = 5967 Score = 29.9 bits (59), Expect(2) = 0.17 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -1 / +3 Query: 721 R*EPTRGRARPAGHPSTRGGAPATNTPALQLARQKP 614 R P RGR RP G P GAP + L+L + P Sbjct: 345 RRNPRRGR*RPRGGPPRGRGAPHGDRARLRLPARVP 452 Score = 25.4 bits (49), Expect(2) = 0.17 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 / +3 Query: 582 AALPQRGQPSPGAATTRGGSPSAQR 508 A +P RGQP+P R G + +R Sbjct: 441 ARVPPRGQPAPPLRARRHGGGARRR 515
>LOC_Os01g50820:12001.t04516:unspliced-genomic nitrate transporter, putative, expressed| Length = 2116 Score = 29.0 bits (57), Expect(2) = 0.18 Identities = 15/46 (32%), Positives = 18/46 (39%) Frame = +2 / +2 Query: 521 GLPPLVVAAPGLGWPRCGRAAVGYPGSSCAAWLLPGELECRCVCSR 658 G P + P RC R++ GS PG CR CSR Sbjct: 377 GSPSSAASCPRSPRRRCCRSSATPSGSRPRTSATPGSRPCRAPCSR 514 Score = 26.3 bits (51), Expect(2) = 0.18 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 / +2 Query: 641 RCVCSRGPSPRRWVSSRAGSSPRRFSAPC 727 RC SPRR SS A S R+ C Sbjct: 593 RCTAPPSSSPRRGTSSCASSRASRWRRSC 679
>LOC_Os09g23570:12009.t02041:unspliced-genomic receptor kinase, putative, expressed| Length = 2303 Score = 34.5 bits (69), Expect(2) = 0.18 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 / +2 Query: 638 CRCVCSRGPSPRRWVSSRAGSS 703 CRC +R P+ RW S+ AGSS Sbjct: 536 CRCAPTRSPAGSRWTSATAGSS 601 Score = 25.8 bits (50), Expect(2) = 0.18 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 / +3 Query: 117 SSVNPPFRRLRHRPP 161 S+ +PP RR R RPP Sbjct: 42 SNASPPSRRRRRRPP 86
>LOC_Os04g11350:12004.t00963:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 5017 Score = 32.7 bits (65), Expect(3) = 0.19 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 / +1 Query: 227 GVAPRGPNAGNGTRGAAPSPRTWR 156 G+ P GTRG+ PSP+ WR Sbjct: 3928 GIHPPSAPTKRGTRGSPPSPKAWR 3999 Score = 25.8 bits (50), Expect(3) = 0.19 Identities = 15/45 (33%), Positives = 18/45 (40%) Frame = -3 / +1 Query: 716 RTDEGKSPPCWTPIYAGRGPCYKHTCTPTRPAKATPRSCCRGSLP 582 RT +SP T G C+ T TP R + A SLP Sbjct: 2692 RTSPSRSPSRATRPPTGSALCWSRTATPWRSSAAPSCCVIVPSLP 2826 Score = 23.5 bits (45), Expect(3) = 0.19 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 / +1 Query: 1065 RSPDTTPHNTSTAL 1024 RSP T PH+T +L Sbjct: 1501 RSPSTAPHSTPISL 1542
>LOC_Os08g30100:12008.t02763:unspliced-genomic 1-aminocyclopropane-1-carboxylate oxidase, putative, expressed| Length = 1240 Score = 26.7 bits (52), Expect(4) = 0.20 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 / +3 Query: 569 CGRAAVGYPGSSCAAWLLPGELECRCVCSRGPSPRR 676 C G + C LPG L CR S S RR Sbjct: 954 CRTTGSGAWSTGCCPPALPGRLACRWRASSASSTRR 1061 Score = 25.4 bits (49), Expect(4) = 0.20 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 / +3 Query: 147 RHRPPCPGARGGSPRPIPGVRT 212 R RPP P SPRP V T Sbjct: 264 RPRPPRPSRSSTSPRPTSTVTT 329 Score = 21.7 bits (41), Expect(4) = 0.20 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 / +1 Query: 141 RLRHRPP 161 RLRHRPP Sbjct: 124 RLRHRPP 144 Score = 21.7 bits (41), Expect(4) = 0.20 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 / +3 Query: 539 VAAPGLGWPRCGR 577 +A+PG W RC R Sbjct: 387 MASPGS*WRRCSR 425
>LOC_Os11g28530:12011.t02465:unspliced-genomic ent-kaurene synthase B, chloroplast precursor, putative, expressed| Length = 14245 Score = 37.7 bits (76), Expect = 0.21 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 / -2 Query: 641 RCVCSRGPSPRRWVSSRAGSSPRRFSAP 724 RC SR PSP R S R+G PRR+ AP Sbjct: 13689 RC*ASRCPSPSRRSSRRSGGGPRRWRAP 13606
>LOC_Os02g47470:12002.t04331:unspliced-genomic cytochrome P450 90D2, putative, expressed| Length = 2865 Score = 37.7 bits (76), Expect = 0.21 Identities = 17/48 (35%), Positives = 19/48 (39%) Frame = +2 / -2 Query: 542 AAPGLGWPRCGRAAVGYPGSSCAAWLLPGELECRCVCSRGPSPRRWVS 685 A+ G WP G P SSC G CS P PRRW + Sbjct: 911 ASSGPSWPCGTGCPAGSPASSCTPSPASGSTASAPRCSASPPPRRWTA 768
>LOC_Os02g31867:12002.t05462:unspliced-genomic expressed protein| Length = 1592 Score = 37.7 bits (76), Expect = 0.21 Identities = 19/47 (40%), Positives = 22/47 (46%) Frame = -1 / +3 Query: 754 AALPAMNSCTRR*EPTRGRARPAGHPSTRGGAPATNTPALQLARQKP 614 A+ P+ T PTR R PA P+T GGAP PA A P Sbjct: 612 ASSPSPTPSTPPPPPTRRRHHPAATPTTTGGAPPPPPPAAASATNTP 752
>LOC_Os02g09960:12002.t00843:unspliced-genomic protein kinase, putative, expressed| Length = 2372 Score = 37.7 bits (76), Expect = 0.21 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +2 / -1 Query: 641 RCVCSRGPSPRRWVSSRAGSSPRRFSAP 724 RC CSRG S R W S R+ SPR +AP Sbjct: 197 RCRCSRGWSSRWWRSRRSAGSPRTPAAP 114
>LOC_Os08g32610:12008.t03006:unspliced-genomic ubiquitin-protein ligase, putative, expressed| Length = 2081 Score = 37.3 bits (75), Expect(2) = 0.23 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = +3 / -1 Query: 135 FRRLRHRPPCPGARGGSPRPIPGVRTP 215 +RR R PCP AR G PR PG R+P Sbjct: 1445 WRRPSPRRPCPSARPGLPRTWPGCRSP 1365 Score = 22.6 bits (43), Expect(2) = 0.23 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +2 / -1 Query: 653 SRGPSPRRWVSSRAGSSPRRFSAPCA*VHRRQRSVA 760 SR PSP +SS +PR + P A R+ A Sbjct: 524 SRAPSPPPSLSSPQPQAPRGGAPPPAPPRRKAAQAA 417
>LOC_Os03g21160:12003.t01871:unspliced-genomic nucleic acid binding protein, putative, expressed| Length = 3825 Score = 29.9 bits (59), Expect(2) = 0.24 Identities = 16/55 (29%), Positives = 23/55 (41%) Frame = -1 / -3 Query: 805 WERQRQRLTGHSRRCCYAALPAMNSCTRR*EPTRGRARPAGHPSTRGGAPATNTP 641 W R+R+ G + RCC + S + +R R A P+ GGA P Sbjct: 1183 WRRRRRGRHGRTCRCCRSCRTRARSTGKVSTRSRRRRGRARSPTRCGGAQGRRWP 1019 Score = 24.9 bits (48), Expect(2) = 0.24 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = -3 / -3 Query: 626 PAKATPRSCCRGSLPRLSHSEANLALARLPRGEGAP 519 P + TP RGS PRL + A A R P Sbjct: 961 PLRRTPGEHARGSRPRLRRAGTRAAPAARSRPGARP 854
>LOC_Os08g40330:12008.t03764:unspliced-genomic flavonol sulfotransferase-like, putative| Length = 1082 Score = 31.3 bits (62), Expect(2) = 0.26 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -3 / +2 Query: 629 RPAKATPRSCCRGSLPRLSHSEANLALAR 543 RP +A PR C LP++ H A AL R Sbjct: 266 RPVRAAPRRCAPRHLPKVRHHLAQGALLR 352 Score = 23.5 bits (45), Expect(2) = 0.26 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 / +2 Query: 517 CAAHARTLHCRTSRC 473 C+ AR CR+SRC Sbjct: 389 CSPKARMTLCRSSRC 433
>LOC_Os05g25910:12005.t02245:unspliced-genomic plant-specific domain TIGR01568 family protein, expressed| Length = 1050 Score = 37.3 bits (75), Expect = 0.28 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +3 / -1 Query: 114 ASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTP 215 A+ NPP R RPP P GSP P P +P Sbjct: 828 AAPANPPATASRSRPPSPPCSPGSPSPAPPTPSP 727
>LOC_Os11g41560:12011.t03692:unspliced-genomic F-box domain containing protein, expressed| Length = 2678 Score = 37.3 bits (75), Expect = 0.28 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +2 / +3 Query: 620 LPGELECRCVCSRGPSPRRWVSSRAGSSPRR 712 +P + RC C PSP +SR G+SPRR Sbjct: 15 IPPRFQWRCCCRTTPSPTSSAASRRGASPRR 107
>LOC_Os05g14750:12005.t01249:unspliced-genomic protein kinase G11A, putative, expressed| Length = 3520 Score = 37.3 bits (75), Expect = 0.28 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = -2 / +1 Query: 639 HSNSPGKSHAAQLLPG*PTAALPQRGQPSPGAATTRGGSPSAQR 508 H+ PG A LLP P AA PQ Q G A R G QR Sbjct: 2623 HAGEPGLHPALLLLPAHPAAAQPQGVQERHGPAAQRRGGGGVQR 2754
>LOC_Os05g16300:12005.t01400:unspliced-genomic expressed protein| Length = 2003 Score = 29.9 bits (59), Expect(3) = 0.29 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 / -2 Query: 656 RGPSPRRWVSSRAGSSPRRFSAPC 727 R +PRR S+RA SSP ++PC Sbjct: 190 RATAPRRRASARAPSSPAPTTSPC 119 Score = 25.4 bits (49), Expect(3) = 0.29 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +3 / -3 Query: 138 RRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 RR R RPPC + P VR+P P Sbjct: 1668 RRRRRRPPCRRRQPPWPDRTNPVRSPPEQAP 1576 Score = 23.5 bits (45), Expect(3) = 0.29 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +2 / -3 Query: 377 APSPFLPPPRIGSDPTW 427 AP PPPR + P W Sbjct: 1359 APRR*SPPPRCSTSPPW 1309
>LOC_Os03g54000:12003.t04715:unspliced-genomic oligopeptide transporter 3, putative, expressed| Length = 4177 Score = 31.8 bits (63), Expect(2) = 0.32 Identities = 20/54 (37%), Positives = 24/54 (44%) Frame = +2 / +3 Query: 638 CRCVCSRGPSPRRWVSSRAGSSPRRFSAPCA*VHRRQRSVATSARMSRQSLSLS 799 CRC CS G S RR S + S +P RR S A S+R + S S Sbjct: 3384 CRCGCSAGRSRRRSGSRSSTSPSSPTGSPGCRRRRRPTSRAGSSRAPSSTTSCS 3545 Score = 22.6 bits (43), Expect(2) = 0.32 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 / +1 Query: 527 PPLVVAAPGLGWPRCGRAA 583 PP V PG+ PR RAA Sbjct: 3325 PPRPVPQPGVAVPRRRRAA 3381
>LOC_Os05g15850:12005.t01356:unspliced-genomic xylanase inhibitor protein 2 precursor, putative, expressed| Length = 1149 Score = 32.2 bits (64), Expect(2) = 0.32 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 / -2 Query: 153 RPPCPGARGGSPRPIPGVRTPR 218 R C GGSPRP G RTPR Sbjct: 251 RGRCRRPHGGSPRPCSGPRTPR 186 Score = 26.3 bits (51), Expect(2) = 0.32 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 / -2 Query: 641 RCVCSRGPSPRRWVSSRAGSSPR 709 RC CS PSP R R ++ R Sbjct: 179 RCCCSAAPSPERRRGRRRAAAAR 111
>LOC_Os11g37850:12011.t03326:unspliced-genomic stripe rust resistance protein Yr10, putative| Length = 5601 Score = 36.8 bits (74), Expect = 0.39 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +3 / +1 Query: 138 RRLRHRPPCPGARGGSPRPIPGVRTPR 218 RRL HR P P A SPRP VR PR Sbjct: 4336 RRLLHRRPSPPAASPSPRPSVAVRLPR 4416
>LOC_Os04g52120:12004.t04688:unspliced-genomic potassium transporter 15, putative, expressed| Length = 5122 Score = 36.8 bits (74), Expect = 0.39 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +3 / -3 Query: 129 PPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 PP RR R P P R S RP P R PR PP Sbjct: 419 PPRRRRRRPPRPPPPRTRSSRPCPRPRRPRPPPP 318
>LOC_Os10g33710:12010.t02671:unspliced-genomic expressed protein| Length = 14840 Score = 36.8 bits (74), Expect = 0.39 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +2 / +1 Query: 596 GSSCAAWLLPGELECRCVCSRGPSPRRWVSSRAGSSPRRFSAPC 727 G+SC ++EC+C CSRG S +S F A C Sbjct: 4087 GTSCCVQFCRQDIECKCKCSRGESMLSSISPYVPDIKLEFQAQC 4218
>LOC_Os12g01690:12012.t00067:unspliced-genomic prenylated Rab receptor 2, putative| Length = 663 Score = 26.7 bits (52), Expect(3) = 0.40 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 / +2 Query: 159 PCPGARGGSPRPIPGVRTPRSDPP 230 P P R SP P P R+ S PP Sbjct: 293 PSPSPRPSSPTPSPLPRSSPSSPP 364 Score = 25.4 bits (49), Expect(3) = 0.40 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 / +3 Query: 129 PPFRRLRHRPPCPGAR 176 PP + RHR PCP R Sbjct: 39 PPRQHHRHRLPCPHLR 86 Score = 23.1 bits (44), Expect(3) = 0.40 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +3 / +2 Query: 357 SSPKVRPRLPPS 392 S+P RPR PPS Sbjct: 383 SAPPTRPRSPPS 418
>LOC_Os09g28080:12009.t02486:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3292 Score = 31.3 bits (62), Expect(2) = 0.46 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +3 / +2 Query: 111 SASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPPVELI 242 +A +N P + P GARG + P PG R R +P L+ Sbjct: 956 AAGGINLPREGVVLLGPATGARGAAALPTPGGRGSRKEPLPHLL 1087 Score = 28.1 bits (55), Expect(2) = 0.46 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 / +1 Query: 642 GVFVAGAPPRVDGCPAGRALPLVGSQRRVH 731 G+F A P CP R P G RR H Sbjct: 1855 GIFSEAALPHAFRCPTERRAPSAGLGRRKH 1944
>LOC_Os06g15370:12006.t01410:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 4592 Score = 31.3 bits (62), Expect(2) = 0.46 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +3 / -2 Query: 132 PFRRLRHRPPCPGARGGSPRPIPGVRTP 215 P RR R RP GARGGS P + P Sbjct: 3997 PVRRQRRRPRVGGARGGSGLPPVALHEP 3914 Score = 28.6 bits (56), Expect(2) = 0.46 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 / -1 Query: 656 RGPSPRRWVSSRAGSSPRRFSAP 724 RG PRRW + R RRF P Sbjct: 3908 RG*PPRRWRTQRPSGGGRRFHGP 3840
>LOC_Os04g02470:12004.t00140:unspliced-genomic expressed protein| Length = 528 Score = 28.6 bits (56), Expect(3) = 0.46 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 / +3 Query: 706 RGRARPAGHPSTRGGAPA 653 RGRA +GHP+TR G A Sbjct: 69 RGRACRSGHPATRSGGRA 122 Score = 23.5 bits (45), Expect(3) = 0.46 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -1 / +2 Query: 43 GGNWRRWGDREGTP 2 GG WRRW R P Sbjct: 341 GGVWRRWRRRTRLP 382 Score = 22.1 bits (42), Expect(3) = 0.46 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = -2 / +3 Query: 402 GGGRKGEGAAS 370 GGG +GEG+A+ Sbjct: 132 GGGARGEGSAA 164
>LOC_Os07g02550:12007.t00146:unspliced-genomic ligA, putative| Length = 912 Score = 30.9 bits (61), Expect(2) = 0.47 Identities = 18/62 (29%), Positives = 22/62 (35%) Frame = -3 / -3 Query: 767 PMLLRCAAGDELMHTALRTDEGKSPPCWTPIYAGRGPCYKHTCTPTRPAKATPRSCCRGS 588 P+ R G E TA PP P + G C P RP A P + S Sbjct: 346 PLRPRDGGGGERARTAATASRAYPPPPPPPPSSFPGGCRTRQAPPHRPCTAPPPTAAPCS 167 Query: 587 LP 582 +P Sbjct: 166 VP 161 Score = 23.1 bits (44), Expect(2) = 0.47 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -2 / -2 Query: 915 PPTGAPC*LPLGYDTAT 865 PPT PC P TAT Sbjct: 506 PPTTVPCSAPSSSTTAT 456
>LOC_Os06g08610:12006.t00740:unspliced-genomic anthranilate N-benzoyltransferase protein 1, putative, expressed| Length = 1183 Score = 27.6 bits (54), Expect(3) = 0.47 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +2 / +3 Query: 641 RCVCSRGPSPRRWVSSRAGSSPRRFSAPCA*VHRRQRS 754 RC RGP RW + S A C+ RR+R+ Sbjct: 384 RCSSRRGPGTTRWTT**TSSCRATRCATCSCPRRRRRT 497 Score = 25.8 bits (50), Expect(3) = 0.47 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 / +3 Query: 885 VVTSMVRL*EGVGSSPPLGAFCSFVLIY 968 ++ SM L*+ + PPL CSF I+ Sbjct: 996 IIASMPLL*KPIAVLPPLFRVCSFTPIF 1079 Score = 23.1 bits (44), Expect(3) = 0.47 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 / +3 Query: 132 PFRRLRHRPPCPGARGGSPR 191 P RR R R PC SPR Sbjct: 132 PRRRRRRRAPCGCPTSTSPR 191
>LOC_Os05g38500:12005.t03392:unspliced-genomic fasciclin-like arabinogalactan protein 8 precursor, putative| Length = 1756 Score = 33.1 bits (66), Expect(2) = 0.48 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +3 / +3 Query: 132 PFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPPVEL 239 P RR RPPC PR G RTP PP+ L Sbjct: 744 PHRRRLRRPPCRRPPPVPPRRAKGRRTPLPRPPLLL 851 Score = 25.4 bits (49), Expect(2) = 0.48 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +2 / +3 Query: 662 PSPRRWVSSRAGSSPRRFSAPCA*VHRRQRSVATSAR 772 P PRR V G+ P P HRR+R A + R Sbjct: 1014 PEPRRRVRRLQGAPPEGNVQPQRLRHRRRRVGAPAGR 1124
>LOC_Os03g42790:12003.t03680:unspliced-genomic ubiquitin-protein ligase/ zinc ion binding protein, putative,| expressed Length = 3526 Score = 30.4 bits (60), Expect(2) = 0.49 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 / -1 Query: 638 CRCVCSRGPSPRR 676 CRC C+ PSPRR Sbjct: 2632 CRCACTTSPSPRR 2594 Score = 29.0 bits (57), Expect(2) = 0.49 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 / -1 Query: 126 NPPFRRLRHRPPCPGAR 176 +PP RR R PPC G R Sbjct: 2677 SPPSRRRRRPPPCSGCR 2627
>LOC_Os05g04930:12005.t00385:unspliced-genomic taxadien-5-alpha-ol O-acetyltransferase, putative| Length = 1335 Score = 31.8 bits (63), Expect(2) = 0.50 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 / -3 Query: 132 PFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 P RR R P AR G R RTP S PP Sbjct: 1117 PTRRTRSTAPAAAARAGRARRRRTARTPPSPPP 1019 Score = 26.3 bits (51), Expect(2) = 0.50 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +2 / -3 Query: 662 PSPRRWVSSRAGSSPRRFSAP 724 PSP R ++RA ++PRR+ +P Sbjct: 1006 PSPPRRPATRAAAAPRRW*SP 944
>LOC_Os11g42230:12011.t03754:unspliced-genomic F-box domain containing protein, expressed| Length = 1902 Score = 31.8 bits (63), Expect(2) = 0.51 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 / +2 Query: 650 CSRGPSPRRWVSSRAGSSPRRFSAPC 727 C+ G +P W + A S+PRR S PC Sbjct: 734 CACGSAP*GWRTCSASSTPRRRSPPC 811 Score = 26.7 bits (52), Expect(2) = 0.51 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 / +2 Query: 129 PPFRRLRHRPPCPGARG 179 PP RRLR PP P + G Sbjct: 323 PPRRRLRPPPPAPASPG 373
>LOC_Os08g31228:12008.t02872:unspliced-genomic 50S ribosomal protein L27, putative, expressed| Length = 3592 Score = 36.3 bits (73), Expect = 0.53 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = -3 / -2 Query: 215 RGPNAGNGTRGAAPSPRTWRPVPETTERRVDGGGA 111 R P+A G G AP WR P + RR GGGA Sbjct: 120 RRPDARVGRGGRAPPHHRWRRAPASRRRRRGGGGA 16
>LOC_Os06g13160:12006.t01191:unspliced-genomic TMV response-related gene product, putative, expressed| Length = 1431 Score = 34.5 bits (69), Expect(2) = 0.54 Identities = 22/75 (29%), Positives = 33/75 (44%) Frame = +2 / +1 Query: 575 RAAVGYPGSSCAAWLLPGELECRCVCSRGPSPRRWVSSRAGSSPRRFSAPCA*VHRRQRS 754 RA+ P ++ A+W R S P PRR S A +SPRR ++ + RS Sbjct: 223 RASSSIPRAAWASWRSRRSSPSRSAPSSSPPPRRRTSRAASASPRRCTSATSSRGSSPRS 402 Query: 755 VATSARMSRQSLSLS 799 ++ R + S S Sbjct: 403 SSSPRSSPRDTTSPS 447 Score = 23.5 bits (45), Expect(2) = 0.54 Identities = 9/28 (32%), Positives = 11/28 (39%) Frame = +3 / +2 Query: 147 RHRPPCPGARGGSPRPIPGVRTPRSDPP 230 RH P P + P P R + PP Sbjct: 149 RHLPSPPRSAAAETSPAPATRGHHAGPP 232
>LOC_Os08g17990:12008.t01669:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6087 Score = 36.3 bits (73), Expect = 0.54 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +2 / -3 Query: 566 RCGRAAVGYPGSSCAAWLLPGELECRCVCSRGPSPR 673 RC + G+P + C L P CRC C RG R Sbjct: 5857 RCSSPSSGWPAALCLGILPPPPPRCRCRCRRGRGSR 5750
>LOC_Os02g35530:12002.t03191:unspliced-genomic kelch motif family protein| Length = 1176 Score = 35.4 bits (71), Expect(2) = 0.60 Identities = 18/54 (33%), Positives = 24/54 (44%) Frame = +2 / +2 Query: 644 CVCSRGPSPRRWVSSRAGSSPRRFSAPCA*VHRRQRSVATSARMSRQSLSLSFP 805 C PRR S+ AG P R C+ RQR+ T+ R R+ S +P Sbjct: 152 CAAGGAARPRRRRSAAAGGRPGRPRTSCSSSRPRQRAAVTTGRGRRRRRSARWP 313 Score = 22.1 bits (42), Expect(2) = 0.60 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 / +3 Query: 342 PFGAPSSPKVRPR 380 P GAP P+V PR Sbjct: 135 PGGAPRVPRVAPR 173
>LOC_Os07g08650:12007.t00740:unspliced-genomic expressed protein| Length = 1615 Score = 29.0 bits (57), Expect(2) = 0.62 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -1 / +2 Query: 706 RGRARPAGHPSTRGGAPATNTPALQL 629 R R RP HP R GAP PA +L Sbjct: 164 RRRRRPRRHPPRRLGAPQAPRPAQRL 241 Score = 24.4 bits (47), Expect(2) = 0.62 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 / +2 Query: 757 YAALPAMNSCTRR*EPTRGRARP 689 + LP+ C RR RGRA P Sbjct: 5 FHTLPSFLPCQRRCAAARGRAAP 73
>LOC_Os12g07620:12012.t00646:unspliced-genomic ligA, putative| Length = 1899 Score = 30.4 bits (60), Expect(3) = 0.62 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 / -2 Query: 138 RRLRHRPPCPGARGGSPRP 194 RRL RPPCP PRP Sbjct: 1370 RRLPRRPPCPRLPSNRPRP 1314 Score = 24.0 bits (46), Expect(3) = 0.62 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 / -3 Query: 389 FLPPPRIGSDPTWCML 436 F+PPP G+ P W +L Sbjct: 841 FIPPPSGGALPPWELL 794 Score = 23.1 bits (44), Expect(3) = 0.62 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 / -1 Query: 542 AAPGLGWPRCGRAAVGYP 595 AA LG RC AVG P Sbjct: 291 AAAALGHLRCASPAVGLP 238
>LOC_Os03g58030:12003.t05064:unspliced-genomic N-acetyltransferase, putative| Length = 510 Score = 29.9 bits (59), Expect(2) = 0.66 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -3 / +2 Query: 638 TPTRPAKATPRSCCRGSLPRLSHSEANLA 552 TP P+ ATP S RGS P S + A A Sbjct: 116 TPCAPSSATPCSRTRGSAPSASPATATAA 202 Score = 23.5 bits (45), Expect(2) = 0.66 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 / +2 Query: 706 RGRARPAGHPSTRGGAPATNTP 641 RGR P PS RG + +TP Sbjct: 56 RGRRTPR*RPS*RGSRTSPSTP 121
>LOC_Os04g40590:12004.t03621:unspliced-genomic wax synthase isoform 1, putative, expressed| Length = 1327 Score = 31.8 bits (63), Expect(2) = 0.67 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 / +1 Query: 653 SRGPSPRRWVSSRAGSSPRRFSAPCA 730 SRGP+P RW S RA S R P + Sbjct: 925 SRGPAPTRW*SPRARRSSRSCGTPAS 1002 Score = 25.8 bits (50), Expect(2) = 0.67 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 / +1 Query: 108 CSASSVNPPFRRLRHRPPCPGARGGSPR 191 CSA + P R R P RG SPR Sbjct: 619 CSARASATPCARASAREPPASRRGSSPR 702
>LOC_Os07g41080:12007.t03764:unspliced-genomic hydrolase, alpha/beta fold family protein| Length = 9098 Score = 32.2 bits (64), Expect(3) = 0.68 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 / +2 Query: 108 CSASSVNPPFRRLRHRPPCPGARGGSPRPIP 200 CS+ PP RR R R GA GSP P P Sbjct: 11 CSSPPPPPPRRRWRRRGRHAGAASGSPPPPP 103 Score = 24.9 bits (48), Expect(3) = 0.68 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 / +2 Query: 653 SRGPSPRRWVSS 688 SRG SPRRW S Sbjct: 146 SRGSSPRRWSGS 181 Score = 24.4 bits (47), Expect(3) = 0.68 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 / +2 Query: 1033 GCVVGCCIRGSGVQILEKPH 1092 GCVV +R G +L PH Sbjct: 5960 GCVVHATLRNLGNNLLPHPH 6019
>LOC_Os04g34970:12004.t03171:unspliced-genomic AP2 domain containing protein, expressed| Length = 735 Score = 28.6 bits (56), Expect(2) = 0.71 Identities = 17/57 (29%), Positives = 23/57 (40%) Frame = +3 / -3 Query: 108 CSASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPPVELILVNGANRANSFP 278 CS S+ + RR R P + +P P PG + R P A RA + P Sbjct: 586 CSTSARSGRSRRRRRTRPGRWSSSAAPAPPPGSWSSRGSPRRRPAATPAARRAPTTP 416 Score = 28.1 bits (55), Expect(2) = 0.71 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +2 / -3 Query: 656 RGPSPRRWVSSRAGSSP 706 R P PRRW +SRA +P Sbjct: 301 RAPRPRRWRTSRATPAP 251
>LOC_Os03g19427:12003.t01709:unspliced-genomic nicotianamine synthase 1, putative, expressed| Length = 1413 Score = 33.6 bits (67), Expect(2) = 0.71 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 / -1 Query: 138 RRLRHRPPCPGARGGSPRPIPGVRTPRSDP 227 RR RPPC SPRP P PR+ P Sbjct: 804 RRAPRRPPCARPGARSPRPSPRPPCPRAPP 715 Score = 24.0 bits (46), Expect(2) = 0.71 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 / -1 Query: 527 PPLVVAAPGLGWPR 568 PP A PG WPR Sbjct: 303 PPASPAPPGRAWPR 262
>LOC_Os04g03910:12004.t00279:unspliced-genomic conserved hypothetical protein| Length = 1896 Score = 35.9 bits (72), Expect = 0.73 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +3 / -3 Query: 114 ASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 A+S PP R R P P GG P P PG PR P Sbjct: 289 AASSRPPAVLRRRRRPSPDLAGGGPDPPPGRPDPRPARP 173
>LOC_Os03g31026:12003.t005774:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 3714 Score = 35.9 bits (72), Expect = 0.73 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +3 / +2 Query: 108 CSASSVNPPFRRLRHRPPCPGARGGSPRPIP 200 C A +P FRR RHR PG G P P+P Sbjct: 482 CCAIRHHPHFRRRRHRNQYPGGPGFPPVPLP 574
>LOC_Os01g45200:12001.t03978:unspliced-genomic dihydroflavonol-4-reductase, putative, expressed| Length = 6505 Score = 35.9 bits (72), Expect = 0.73 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +3 / -1 Query: 126 NPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 +P RR RPP P GSP P RTPR+ P Sbjct: 6193 SPAGRRSPARPPPPPLCAGSPAGAPAPRTPRASSP 6089
>LOC_Os12g20460:12012.t01887:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3752 Score = 35.9 bits (72), Expect = 0.74 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = -1 / -1 Query: 1351 HLHTYPINSTYKLHAQMPICQHTNNMNYKTTYHCPTYMLSLTLHQT 1214 H T ++TY+ A +P+C+H + K P LSLT H T Sbjct: 1256 HSPTTHASTTYRKEADIPVCRHASTTYRKEAVTGPLA*LSLTKHTT 1119
>LOC_Os10g30460:12010.t02380:unspliced-genomic conserved hypothetical protein| Length = 1108 Score = 35.9 bits (72), Expect = 0.74 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -1 / +3 Query: 61 QGRTREGGNWRRWGDREGTP 2 QGR R GG WRR G +GTP Sbjct: 90 QGRWRSGGGWRR*GGSQGTP 149
>LOC_Os07g38820:12007.t03546:unspliced-genomic lectin-like receptor kinase 7, putative| Length = 2512 Score = 35.9 bits (72), Expect = 0.74 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 / +3 Query: 641 RCVCSRGPSPRRWVSSRAGSSPRRFSAPCA*VHRRQRSVATSARMSRQSLSLS 799 RC+ + PSPR S + +SPR + C RR+R+ + S S S Sbjct: 1116 RCLPCKCPSPRSLCSPKPSTSPRSWPRRCTSASRRRRASCSRTTTSSDGASAS 1274
>LOC_Os07g13830:12007.t01247:unspliced-genomic expressed protein| Length = 1818 Score = 35.9 bits (72), Expect = 0.74 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = +2 / +1 Query: 641 RCVCSRGPSPRRWVSSRAGSSPRRFSAPCA*VHRRQRS 754 RC R SP RW +SR SSP R AP + +R S Sbjct: 235 RCAARRAASPPRWSASRGCSSPPRPMAPTSAAVKRVTS 348
>LOC_Os02g08100:12002.t00706:unspliced-genomic 4-coumarate--CoA ligase 1, putative, expressed| Length = 5433 Score = 35.9 bits (72), Expect = 0.74 Identities = 20/47 (42%), Positives = 26/47 (55%) Frame = +2 / +3 Query: 665 SPRRWVSSRAGSSPRRFSAPCA*VHRRQRSVATSARMSRQSLSLSFP 805 SPRR S R GSSPRR ++P + R + +SAR S + S P Sbjct: 480 SPRRAPSRRCGSSPRRGASPWSPWTARSTAAWSSARCSPRRSSTPTP 620
>LOC_Os03g19420:12003.t01708:unspliced-genomic nicotianamine synthase 2, putative, expressed| Length = 1476 Score = 33.6 bits (67), Expect(2) = 0.74 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 / -1 Query: 138 RRLRHRPPCPGARGGSPRPIPGVRTPRSDP 227 RR RPPC SPRP P PR+ P Sbjct: 807 RRAPRRPPCARPGARSPRPSPRPPCPRAPP 718 Score = 24.0 bits (46), Expect(2) = 0.74 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 / -1 Query: 527 PPLVVAAPGLGWPR 568 PP A PG WPR Sbjct: 306 PPASPAPPGRAWPR 265
>LOC_Os04g14550:12004.t01274:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 5439 Score = 29.0 bits (57), Expect(2) = 0.76 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 / +3 Query: 114 ASSVNPPFRRLRHRPPCPGAR 176 A++V+PP RR RPP PG R Sbjct: 3579 AAAVSPPPRRQLLRPPPPGRR 3641 Score = 24.0 bits (46), Expect(2) = 0.76 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +3 / +1 Query: 156 PPCPGARGGSPRPIPGVRTPRSDPP 230 PPC S P+P R PR P Sbjct: 3694 PPCQIQVAASFAPLPDRRAPRPPSP 3768
>LOC_Os07g27950:12007.t02487:unspliced-genomic protein binding protein, putative, expressed| Length = 4551 Score = 28.1 bits (55), Expect(2) = 0.77 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -1 / -2 Query: 745 PAMNSCTRR*EPTRGRARPAGHPSTRGGAPATNTP 641 P +CTRR* RGR A R GA TP Sbjct: 503 PPGAACTRR*RRGRGRGTGARTRRARRGAAPRGTP 399 Score = 24.9 bits (48), Expect(2) = 0.77 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -2 / -2 Query: 594 G*PTAALPQRGQPSPGAATTRGGSPSAQRT 505 G P A P P P A + GGSP T Sbjct: 299 GAPRGAPPPSPAPPPTAPASGGGSPCGPGT 210
>LOC_Os05g43420:12005.t03833:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3292 Score = 29.5 bits (58), Expect(2) = 0.83 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 / +2 Query: 159 PCPGARGGSPRPIPGVRTPRSDPPVELI 242 P GARG + P PG R R +P L+ Sbjct: 1004 PATGARGAAALPTPGGRGSREEPLPHLL 1087 Score = 29.0 bits (57), Expect(2) = 0.83 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 / +1 Query: 642 GVFVAGAPPRVDGCPAGRALPLVGSQRRVH 731 G+F A P CP R P G RR H Sbjct: 1855 GIFTEAALPHAFRCPTERRAPSAGLGRRKH 1944
>LOC_Os05g01790:12005.t00079:unspliced-genomic expressed protein| Length = 1125 Score = 27.6 bits (54), Expect(2) = 0.85 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = -2 / +3 Query: 651 QTHLHSNSPGKSHAAQLLPG*PTAALPQRGQPSPGAATTRGGSPSAQ 511 + H S+SP + G A RG PS G ATT P A+ Sbjct: 375 RVHAASSSPARRRPRCASCGTSAARGSARGSPSRGRATTSPWRPRAR 515 Score = 25.4 bits (49), Expect(2) = 0.85 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = -1 / +3 Query: 793 RQRLTGHSRRCCYAALPAMNSCTRR*EPTRGRARPAGHPSTRGGAP 656 R T RR + ++ T R P+R R+ P+TR +P Sbjct: 123 RGAATSRRRRATSPPTRSRSTATSRGGPSRRRSTAPRSPATRASSP 260
>LOC_Os01g60860:12001.t05467:unspliced-genomic spotted leaf protein 11, putative, expressed| Length = 2493 Score = 30.9 bits (61), Expect(2) = 0.88 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +2 / -1 Query: 659 GPSPRRWVSSRAGSSPRRFSAPCA*VHRRQRSVATSARMSRQSLSLS 799 G R W +RA +S ++P + R SVA S SR S S+S Sbjct: 666 GEHRRHWRDARARTSSTSSASPSSTTGNRSSSVARSWLSSRSSASIS 526 Score = 27.2 bits (53), Expect(2) = 0.88 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 / -2 Query: 138 RRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 RR R P R G P PG R+PR P Sbjct: 884 RRERSWRPSISPRHGRRSPAPGSRSPRCSSP 792
>LOC_Os10g03440:12010.t00233:unspliced-genomic avr9/Cf-9 rapidly elicited protein 74, putative| Length = 1383 Score = 31.3 bits (62), Expect(2) = 0.94 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 / +3 Query: 141 RLRHRPPCPGARGGSPRPIP 200 R R RP C RGG PR +P Sbjct: 885 RARRRPRCGAPRGGRPRAVP 944 Score = 25.8 bits (50), Expect(2) = 0.94 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 / +2 Query: 665 SPRRWVSSRAGSSPRRFSAPCA*VHRR 745 S RRW AG +P+ +PC RR Sbjct: 1001 STRRWRPRPAGRAPKPTRSPCRCSSRR 1081
>LOC_Os11g31960:12011.t02793:unspliced-genomic expressed protein| Length = 8091 Score = 30.4 bits (60), Expect(3) = 0.97 Identities = 17/48 (35%), Positives = 21/48 (43%) Frame = +2 / -2 Query: 554 LGWPRCGRAAVGYPGSSCAAWLLPGELECRCVCSRGPSPRRWVSSRAG 697 L PR RAA ++ A+W LP S P PRR +S G Sbjct: 248 LSAPRRERAAAFRSSTAAASWPLPSRRRRAGTSSLPPPPRRAAASGVG 105 Score = 25.8 bits (50), Expect(3) = 0.97 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = +3 / -3 Query: 114 ASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 A +P RH P GA PRP + T + PP Sbjct: 805 ARRASPRSSSARHAPAAAGASPPHPRPPALLPTASARPP 689 Score = 24.4 bits (47), Expect(3) = 0.97 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 / -3 Query: 377 APSPFLPPPRIGS 415 AP P LPPP GS Sbjct: 331 APPPALPPPHPGS 293
>LOC_Os10g12570:12010.t01034:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 9478 Score = 35.4 bits (71), Expect = 1.0 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +3 / +1 Query: 108 CSASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDP 227 C+A++ P RR RPP P AR + P G R P P Sbjct: 4582 CAATASRSPRRRYATRPPPPRARHATATPRRGCRAPPPRP 4701
>LOC_Os05g34150:12005.t03009:unspliced-genomic glutathione S-transferase GSTU6, putative, expressed| Length = 1423 Score = 35.4 bits (71), Expect = 1.0 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +3 / +2 Query: 129 PPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDP 227 PP RR+RH PP P R P P +R R P Sbjct: 335 PPARRVRHHPPVPRRRLAGEPPPPPLRPLRPRP 433
>LOC_Os03g49520:12003.t04300:unspliced-genomic pinin/SDK/memA/ protein conserved region containing protein,| expressed Length = 3915 Score = 35.4 bits (71), Expect = 1.0 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 / -3 Query: 165 PGARGGSPRPIPGVRTPRSDP 227 PGARGGSPRP R P S P Sbjct: 106 PGARGGSPRPSSPSRRPSSSP 44
>LOC_Os03g19452:12003.t01710:unspliced-genomic expressed protein| Length = 5077 Score = 35.4 bits (71), Expect = 1.0 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 / -3 Query: 129 PPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 PP RR RPP P R SPR R R PP Sbjct: 272 PPGRRPPRRPPAPRGRAPSPRTPASSRRRRRPPP 171
>LOC_Os08g40700:12008.t03800:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 1536 Score = 35.4 bits (71), Expect = 1.0 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +2 / -2 Query: 650 CSRGPSPRRWVSSRAGSSPRRF 715 CSRGP+P W SR G +PR++ Sbjct: 1367 CSRGPAPGNWP*SRRGYAPRQY 1302
>LOC_Os06g01750:12006.t00071:unspliced-genomic PE-PGRS FAMILY PROTEIN, putative| Length = 978 Score = 35.4 bits (71), Expect = 1.0 Identities = 17/42 (40%), Positives = 20/42 (47%) Frame = -1 / +3 Query: 745 PAMNSCTRR*EPTRGRARPAGHPSTRGGAPATNTPALQLARQ 620 P + C R P RG A P+ RGG T T +LARQ Sbjct: 105 PGQSGCWWRRRPRRGDATRPATPARRGGGDGTATRRRRLARQ 230
>LOC_Os04g44780:12004.t04016:unspliced-genomic rare lipoprotein A like double-psi beta-barrel containing protein,| expressed Length = 4610 Score = 35.4 bits (71), Expect = 1.0 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 / +2 Query: 638 CRCVCSRGPSPRRWVSSRAGSSPRR 712 C C CSR PSP R S+ SPRR Sbjct: 152 CCCCCSRPPSPPRSCSTAGSPSPRR 226
>LOC_Os05g44690:12005.t03957:unspliced-genomic hypothetical protein| Length = 1339 Score = 30.4 bits (60), Expect(3) = 1.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 / -3 Query: 138 RRLRHRPPCPGARGGSPRP 194 RRL RPPCP PRP Sbjct: 830 RRLPRRPPCPRLPSNRPRP 774 Score = 23.5 bits (45), Expect(3) = 1.0 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 / -3 Query: 389 FLPPPRIGSDPTWCML 436 F+PPP G+ P W +L Sbjct: 305 FVPPPSGGALPPWELL 258 Score = 21.7 bits (41), Expect(3) = 1.0 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 / -3 Query: 12 SLSPQRRQFPPS 47 SLS RR+FPP+ Sbjct: 953 SLSLSRRRFPPT 918
>LOC_Os11g06310:12011.t00523:unspliced-genomic conserved hypothetical protein| Length = 624 Score = 26.3 bits (51), Expect(3) = 1.1 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -2 / +3 Query: 414 EPIRGGGRKGEGAASP 367 EP GG R+G GAA P Sbjct: 501 EPRAGGVRRGRGAAGP 548 Score = 24.4 bits (47), Expect(3) = 1.1 Identities = 11/38 (28%), Positives = 14/38 (36%) Frame = -3 / +2 Query: 704 GKSPPCWTPIYAGRGPCYKHTCTPTRPAKATPRSCCRG 591 G +P CW P A P + + R S C G Sbjct: 101 GCAPRCWAPATASSPPRRSCSASARRAPPTRAPSSCPG 214 Score = 22.6 bits (43), Expect(3) = 1.1 Identities = 9/24 (37%), Positives = 10/24 (41%) Frame = -3 / +2 Query: 227 GVAPRGPNAGNGTRGAAPSPRTWR 156 G+ GP G G R A WR Sbjct: 548 GLPVAGPGLGRGRRVAGHGRHLWR 619
>LOC_Os03g11670:12003.t00968:unspliced-genomic salt-inducible protein, putative, expressed| Length = 2276 Score = 28.1 bits (55), Expect(3) = 1.1 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +3 / +3 Query: 351 APSSPKVRPRLPPS 392 AP+SP RPRLPP+ Sbjct: 270 APASPPRRPRLPPA 311 Score = 26.3 bits (51), Expect(3) = 1.1 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +2 / +3 Query: 656 RGPSPRRWVSSRAGSSPRRFSAPCA 730 R PSPRRW P R + C+ Sbjct: 321 RRPSPRRWRPRSRNPRPSRTPSSCS 395 Score = 22.6 bits (43), Expect(3) = 1.1 Identities = 5/8 (62%), Positives = 7/8 (87%) Frame = +1 / +3 Query: 1261 WSCSSCCW 1284 WSC++ CW Sbjct: 894 WSCTTRCW 917
>LOC_Os07g23820:12007.t02079:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3265 Score = 29.9 bits (59), Expect(2) = 1.1 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +3 / +2 Query: 159 PCPGARGGSPRPIPGVRTPRSDPPVELILVNGANRANS 272 P GARG + P PG R R +P L+ R + Sbjct: 1004 PATGARGAAALPTPGGRGSRKEPLPHLLPEGAGRRVTA 1117 Score = 28.1 bits (55), Expect(2) = 1.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 / +1 Query: 642 GVFVAGAPPRVDGCPAGRALPLVGSQRRVH 731 G+F A P CP R P G RR H Sbjct: 1855 GIFSEAALPHAFRCPTERRAPSAGLGRRKH 1944
>LOC_Os09g10660:12009.t00857:unspliced-genomic hypothetical protein| Length = 1577 Score = 28.1 bits (55), Expect(2) = 1.1 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -1 / -1 Query: 700 RARPAGHPSTRGGAPATNT 644 R RPAG P TRG P + T Sbjct: 596 RRRPAGSPMTRGWPPCSPT 540 Score = 24.4 bits (47), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 / -1 Query: 573 PQRGQPSPGAATTRGGSPSA 514 P P G+ +TRGGSP++ Sbjct: 515 PTTRGPELGSPSTRGGSPAS 456
>LOC_Os12g08980:12012.t00779:unspliced-genomic syntaxin-related protein KNOLLE, putative| Length = 888 Score = 31.8 bits (63), Expect(2) = 1.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 / -3 Query: 218 PRGPNAGNGTRGAAPSPRTWRPVPETTERRVDG 120 PR G R AAP R WRP P R G Sbjct: 190 PRARPGGGTARRAAPPSRPWRPPPPGGTPRASG 92 Score = 24.4 bits (47), Expect(2) = 1.1 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -1 / -3 Query: 703 GRARPAGHPSTRGGAPATNTP 641 GRARPA + R G A TP Sbjct: 250 GRARPAWRRAARRGGAAPWTP 188
>LOC_Os01g36610:12001.t03209:unspliced-genomic salt-inducible protein-like, putative| Length = 1791 Score = 29.0 bits (57), Expect(2) = 1.2 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -3 / +2 Query: 215 RGPNAGNGTRGAAPSPRTWRPVP 147 R P + TR PSPR+ P P Sbjct: 338 RSPTSSGSTRATTPSPRSSAPAP 406 Score = 28.1 bits (55), Expect(2) = 1.2 Identities = 17/60 (28%), Positives = 23/60 (38%) Frame = -3 / +2 Query: 698 SPPCWTPIYAGRGPCYKHTCTPTRPAKATPRSCCRGSLPRLSHSEANLALARLPRGEGAP 519 SPP P G C+PT A ++P S + P S A+ + R R P Sbjct: 98 SPPPTPPTRRGPSRMSSPGCSPTSAATSSPPSSSAPATPTRSPPSASSSRCRRRRSPRRP 277
>LOC_Os05g42240:12005.t03760:unspliced-genomic hypothetical protein| Length = 1251 Score = 27.6 bits (54), Expect(3) = 1.2 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +2 / -2 Query: 563 PRCGRAAVGYPGSSCAAWLLPGELECRCVCSRG 661 P+ R++ P C A LLP C C C G Sbjct: 305 PQRRRSSSATPRPRCGALLLPPPPTCCCCCFAG 207 Score = 24.0 bits (46), Expect(3) = 1.2 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 / -2 Query: 1211 CCLMEGEREHVCR 1249 CC GE E CR Sbjct: 224 CCCFAGEEEEACR 186 Score = 23.5 bits (45), Expect(3) = 1.2 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 / -3 Query: 380 PSPFLPPPRIGSDP 421 PSP PPPR S P Sbjct: 1117 PSPPPPPPRRSSSP 1076
>LOC_Os02g45880:12002.t04175:unspliced-genomic expressed protein| Length = 708 Score = 29.0 bits (57), Expect(2) = 1.2 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +3 / +2 Query: 114 ASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDP 227 +S + P RR R P PGA SPRP P P Sbjct: 8 SSPLPRPARRSPSRRPPPGAAPSSPRPSRPPAAPTRPP 121 Score = 26.7 bits (52), Expect(2) = 1.2 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 / +3 Query: 368 GEAAPSPFLPPPR 406 G AP P LPPPR Sbjct: 114 GRPAPRPLLPPPR 152
>LOC_Os05g50660:12005.t04496:unspliced-genomic PX domain containing protein, expressed| Length = 7761 Score = 30.4 bits (60), Expect(2) = 1.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -3 / -2 Query: 1334 HQLHLQAPCTNAYLPTHQQHELQDHIPLPYIHALSH 1227 HQ PC+++ + HQQH+ P + H H Sbjct: 5030 HQFLNSVPCSSSLISNHQQHQSLYPSPSAWYHLYVH 4923 Score = 28.6 bits (56), Expect(2) = 1.3 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = -3 / -1 Query: 716 RTDEGKSPPCWTPIYAGRGPCYKHTCTPTRPAKATPRSCCR 594 R G + P +P GRGPC P+ A P CR Sbjct: 267 RRRRGAARPASSPPPRGRGPCAPSPGRLPSPSPAAPPRGCR 145
>LOC_Os08g08830:12008.t00769:unspliced-genomic expressed protein| Length = 9400 Score = 26.7 bits (52), Expect(2) = 1.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 / +1 Query: 159 PCPGARGGSPRPIPGVRTPRS 221 P P R G+P+P PG +P S Sbjct: 43 PPPPPRRGAPKP*PGAASPPS 105 Score = 25.4 bits (49), Expect(2) = 1.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +3 / +1 Query: 129 PPFRRLRHRPPCPGARG 179 PPF H PP P RG Sbjct: 16 PPFASATHMPPPPPRRG 66
>LOC_Os06g49300:12006.t04614:unspliced-genomic HGA1, putative, expressed| Length = 2040 Score = 30.4 bits (60), Expect(2) = 1.3 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 / -1 Query: 111 SASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 SA + PP R PP P G P P P RT PP Sbjct: 1539 SAPTRAPPPSRRTSSPPTPPPGCGRPAPPPPPRTRPPPPP 1420 Score = 26.7 bits (52), Expect(2) = 1.3 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 / -3 Query: 620 LPGELECRCVCSRGPSPRRW 679 LP C CV S SP RW Sbjct: 1114 LPNHHRCFCVTSSWTSPARW 1055
>LOC_Os11g13870:12011.t01221:unspliced-genomic plant-specific domain TIGR01627 family protein, expressed| Length = 1061 Score = 29.0 bits (57), Expect(2) = 1.3 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +2 / +1 Query: 653 SRGPSPRRWVSSRAGSSPRRFSAPCA*VHRR 745 S P+P S RA S+ RR S+PCA RR Sbjct: 685 STAPAPPPPSSRRATSTARRASSPCAASPRR 777 Score = 27.2 bits (53), Expect(2) = 1.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 / +2 Query: 159 PCPGARGGSPRPIPGV 206 PCPG RGG P+ V Sbjct: 350 PCPGGRGGGAGPLRDV 397
>LOC_Os01g34470:12001.t03005:unspliced-genomic hypothetical protein| Length = 1566 Score = 26.7 bits (52), Expect(3) = 1.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -3 / -3 Query: 176 PSPRTWRPVPETTERRVDGGGA 111 P PR RP P RR GGA Sbjct: 1042 PPPRRRRPPPRRPRRRAPRGGA 977 Score = 25.4 bits (49), Expect(3) = 1.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -3 / -2 Query: 641 CTPTRPAKATPRSCCRGSLPRLSHSEANLA 552 C R + PRSC R ++ R S S + A Sbjct: 1499 CILARRTQRRPRSCARSAMVRWSPSRSAAA 1410 Score = 23.5 bits (45), Expect(3) = 1.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 / -1 Query: 59 GKNEGRGKLAALGGQRG 9 G+++GRG + GGQRG Sbjct: 78 GESQGRGGPSHGGGQRG 28
>LOC_Os12g44310:12012.t04097:unspliced-genomic 9,10-9,10 carotenoid cleavage dioxygenase 1, putative, expressed| Length = 7296 Score = 35.0 bits (70), Expect = 1.4 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +3 / +1 Query: 138 RRLRHRPPCPGARGGSPRPIPGVRTPRSDPPVELILVN 251 R+LR RPP A G PRP P RTP P + ++ Sbjct: 439 RQLRPRPPRDPAGPGPPRPRPPPRTPPLSYPPPFLFIH 552
>LOC_Os06g33530:12006.t03050:unspliced-genomic protein phosphatase 2C isoform epsilon, putative, expressed| Length = 2912 Score = 35.0 bits (70), Expect = 1.4 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 / +2 Query: 111 SASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 + SS + RLR RPP P AR +P +P R + PP Sbjct: 11 TTSSASSAAPRLRRRPPPPAARAHTPVSMPLARCGMAAPP 130
>LOC_Os05g08770:12005.t00754:unspliced-genomic receptor-like protein kinase precursor, putative, expressed| Length = 3364 Score = 35.0 bits (70), Expect = 1.4 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 / +3 Query: 129 PPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPPVEL 239 PP +RLR R P P R + R +P + P PP +L Sbjct: 729 PPLQRLRGRRPAPAVRPPARRHLPQPQPPPLRPPRQL 839
>LOC_Os04g42340:12004.t03786:unspliced-genomic expressed protein| Length = 2308 Score = 35.0 bits (70), Expect = 1.4 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +3 / -1 Query: 111 SASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPPVELILVNG 254 S S+ P RR R R P PG+ G + R P PR+ P ++ + + G Sbjct: 280 SCSASRRPARRRRARRPRPGSPGTTARTPPPPPRPRAAPSLQPLALTG 137
>LOC_Os04g40080:12004.t03573:unspliced-genomic protein lap1, putative, expressed| Length = 3174 Score = 35.0 bits (70), Expect = 1.4 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = +3 / +3 Query: 111 SASSVNPPFRRLRHRPPCPGARGGSPR 191 + SS PP R P PGARGGSPR Sbjct: 348 TTSSSTPPARSSPRPTPRPGARGGSPR 428
>LOC_Os03g25640:12003.t02261:unspliced-genomic F-box domain containing protein, expressed| Length = 2262 Score = 35.0 bits (70), Expect = 1.4 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 / -2 Query: 165 PGARGGSPRPIPGVRTPRSDPP 230 PGARG PRP+P R +PP Sbjct: 2009 PGARGAHPRPLPSPEAVRVEPP 1944
>LOC_Os03g19480:12003.t01713:unspliced-genomic polycomb protein EZ3, putative, expressed| Length = 7703 Score = 35.0 bits (70), Expect = 1.4 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +3 / +3 Query: 114 ASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPPV 233 A++ PP+RR R RPP P P P R P D P+ Sbjct: 195 ATAPAPPWRRPRPRPPIPLPNAPRCAPSPQSRLPAPDSPL 314
>LOC_Os02g14110:12002.t01207:unspliced-genomic aspartate aminotransferase, mitochondrial precursor, putative,| expressed Length = 4980 Score = 35.0 bits (70), Expect = 1.4 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 / -3 Query: 132 PFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 P RR R P P +R SP P P P S PP Sbjct: 271 PARRGRTATPSPSSRASSPSPAPRPAAPGSRPP 173
>LOC_Os01g40660:12001.t03589:unspliced-genomic embryonic abundant protein-like, putative, expressed| Length = 1247 Score = 35.0 bits (70), Expect = 1.4 Identities = 19/52 (36%), Positives = 23/52 (44%) Frame = -3 / -3 Query: 665 RGPCYKHTCTPTRPAKATPRSCCRGSLPRLSHSEANLALARLPRGEGAPLRS 510 R PC T PT P A+PR+ G P S S + RG G P R+ Sbjct: 984 R*PCGPATRHPTLPPAASPRARPAGPRPAASPSPPPTTTSAFGRGPGTPSRA 829
>LOC_Os01g06000:12001.t00484:unspliced-genomic expressed protein| Length = 4713 Score = 35.0 bits (70), Expect = 1.4 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +3 / +3 Query: 129 PPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 PP RR R PP P A SPR +P + P + PP Sbjct: 84 PPGRRPRLLPPPPPAVAISPRSLPPLPPPAAAPP 185
>LOC_Os11g24060:12011.t02027:unspliced-genomic transmembrane transport protein-like, putative, expressed| Length = 1996 Score = 35.0 bits (70), Expect = 1.4 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +2 / +2 Query: 608 AAWLLPGELECRCVCSRGPSPRRWVSS 688 A+W + C C RGPS RRW SS Sbjct: 1322 ASWRRSSSVPC*RACRRGPSDRRWCSS 1402
>LOC_Os06g13050:12006.t01180:unspliced-genomic peroxidase family protein, expressed| Length = 9862 Score = 35.0 bits (70), Expect = 1.4 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = -2 / +3 Query: 636 SNSPGKSHAAQLLPG*PTAALPQRGQPSPGAATTRGGSPSAQR 508 S+SP + H ++L P+++ P P P AA T SPS +R Sbjct: 3498 SSSPSRHHPSRLPWSPPSSSSPSSSSPPPRAAATITTSPSPRR 3626
>LOC_Os05g38530:12005.t03395:unspliced-genomic heat shock cognate 70 kDa protein, putative, expressed| Length = 3225 Score = 35.0 bits (70), Expect = 1.4 Identities = 20/52 (38%), Positives = 24/52 (46%) Frame = +2 / +1 Query: 638 CRCVCSRGPSPRRWVSSRAGSSPRRFSAPCA*VHRRQRSVATSARMSRQSLS 793 CR +R +R G S RR SAP A RR+R S R +R S S Sbjct: 1696 CRSSSARTRRTSAATRARCGGSGRRASAPSARCRRRRRPPLRSTRCTRASTS 1851
>LOC_Os01g65630:12001.t05925:unspliced-genomic expressed protein| Length = 1445 Score = 35.0 bits (70), Expect = 1.4 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 / +3 Query: 659 GPSPRRWVSSRAGSSPRRFSAPCA 730 G S RRW SR+GS P S+PC+ Sbjct: 822 GTSARRWTPSRSGSRPPPSSSPCS 893
>LOC_Os01g25590:12001.t02275:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3141 Score = 29.9 bits (59), Expect(2) = 1.4 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +3 / +3 Query: 624 RASWSAGVFVAGAPPRVDGCPAGRALPLVGSQRRVH 731 R + +G+F A P CP R P G RR H Sbjct: 1686 RRAEPSGIFTKAALPHAFRCPTERRAPSAGLGRRKH 1793 Score = 27.6 bits (54), Expect(2) = 1.4 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +3 / +2 Query: 159 PCPGARGGSPRPIPGVRTPRSDPPVELILVNGANRANS 272 P GARG + P P R R PP L+ R ++ Sbjct: 1004 PVMGARGAAALPTPEGRGSRRVPPPHLLPEGAGRRVSA 1117
>LOC_Os03g02750:12003.t00164:unspliced-genomic xylem serine proteinase 1 precursor, putative, expressed| Length = 2693 Score = 29.5 bits (58), Expect(2) = 1.5 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 / +2 Query: 698 SPPCWTPIYAGRGPCYKHTC 639 +PP WT R PC +H C Sbjct: 2156 TPPWWTCPRTSRSPCTRHCC 2215 Score = 22.6 bits (43), Expect(2) = 1.5 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 / +2 Query: 570 QRGQPSPGAATTRGGSPSA 514 Q +PSP + T GSP++ Sbjct: 2267 QGSRPSPASRGTSSGSPTS 2323
>LOC_Os01g38110:12001.t03349:unspliced-genomic cytochrome P450 76C4, putative, expressed| Length = 1938 Score = 26.7 bits (52), Expect(2) = 1.5 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 / +2 Query: 552 PGAATTRGGSPSAQR 508 P +TTRGGSP+ +R Sbjct: 1196 PSRSTTRGGSPTCRR 1240 Score = 25.4 bits (49), Expect(2) = 1.5 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -2 / +3 Query: 411 PIRGGGRKGEG 379 P+RGGGR+G G Sbjct: 1287 PLRGGGRRGGG 1319
>LOC_Os08g43570:12008.t04082:unspliced-genomic beta-galactosidase precursor, putative, expressed| Length = 4594 Score = 32.2 bits (64), Expect(2) = 1.5 Identities = 18/58 (31%), Positives = 28/58 (48%) Frame = +2 / +3 Query: 662 PSPRRWVSSRAGSSPRRFSAPCA*VHRRQRSVATSARMSRQSLSLSFPVVRQRAISDN 835 P+ RRW S+R+ S+ SAP RR R+ + R+S + + P R S + Sbjct: 2490 PTARRWCSARSTSTRSTTSAPSTSPTRRCRTTCGRCTVRRRSPATARPPSAHRGHSSS 2663 Score = 25.8 bits (50), Expect(2) = 1.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 / +2 Query: 135 FRRLRHRPPC 164 F R RHRPPC Sbjct: 11 FTRARHRPPC 40
>LOC_Os01g24440:12001.t02165:unspliced-genomic expressed protein| Length = 1215 Score = 28.6 bits (56), Expect(2) = 1.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 / +2 Query: 129 PPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 PP RR R AR PRP P P PP Sbjct: 119 PPGRRRRRCRSSSSARSPPPRPSPPPPPPPPPPP 220 Score = 27.6 bits (54), Expect(2) = 1.5 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 / +2 Query: 575 RAAVGYPGSSCAAWLLPGELECRCVCSRGPSPRRW 679 R G+ SSCA+ P C SR SPR W Sbjct: 488 RRRSGWCTSSCASSRSPTAPSSPCGGSRASSPRAW 592
>LOC_Os07g36320:12007.t03304:unspliced-genomic F-box domain containing protein, expressed| Length = 1012 Score = 28.1 bits (55), Expect(2) = 1.6 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 / +1 Query: 588 PTAALPQRGQPSPGAATTRGGSPSA 514 P + P+R P PG+A+ R SP + Sbjct: 472 PPSTAPRRTPPPPGSASPRPSSPES 546 Score = 24.0 bits (46), Expect(2) = 1.6 Identities = 13/42 (30%), Positives = 16/42 (38%) Frame = -3 / +3 Query: 728 HTALRTDEGKSPPCWTPIYAGRGPCYKHTCTPTRPAKATPRS 603 H R D+ PP + G P +PT PA P S Sbjct: 294 HQRRRQDQLAVPPLAPRLEMGVRPLLASLPSPTTPAPCAPPS 419
>LOC_Os05g48840:12005.t04318:unspliced-genomic expressed protein| Length = 935 Score = 29.9 bits (59), Expect(2) = 1.6 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -1 / +3 Query: 796 QRQRLTGHSRRCCYAALPAMNSCTRR*EPTRGRA 695 +R R R CC A +SC RR PTRG A Sbjct: 225 RRTRARRTWRSCCRRAPCWRSSCCRRSSPTRGTA 326 Score = 22.1 bits (42), Expect(2) = 1.6 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 / +3 Query: 571 TARPT*PWR 545 T+RPT PWR Sbjct: 327 TSRPTAPWR 353
>LOC_Os05g50720:12005.t04502:unspliced-genomic harpin-induced protein, putative, expressed| Length = 1090 Score = 26.3 bits (51), Expect(3) = 1.7 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +1 / -3 Query: 898 WCACRRAWVR 927 WC+CR +W R Sbjct: 497 WCSCRTSWTR 468 Score = 24.0 bits (46), Expect(3) = 1.7 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +3 / -3 Query: 129 PPFRRLRHRPPCPGARGGSPRP 194 PP RR R P PG+ P P Sbjct: 620 PPCRRTRPCRPAPGSCPAPPPP 555 Score = 24.0 bits (46), Expect(3) = 1.7 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 / -2 Query: 1249 GNGMWSCSSCCWCVG 1293 G+G SC WCVG Sbjct: 105 GSGSAMNRSCLWCVG 61
>LOC_Os01g48120:12001.t04257:unspliced-genomic hypothetical protein| Length = 1421 Score = 33.6 bits (67), Expect(2) = 1.7 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -2 / -3 Query: 645 HLHSNSPGKSHAAQLLPG*PTAALPQRGQPSPGA 544 H+ S +P + A LP PT LPQ P PG+ Sbjct: 1407 HMASTTPNRRPTAGRLPVLPTTRLPQHQPPPPGS 1306 Score = 22.6 bits (43), Expect(2) = 1.7 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -2 / -1 Query: 567 RGQPSPGAATTRGGSPSAQR 508 R P P A R G+PS R Sbjct: 299 RAAPPPLTALVRDGAPSTSR 240
>LOC_Os07g33380:12007.t03017:unspliced-genomic conserved hypothetical protein| Length = 945 Score = 25.4 bits (49), Expect(3) = 1.8 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 / -2 Query: 348 GAPSSPKVRPRLPPSFLLRGSARIR 422 GAPS+ + R RLPP L S R R Sbjct: 281 GAPSTRRGRRRLPPGALDTVSPRQR 207 Score = 24.4 bits (47), Expect(3) = 1.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 / -3 Query: 671 RRWVSSRAGSSPRRFSAPCA 730 RR R GS+PR APC+ Sbjct: 115 RRRRRRRRGSAPRACGAPCS 56 Score = 24.0 bits (46), Expect(3) = 1.8 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +3 / -3 Query: 108 CSASSVNPPFRRLRHRPPCPGARGGSPRP 194 C +S PP R R CP + G+ P Sbjct: 748 CGRAS*TPPSRSSPCRRACPSSPAGAGAP 662
>LOC_Os11g22200:12011.t01890:unspliced-genomic major ampullate spidroin 1, putative| Length = 549 Score = 29.9 bits (59), Expect(2) = 1.8 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = -3 / +1 Query: 230 GGVAPRGPNAGNGTRGAAPSPRTWRPVPETTERRVDGGGA 111 G V R G+G RGA + R T ERR DG A Sbjct: 142 GAVMRRAVVRGSGRRGARHAVRATGDATATVERRRDGDAA 261 Score = 24.9 bits (48), Expect(2) = 1.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -2 / +3 Query: 405 RGGGRKGEGAASPW 364 RGG R+G GAA+ W Sbjct: 48 RGGRRRGGGAAA*W 89
>LOC_Os04g31630:12004.t02844:unspliced-genomic hypothetical protein| Length = 1469 Score = 28.1 bits (55), Expect(2) = 1.8 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 / -3 Query: 153 RPPCPGARGGSPRPIPGVRTPRSDP 227 RPP GAR PGV PR+ P Sbjct: 273 RPPRAGARPAPGAVAPGVGPPRAQP 199 Score = 28.1 bits (55), Expect(2) = 1.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 / -2 Query: 644 CVCSRGPSPRRWVSSRAGSSPRRFSAP 724 C CS PSPRR S + PR P Sbjct: 88 CCCSCSPSPRRPASPDPRTPPRSVPPP 8
>LOC_Os03g58750:12003.t05128:unspliced-genomic receptor protein kinase CRINKLY4 precursor, putative, expressed| Length = 1470 Score = 33.1 bits (66), Expect(2) = 1.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 / -3 Query: 153 RPPCPGARGGSPRPIPGVRTPRSDPP 230 RP PG R G P P P TP PP Sbjct: 1252 RPAPPGRRAGRPCPAPRTGTPAPPPP 1175 Score = 23.1 bits (44), Expect(2) = 1.8 Identities = 9/24 (37%), Positives = 10/24 (41%) Frame = +2 / -3 Query: 545 APGLGWPRCGRAAVGYPGSSCAAW 616 +PG G P C A P S W Sbjct: 955 SPGRGTPACPAAPCSTPAPSRPPW 884 Score = 32.2 bits (64), Expect = 9.3 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +3 / +3 Query: 114 ASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRS 221 A + +PP RR R R P RG +PR P S Sbjct: 3 APTASPPRRRRRRRGAAPAGRGETPRLAPAAAAAAS 110
>LOC_Os02g16030:12002.t01396:unspliced-genomic harpin-induced protein, putative, expressed| Length = 5122 Score = 27.2 bits (53), Expect(2) = 1.9 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 / +3 Query: 588 PTAALPQRGQPSPGAATTRG 529 PTA G+P PG+AT RG Sbjct: 579 PTATSRWAGRPWPGSATRRG 638 Score = 24.4 bits (47), Expect(2) = 1.9 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 / +1 Query: 402 GGGRKGEGAASP 367 GGGR+G G A P Sbjct: 676 GGGRRGRGGARP 711
>LOC_Os05g42250:12005.t03761:unspliced-genomic cyclic nucleotide-gated ion channel 2, putative, expressed| Length = 4637 Score = 28.1 bits (55), Expect(2) = 1.9 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 / -3 Query: 126 NPPFRRLRHRPPCPGARGGSPRPIP 200 +PP R+R RP GA +P P+P Sbjct: 210 DPPRPRVRRRPRRRGAAAETPPPLP 136 Score = 23.5 bits (45), Expect(2) = 1.9 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +3 / -1 Query: 183 SPRPIPGVRTPRSDPPVELILVNGANRANSFP 278 SPR +P PR+ P EL+ R S P Sbjct: 101 SPRGVPPCSGPRASPGGELLDEEVDARVESSP 6
>LOC_Os01g57510:12001.t05155:unspliced-genomic receptor protein kinase, putative, expressed| Length = 4120 Score = 26.7 bits (52), Expect(2) = 1.9 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 / -1 Query: 557 GWPRCGRAAVGYPGSSCAAW 616 G P A G P SC AW Sbjct: 988 GGPTAAATAAGTPAGSCTAW 929 Score = 24.9 bits (48), Expect(2) = 1.9 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 / -1 Query: 644 CVCSRGPSPRRWVSSRAGSS 703 C C +PR W S R G S Sbjct: 925 CWCRSSRTPRTWRSRRTGRS 866
>LOC_Os01g09700:12001.t00847:unspliced-genomic 1-aminocyclopropane-1-carboxylate synthase 7, putative, expressed| Length = 3610 Score = 27.6 bits (54), Expect(2) = 1.9 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = -3 / +1 Query: 638 TPTRPAKATPRSCCRGSLPRLSHSEANLALARLPRGEGAPLRSARTHS 495 +PT P ++ PRS R S + A + + R AP RT S Sbjct: 2485 SPTPPTRSAPRSGARCSTTSSTSCRATTSTSSPTRSTPAPSSPRRTSS 2628 Score = 24.0 bits (46), Expect(2) = 1.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -1 / +2 Query: 799 RQRQRLTGHSRR 764 RQR+R+ GH RR Sbjct: 2390 RQRERVPGHGRR 2425
>LOC_Os12g40419:12012.t03720:unspliced-genomic WAK-like kinase, putative, expressed| Length = 11427 Score = 34.5 bits (69), Expect = 1.9 Identities = 17/40 (42%), Positives = 20/40 (50%) Frame = +3 / -2 Query: 111 SASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 ++SS N P R R G R G+PRP P RT R P Sbjct: 725 ASSSANTPPASPRRRRTSAGCRTGAPRPCPTGRTCRRRAP 606
>LOC_Os10g41250:12010.t03361:unspliced-genomic glycoprotein, putative, expressed| Length = 1964 Score = 34.5 bits (69), Expect = 1.9 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +3 / -2 Query: 129 PPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 P RR RH P P A + R VRTPR+ PP Sbjct: 379 PHGRRRRHHLPPPPAPAATARGGAAVRTPRTPPP 278
>LOC_Os10g23120:12010.t01789:unspliced-genomic pyridoxamine-phosphate oxidase, putative, expressed| Length = 6051 Score = 34.5 bits (69), Expect = 1.9 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 / -2 Query: 147 RHRPPCPGARGGSPRPIPGVRTPR 218 R PP P ARG SP P RTPR Sbjct: 338 RRSPPPPAARGASPPPPTPTRTPR 267
>LOC_Os06g50360:12006.t04720:unspliced-genomic RNA binding protein, putative, expressed| Length = 4513 Score = 34.5 bits (69), Expect = 1.9 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 / +1 Query: 156 PPCPGARGGSPRPIPGVRTPRSDPPVELI 242 PPC G RGG G RTP + PP ++ Sbjct: 70 PPCCGDRGGEAAVAWGHRTPDASPPTRML 156
>LOC_Os06g40060:12006.t03703:unspliced-genomic acetylglucosaminyltransferase, putative, expressed| Length = 3963 Score = 34.5 bits (69), Expect = 1.9 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 / +2 Query: 156 PPCPGARGGSPRPIPGVRTPRSDPPV 233 PP P R +P P P + +PRS PPV Sbjct: 89 PPPPPPRAAAPDPNPRLASPRSTPPV 166
>LOC_Os06g18970:12006.t01720:unspliced-genomic expressed protein| Length = 6828 Score = 34.5 bits (69), Expect = 1.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 / -2 Query: 221 APRGPNAGNGTRGAAPSPRTWRPVPETTERRVD 123 AP A A PSPR RP PET RR D Sbjct: 5618 APTAAAAAAAIASARPSPRRRRPPPETVRRRDD 5520
>LOC_Os05g07880:12005.t00669:unspliced-genomic phospholipase D alpha 1 precursor, putative, expressed| Length = 4571 Score = 34.5 bits (69), Expect = 1.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -3 / -1 Query: 218 PRGPNAGNGTRGAAPSPRTWRPVP 147 PRGP G+G R A + R W P P Sbjct: 3017 PRGPRGGSGCRATARAARPWPPSP 2946
>LOC_Os04g44640:12004.t04004:unspliced-genomic ulp1 protease family, C-terminal catalytic domain containing| protein, expressed Length = 11103 Score = 34.5 bits (69), Expect = 1.9 Identities = 17/40 (42%), Positives = 19/40 (47%) Frame = +3 / -2 Query: 108 CSASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDP 227 CS+ S P R R PP P R SP P R+PR P Sbjct: 449 CSSRSAPAPC*RRRASPPPPPGRASSPPHPPPRRSPRRRP 330
>LOC_Os04g35880:12004.t03258:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 3955 Score = 34.5 bits (69), Expect = 1.9 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +3 / -1 Query: 183 SPRPIPGVRTPRSDPPV 233 +PRPI G+RTPR PPV Sbjct: 613 NPRPIEGLRTPRGKPPV 563
>LOC_Os05g32544:12005.t02850:unspliced-genomic glycosyltransferase, putative, expressed| Length = 9155 Score = 34.5 bits (69), Expect = 1.9 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 / -2 Query: 644 CVCSRGPSPRRWVSSRAGSSPRRFSAPCA 730 C C+ PSP R R +P R++ PCA Sbjct: 1114 CGCTAAPSPARCRGGRCTGAPTRWTGPCA 1028
>LOC_Os03g11250:12003.t00925:unspliced-genomic expressed protein| Length = 787 Score = 34.5 bits (69), Expect = 1.9 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 / -1 Query: 766 RCCYAALPAMNSCTRR*EPTRGRARPAGHP 677 RCCY LP M RR R R RPA P Sbjct: 685 RCCYCRLPTMARTRRRGREARRRRRPA*AP 596
>LOC_Os02g18040:12002.t01598:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 12139 Score = 34.5 bits (69), Expect = 1.9 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = -1 / -1 Query: 823 RPLSDYWERQRQRLTGHSRRCCYAALPAMNSCTRR*EPTRG 701 RP+ D W+R R+R H RR A P + T R E T G Sbjct: 8371 RPVYDGWQRWRRR*RHHRRRLGRACSPVNDGTTARTEGTYG 8249
>LOC_Os01g20980:12001.t01835:unspliced-genomic pectinesterase-1 precursor, putative, expressed| Length = 2620 Score = 34.5 bits (69), Expect = 1.9 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = -1 / +1 Query: 787 RLTGHSRRCCYAALPAMNSCTRR*EPTRGRARPAGHPSTRGGAPATNTP 641 R TG RC C RR PT RA A P R G AT +P Sbjct: 493 RSTGRPARCSTRRRRTCRRCCRRS*PTSRRAPTASRPPPRRGPCATASP 639
>LOC_Os01g39350:12001.t03465:unspliced-genomic protein kinase domain containing protein| Length = 2213 Score = 28.1 bits (55), Expect(2) = 2.0 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -1 / -2 Query: 724 RR*EPTRGRARPAGHPSTRGGAPATNTPA 638 RR P G P G S R GAP + TPA Sbjct: 877 RRRGPPGGTPCPRGTASRR*GAPPSRTPA 791 Score = 23.5 bits (45), Expect(2) = 2.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 / -3 Query: 826 NRPLSDYWERQRQRLTGH 773 N+PLS R+R+ L GH Sbjct: 1011 NKPLSTIEARRRELLLGH 958
>LOC_Os04g24469:12004.t02159:unspliced-genomic jasmonate-induced protein, putative| Length = 1173 Score = 30.4 bits (60), Expect(2) = 2.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 / -1 Query: 49 REGGNWRRWGDREGT 5 R GG WRRW R GT Sbjct: 306 RRGGGWRRWRCRRGT 262 Score = 25.4 bits (49), Expect(2) = 2.0 Identities = 14/46 (30%), Positives = 16/46 (34%) Frame = -1 / -1 Query: 799 RQRQRLTGHSRRCCYAALPAMNSCTRR*EPTRGRARPAGHPSTRGG 662 R+R R+ R C P C R GR P RGG Sbjct: 432 RRRPRIRRSRRTCGRGGTPPTGRCRSRWGTGCGR*SPTSRGRRRGG 295
>LOC_Os04g06144:12004.t00494:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 12619 Score = 32.2 bits (64), Expect(2) = 2.0 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +3 / +3 Query: 108 CSASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDP 227 C S P R LR P SPRP+P + PR P Sbjct: 4146 CPQPSPRPRLRLLRATSATPARAPRSPRPLPSL*RPRPRP 4265 Score = 26.7 bits (52), Expect(2) = 2.0 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 / +2 Query: 348 GAPSSPKVRPRLPPSFLLRGSARIRRG 428 G P R LPPSFL+ G R G Sbjct: 4706 GHPGRRPPRVNLPPSFLVAGRRRFPSG 4786
>LOC_Os04g09530:12004.t00788:unspliced-genomic pentatricopeptide repeat protein PPR986-12, putative, expressed| Length = 1957 Score = 26.3 bits (51), Expect(2) = 2.0 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +2 / +2 Query: 362 PQGEAAPSPFLPPPRIGSDPT 424 P P+P PPP I + PT Sbjct: 128 PAPSPTPTPLPPPPTISTTPT 190 Score = 25.4 bits (49), Expect(2) = 2.0 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +3 / +3 Query: 138 RRLRHRPPCPGARGGSPRPIPGVRTPRSDPPVELI 242 RR RH PP P R +P P PP+ L+ Sbjct: 45 RRRRHPPPAPPLRRLLLLQVPLPPPPPLPPPLLLL 149
>LOC_Os12g44300:12012.t04096:unspliced-genomic monovalent cation proton antiporter, putative, expressed| Length = 2749 Score = 29.5 bits (58), Expect(3) = 2.0 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = -3 / -1 Query: 698 SPPCWTPIYAGRGPCYKHTCTPTRPAKATPRSCCRGSLP 582 +PP P PC + C R + TPR CR P Sbjct: 2239 APPPAPPRRRRASPCTRWPCCRPRASGRTPRRTCRPPAP 2123 Score = 24.4 bits (47), Expect(3) = 2.0 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 / -1 Query: 405 RGGGRKGEGAASPW 364 RGG +G GA PW Sbjct: 1789 RGGSPRGGGAPCPW 1748 Score = 22.6 bits (43), Expect(3) = 2.0 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 / -1 Query: 218 PRGPNAGNGTRGAAPSPRTWRP 153 P GP+A P+PR+ RP Sbjct: 1489 PSGPSAAPCPPRTPPAPRSRRP 1424
>LOC_Os07g25810:12007.t02277:unspliced-genomic expressed protein| Length = 1681 Score = 33.1 bits (66), Expect(2) = 2.0 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +3 / -3 Query: 129 PPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 PPF RPP P + PRP P + P S PP Sbjct: 851 PPFPMPPPRPPPPPSPPPPPRPPPFPKPPPSPPP 750 Score = 23.1 bits (44), Expect(2) = 2.0 Identities = 10/26 (38%), Positives = 10/26 (38%) Frame = +3 / -1 Query: 621 CRASWSAGVFVAGAPPRVDGCPAGRA 698 CR W PPR G A RA Sbjct: 214 CRHPWRQPAAPTRPPPRHSGTAAARA 137
>LOC_Os08g44490:12008.t04173:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3293 Score = 29.0 bits (57), Expect(2) = 2.0 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 / +2 Query: 159 PCPGARGGSPRPIPGVRTPRSDPPVELI 242 P GARG + P PG R R +P L+ Sbjct: 1004 PAMGARGAAALPTPGGRGSRKEPLPHLL 1087 Score = 28.1 bits (55), Expect(2) = 2.0 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 / +1 Query: 642 GVFVAGAPPRVDGCPAGRALPLVGSQRRVH 731 G+F A P CP R P G RR H Sbjct: 1855 GIFSEAALPHAFRCPTERRAPSAGLGRRKH 1944
>LOC_Os04g24328:12004.t02146:unspliced-genomic jasmonate-induced protein, putative, expressed| Length = 1210 Score = 30.4 bits (60), Expect(2) = 2.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 / -2 Query: 49 REGGNWRRWGDREGT 5 R GG WRRW R GT Sbjct: 306 RRGGGWRRWRCRRGT 262 Score = 25.4 bits (49), Expect(2) = 2.0 Identities = 14/46 (30%), Positives = 16/46 (34%) Frame = -1 / -2 Query: 799 RQRQRLTGHSRRCCYAALPAMNSCTRR*EPTRGRARPAGHPSTRGG 662 R+R R+ R C P C R GR P RGG Sbjct: 432 RRRPRIRRSRRTCGRGGTPPTGRCRSRWGTGCGR*SPTSRGRRRGG 295
>LOC_Os06g38450:12006.t03540:unspliced-genomic vignain precursor, putative, expressed| Length = 1701 Score = 32.7 bits (65), Expect(2) = 2.1 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 / -2 Query: 108 CSASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRS 221 CS+ +P R +P C GG P+P +RTP S Sbjct: 1001 CSSRWSSPTVAASRGQPDCDS*SGGCLPPLPPLRTPNS 888 Score = 23.5 bits (45), Expect(2) = 2.1 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +2 / -1 Query: 638 CRCVCSRGPSPRRWVSSRAGSSPRRFSAPC 727 C C P+ R SSR R+ APC Sbjct: 336 CTCAHGPPPTSRTSPSSRCRRRRRQQPAPC 247
>LOC_Os11g01610:12011.t00059:unspliced-genomic prenylated Rab receptor 2, putative, expressed| Length = 1114 Score = 28.6 bits (56), Expect(2) = 2.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 / +1 Query: 159 PCPGARGGSPRPIPGVRTPRSDPP 230 P P R SP P P R+ S PP Sbjct: 310 PSPSPRPSSPTPSPSPRSSPSSPP 381 Score = 23.1 bits (44), Expect(2) = 2.1 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +3 / +1 Query: 357 SSPKVRPRLPPS 392 S+P RPR PPS Sbjct: 400 SAPPTRPRSPPS 435
>LOC_Os01g48320:12001.t04276:unspliced-genomic 6b-interacting protein 1, putative, expressed| Length = 1799 Score = 30.9 bits (61), Expect(2) = 2.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 / -2 Query: 46 EGGNWRRWGDREGTP 2 EGG WRRWG G P Sbjct: 148 EGGTWRRWGGGIGRP 104 Score = 25.4 bits (49), Expect(2) = 2.2 Identities = 11/39 (28%), Positives = 15/39 (38%) Frame = -3 / -1 Query: 725 TALRTDEGKSPPCWTPIYAGRGPCYKHTCTPTRPAKATP 609 T R ++PPC + RG C C A+ P Sbjct: 668 TRTRASPARAPPCTSS*GCRRGSCTGCRCAAAGGARTPP 552
>LOC_Os10g16510:12010.t01216:unspliced-genomic hypothetical protein| Length = 683 Score = 32.2 bits (64), Expect(2) = 2.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 / +1 Query: 79 YFSEAYQGRTREGGNWRRWGD 17 +F + G GG WRRWGD Sbjct: 532 WFGAGFGGGKSGGGEWRRWGD 594 Score = 22.6 bits (43), Expect(2) = 2.2 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = -1 / +2 Query: 706 RGRARPAGHPSTRGGAPATNTP 641 RGR G P+ RGG P Sbjct: 35 RGRRSSGGFPAKRGGGRGPPRP 100
>LOC_Os05g01470:12005.t00048:unspliced-genomic methionine S-methyltransferase, putative, expressed| Length = 10229 Score = 31.3 bits (62), Expect(2) = 2.2 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = -1 / -2 Query: 778 GHSRRCCYAALPAMNSCTRR*EPTRGRARPAGHPSTRGGAPA 653 G R C + PA +R+ GR G S RGGAPA Sbjct: 265 GRGRGCGIRSAPASRRWSRKAGAPSGRRGRRGEWSARGGAPA 140 Score = 27.2 bits (53), Expect(2) = 2.2 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -1 / -1 Query: 1354 HHLHTYPINSTYKLHAQMPICQHTNNMNYKTTYHCP 1247 H ++ +NS+ LH+ P C H + +K P Sbjct: 10049 HANTSFRLNSSLLLHSYQPSCAHYSFSKHKNVQSAP 9942
>LOC_Os01g07490:12001.t00628:unspliced-genomic RST1, putative, expressed| Length = 14549 Score = 32.7 bits (65), Expect(2) = 2.2 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 / +2 Query: 123 VNPPFRRLRHRPPCPGARGGSPRPIP 200 V P RR+ RPP PGAR +P P Sbjct: 314 VRRPTRRIPRRPPLPGARPPAPHRAP 391 Score = 26.3 bits (51), Expect(2) = 2.2 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +3 / +1 Query: 762 HRRECPVSLCRCRS 803 HR+ C V CRCRS Sbjct: 12397 HRKVCWVICCRCRS 12438
>LOC_Os12g39360:12012.t03616:unspliced-genomic aspartic proteinase nepenthesin-1 precursor, putative, expressed| Length = 2665 Score = 31.8 bits (63), Expect(2) = 2.3 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -1 / +1 Query: 787 RLTGHSRRCCYAALPAMNSCTRR*EPTRGRARPAGHPSTRGGAP 656 R RR A LP RR RGRARP G + R P Sbjct: 181 RAARRRRRQAAAGLPGRRDGRRRRRRRRGRARPLGDAAVRRRVP 312 Score = 24.9 bits (48), Expect(2) = 2.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 / +1 Query: 212 GPNAGNGTRGAAPSPRTWRPVPETTERRVDGGG 114 G A RGAA R WR V R G G Sbjct: 1051 GGAAERQPRGAAAGRRRWRAVRGAARRGQGGAG 1149
>LOC_Os08g09340:12008.t00819:unspliced-genomic bromodomain containing protein, expressed| Length = 2119 Score = 26.7 bits (52), Expect(3) = 2.3 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 / +2 Query: 1249 GNGMWSCSSCC 1281 GN M SCSSCC Sbjct: 1874 GNWMGSCSSCC 1906 Score = 25.8 bits (50), Expect(3) = 2.3 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 / +1 Query: 153 RPPCPGARGGSPRPIPGV 206 RPPCP R PR + GV Sbjct: 778 RPPCPPLRQ*PPRHLRGV 831 Score = 23.1 bits (44), Expect(3) = 2.3 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 / +3 Query: 765 RRECPVSLCRCR 800 RR P LCRCR Sbjct: 906 RRRSPRCLCRCR 941
>LOC_Os08g42940:12008.t04022:unspliced-genomic expressed protein| Length = 2071 Score = 33.1 bits (66), Expect(2) = 2.4 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -1 / -1 Query: 1249 PTYMLSLTLHQTTGKKSYIRTSATH*YRL 1163 P Y L+ HQ GKKS + TSAT Y L Sbjct: 817 PKYNLTSASHQRRGKKSKLNTSATTKYNL 731 Score = 23.1 bits (44), Expect(2) = 2.4 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -2 / -1 Query: 402 GGGRKGEGAASP 367 GGG++G+ ASP Sbjct: 139 GGGKQGQSGASP 104
>LOC_Os01g39220:12001.t03454:unspliced-genomic LOB domain protein 11, putative| Length = 420 Score = 30.4 bits (60), Expect(2) = 2.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 / +3 Query: 129 PPFRRLRHRPPCPGARGGSPRP 194 PP RR RH PP G R G P Sbjct: 135 PPLRRGRHPPPAGGGRPGHRDP 200 Score = 23.5 bits (45), Expect(2) = 2.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 / +2 Query: 357 SSPKVRPRLPPS 392 SSP RPR PPS Sbjct: 296 SSPASRPRSPPS 331
>LOC_Os01g22336:12001.t01968:unspliced-genomic peroxidase 1 precursor, putative, expressed| Length = 5681 Score = 29.0 bits (57), Expect(2) = 2.5 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 / -3 Query: 644 TCTPTRPAKATPRSCCR 594 +C+PTRPA +P + CR Sbjct: 5469 SCSPTRPASRSPAAGCR 5419 Score = 22.1 bits (42), Expect(2) = 2.5 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -1 / -3 Query: 799 RQRQRLTGHSRRC 761 R+R+R+TG RRC Sbjct: 5613 RRRRRMTGC*RRC 5575
>LOC_Os10g05890:12010.t00462:unspliced-genomic expressed protein| Length = 2106 Score = 29.9 bits (59), Expect(2) = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 / -2 Query: 641 RCVCSRGPSPRRWVSSRAGSSP 706 RC C R PSP R SS G SP Sbjct: 608 RCQCRRRPSPPRRPSSLHGRSP 543 Score = 26.3 bits (51), Expect(2) = 2.5 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 / -2 Query: 150 HRPPCPGARGGSPRP 194 HRPPCP PRP Sbjct: 779 HRPPCPPPLCRRPRP 735
>LOC_Os01g65500:12001.t05914:unspliced-genomic chloride channel protein CLC-c, putative, expressed| Length = 4662 Score = 26.3 bits (51), Expect(2) = 2.5 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -1 / +2 Query: 577 SPTARPT*PWRGYHEGREPLCAAHARTLHCRTSR 476 SPTAR T WR R P +A + + C + R Sbjct: 4070 SPTARRTP*WRTCRWPRPPCSSASSASATCASCR 4171 Score = 24.9 bits (48), Expect(2) = 2.5 Identities = 14/60 (23%), Positives = 23/60 (38%) Frame = -1 / +2 Query: 793 RQRLTGHSRRCCYAALPAMNSCTRR*EPTRGRARPAGHPSTRGGAPATNTPALQLARQKP 614 R R + SR C + +SC+ P+ A P + + +P+ AR P Sbjct: 3833 RTRRSRRSRSCAASCCAPTSSCSSAPRPSPPTASRPAPPRCSASSRRSTSPSPGRARASP 4012
>LOC_Os01g36090:12001.t03159:unspliced-genomic DNA-damage-repair/toleration protein DRT102, putative, expressed| Length = 1616 Score = 28.1 bits (55), Expect(3) = 2.5 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +2 / +2 Query: 671 RRWVSSRAGSSPRRFSAPCA*VHRRQRSVATSARMSRQSLSLS 799 R W SSR GS P C RR+ S + SR++ + S Sbjct: 575 RGWSSSRWGSCPAARCGSCGRAPRRRTSGSRPGAWSRRTTTRS 703 Score = 23.5 bits (45), Expect(3) = 2.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 / +3 Query: 129 PPFRRLRHRP 158 PPFRR R RP Sbjct: 99 PPFRRRRRRP 128 Score = 23.1 bits (44), Expect(3) = 2.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 / +3 Query: 171 ARGGSPRPIPGVR 209 AR PRP+PG+R Sbjct: 411 ARHPVPRPVPGLR 449
>LOC_Os06g15540:12006.t01427:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2166 Score = 32.7 bits (65), Expect(2) = 2.5 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 / -3 Query: 730 CTRR*EPTRGRARPAGHPSTRGGAPATNTP 641 C RR P G R AG TRG A TP Sbjct: 1888 CLRRPRPAEGARRSAGRQKTRGRAALKKTP 1799 Score = 23.5 bits (45), Expect(2) = 2.5 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -3 / -3 Query: 176 PSPRTWRPVP 147 P+P +WRP P Sbjct: 571 PAPASWRPAP 542
>LOC_Os12g43110:12012.t03983:unspliced-genomic OsSAUR58 - Auxin-responsive SAUR gene family member, expressed| Length = 674 Score = 34.1 bits (68), Expect = 2.6 Identities = 19/57 (33%), Positives = 21/57 (36%) Frame = -3 / -1 Query: 692 PCWTPIYAGRGPCYKHTCTPTRPAKATPRSCCRGSLPRLSHSEANLALARLPRGEGA 522 P +P Y GP PT P PR+ R PR A R RG GA Sbjct: 542 PQSSPSYLQMGPARPGPARPTSPTDGRPRAATRCRRPRRRRRRARRGRRRRGRGCGA 372
>LOC_Os12g37570:12012.t03437:unspliced-genomic ATP binding protein, putative, expressed| Length = 7240 Score = 34.1 bits (68), Expect = 2.6 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 / -1 Query: 156 PPCPGARGGSPRPIPGVRTPRSDPP 230 PP PG+ G+PR P TP + PP Sbjct: 214 PPAPGSSSGAPRRSPPSPTPTTTPP 140
>LOC_Os12g11410:12012.t01016:unspliced-genomic retrotransposon protein, putative, LINE subclass| Length = 2707 Score = 34.1 bits (68), Expect = 2.6 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 / -1 Query: 141 RLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 R RHR PCP A RP+ V R PP Sbjct: 235 RHRHRHPCPAATVSHHRPVATVSRHRRQPP 146
>LOC_Os09g21340:12009.t01868:unspliced-genomic permease I, putative, expressed| Length = 4607 Score = 34.1 bits (68), Expect = 2.6 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -3 / -3 Query: 635 PTRPAKATPRSCCRGSLPRLSHSEANLALARL 540 P+ P RSCCRGS P+ A+ ARL Sbjct: 4056 PSSPCYCASRSCCRGSRPQDPRQTASTRTARL 3961
>LOC_Os08g36700:12008.t03409:unspliced-genomic AT-HSFB4, putative, expressed| Length = 1236 Score = 34.1 bits (68), Expect = 2.6 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 / +2 Query: 147 RHRPPCPGARGGSPRPIPGVRTPRSDPPVELILVNGANRANS 272 R RP C G+PRP+ R P++ P L G R +S Sbjct: 911 RPRPRCAAPPAGAPRPVARSRWPKTSPRCWLCGCRGRRRRSS 1036
>LOC_Os07g25460:12007.t04707:unspliced-genomic protein binding protein, putative, expressed| Length = 5839 Score = 34.1 bits (68), Expect = 2.6 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +3 / +1 Query: 141 RLRHRPPCPGARGGSPRPIPGVRTPRSDPPVELI 242 R RHRPP P AR G P P R R P L+ Sbjct: 706 RPRHRPPLPAARLGQVVPPPPPRRRRHAPHARLL 807
>LOC_Os07g09690:12007.t00843:unspliced-genomic galactosyltransferase/ transferase, transferring hexosyl groups,| putative, expressed Length = 4172 Score = 34.1 bits (68), Expect = 2.6 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -3 / -3 Query: 227 GVAPRGPNAGNGTRGAAPSPRTWRPVP 147 G PRGP+ G R A P+ TW P P Sbjct: 717 GAPPRGPSHGTRRRSA*PTAGTWPPPP 637
>LOC_Os06g13870:12006.t01262:unspliced-genomic immediate-early fungal elicitor protein CMPG1, putative, expressed| Length = 1442 Score = 34.1 bits (68), Expect = 2.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 / +2 Query: 132 PFRRLRHRPPCPGARGGSPRPIPGVRTPRSDP 227 P RL RPP PG PR + R PR +P Sbjct: 839 PRARLLRRPPRPGGHREGPRHVRRARRPRHEP 934
>LOC_Os05g41180:12005.t03656:unspliced-genomic proteasome subunit alpha type 3, putative, expressed| Length = 4240 Score = 34.1 bits (68), Expect = 2.6 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +3 / +2 Query: 138 RRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 RR R RPP P A G RP+P R + PP Sbjct: 98 RRRRRRPPSPPAGIGKRRPLPLPRVRLAGPP 190
>LOC_Os05g35010:12005.t03094:unspliced-genomic cytochrome P450 71C4, putative, expressed| Length = 1934 Score = 34.1 bits (68), Expect = 2.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 / +2 Query: 147 RHRPPCPGARGGSPRPIPGVRTPRSDPP 230 RHR P PG R SPRP R R P Sbjct: 314 RHRQPAPGGRAASPRPARARRGHRRASP 397
>LOC_Os05g33730:12005.t02968:unspliced-genomic gibberellin receptor GID1L2, putative, expressed| Length = 2865 Score = 34.1 bits (68), Expect = 2.6 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +3 / -1 Query: 111 SASSVNPPFRRLRHRPPCPGARGGSPRP 194 SAS+ P R++ R P P A GGSP P Sbjct: 414 SASNTTHPPRKISRRAPSPHAMGGSPDP 331
>LOC_Os04g12950:12004.t01116:unspliced-genomic indole-3-acetate beta-glucosyltransferase, putative| Length = 13600 Score = 34.1 bits (68), Expect = 2.6 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +3 / +1 Query: 108 CSASSVNPPFRRLRHRPPCPGARGGSPRPIP 200 C +P FRR RHR PG G P P+P Sbjct: 12220 CCTIRHHPHFRRRRHRNQYPGGPGFPPVPLP 12312
>LOC_Os04g12880:12004.t01110:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3312 Score = 34.1 bits (68), Expect = 2.6 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +3 / +1 Query: 129 PPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 P R +H P PG R S RP+P R S PP Sbjct: 373 PQRRPCQHGRPLPGRRPDSSRPLPSQRPRDSRPP 474
>LOC_Os03g11220:12003.t00922:unspliced-genomic RPGR, putative, expressed| Length = 1541 Score = 34.1 bits (68), Expect = 2.6 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 / -1 Query: 138 RRLRHRPPCPGARGGSPRPIPG 203 RR+R PPC GG+PRP G Sbjct: 392 RRIRRNPPCGRTGGGTPRPSRG 327
>LOC_Os03g04260:12003.t00306:unspliced-genomic glutathione S-transferase, putative, expressed| Length = 1298 Score = 34.1 bits (68), Expect = 2.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +3 / -1 Query: 162 CPGARGGSPRPIPGVRTPRSDPP 230 C AR G+ RP PG R PR+ PP Sbjct: 197 CRPARPGTARPSPGGRPPRAPPP 129
>LOC_Os01g67730:12001.t06130:unspliced-genomic expressed protein| Length = 2399 Score = 34.1 bits (68), Expect = 2.6 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 / -2 Query: 129 PPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPPV 233 PP RR PP P R PGVRT PPV Sbjct: 115 PPLRRASAGPPRPSPWRRRRRKSPGVRTESERPPV 11
>LOC_Os01g49830:12001.t04421:unspliced-genomic DNA-binding protein RAV1, putative, expressed| Length = 1635 Score = 34.1 bits (68), Expect = 2.6 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +3 / +2 Query: 114 ASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPR 218 AS+ +PP RR PP P S RP P R PR Sbjct: 662 ASAPSPPPRRRPRPPPPPSPTATSRRPAPPSRPPR 766
>LOC_Os01g35330:12001.t03087:unspliced-genomic circumsporozoite protein precursor, putative, expressed| Length = 1200 Score = 34.1 bits (68), Expect = 2.6 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 / -1 Query: 111 SASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 +A+S PP R +PP P A P+P P R + PP Sbjct: 513 AATSQAPPPRAASVQPPPPRAAAAQPQPPPRPRVATAQPP 394
>LOC_Os01g10980:12001.t00971:unspliced-genomic nodulin-like protein, putative| Length = 1454 Score = 34.1 bits (68), Expect = 2.6 Identities = 17/59 (28%), Positives = 24/59 (40%) Frame = -3 / -3 Query: 716 RTDEGKSPPCWTPIYAGRGPCYKHTCTPTRPAKATPRSCCRGSLPRLSHSEANLALARL 540 RT +G S R P + P RP+ P S GSLP +H ++ + L Sbjct: 816 RTRDGGSRGLSPARRTARSPARRPRTAPRRPSSPRPTSSSAGSLPPCNHERRSVLITHL 640
>LOC_Os11g33250:12011.t02919:unspliced-genomic expressed protein| Length = 1956 Score = 34.1 bits (68), Expect = 2.6 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = -2 / -1 Query: 726 HGAENRRGEEPALLDTHLRGEGPLLQTHLHSNSPGKSHAAQLLPG 592 HG E RRG + AL H+ G G Q G HA PG Sbjct: 828 HGGERRRGVDDALQVVHVHGAGLQPQRRQPRGFHGGRHAQAAAPG 694
>LOC_Os10g30150:12010.t02349:unspliced-genomic ethylene-responsive protein, putative, expressed| Length = 956 Score = 34.1 bits (68), Expect = 2.6 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +2 / +2 Query: 542 AAPGLGWPRCGRAAVGYPGSSCAAWLLPGELECRCVCSRGPSPRRWVSSRAGSSP 706 +A G+GWPR G PG CAA L C + +P R +++ + P Sbjct: 443 SASGVGWPRRRWRWRGSPGRRCAAPLRTPAPACSSSAAAASAPSRGTHTQSRTHP 607
>LOC_Os08g38080:12008.t03544:unspliced-genomic BHLH transcription factor, putative, expressed| Length = 2047 Score = 34.1 bits (68), Expect = 2.6 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +2 / +1 Query: 683 SSRAGSSPRRFSAPCA*VHRRQRSVATSARMSRQSLSLSFPVVRQRA 823 S RA + PRR +AP + HR+ + A++ S + S S PV +R+ Sbjct: 217 SRRAPALPRRRAAPASCCHRQPCAAASAVSRSTPAASSSRPVTARRS 357
>LOC_Os04g38880:12004.t03458:unspliced-genomic microtubule motor, putative, expressed| Length = 2613 Score = 34.1 bits (68), Expect = 2.6 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = +2 / -1 Query: 614 WLLPGELECRCVCSRGPSPRRWVSSRAGSSPRRFSAPC 727 W++P R C R + RRW R GS A C Sbjct: 690 WMIPSSARARGACCRSAAWRRWPPGRPGSRGAAAPAAC 577
>LOC_Os02g14170:12002.t01213:unspliced-genomic peroxidase precursor, putative, expressed| Length = 1572 Score = 34.1 bits (68), Expect = 2.6 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +2 / +3 Query: 608 AAWLLPGELECRCVCSRGPSPRRWVSSRA 694 A WL GE + RC CS SP RW RA Sbjct: 144 APWLSAGEGDGRCSCSCSSSPWRWRWRRA 230
>LOC_Os01g26940:12001.t02398:unspliced-genomic RNA binding protein, putative, expressed| Length = 6264 Score = 33.1 bits (66), Expect(2) = 2.6 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +3 / +2 Query: 117 SSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRS 221 S + PP RR R RPP G G P P PRS Sbjct: 125 SPLLPPCRRRRPRPPRAGRDGAGPDPGAAGPAPRS 229 Score = 24.4 bits (47), Expect(2) = 2.6 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 / +3 Query: 641 RCVCSRGPSPRRWVSSRAGSSPRRFS 718 R + R SPRR SR SPRR S Sbjct: 2856 RALPKRRDSPRRDSPSRRRDSPRRDS 2933
>LOC_Os03g10980:12003.t00899:unspliced-genomic conserved hypothetical protein| Length = 2267 Score = 30.9 bits (61), Expect(2) = 2.6 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 / -2 Query: 165 PGARGGSPRPIPGVRTP 215 PG+ GGSP P P RTP Sbjct: 1708 PGSPGGSPWPCPSCRTP 1658 Score = 25.4 bits (49), Expect(2) = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 / -2 Query: 653 SRGPSPRRWVSSRAGSSPRRFSAPCA 730 SR P PRR ++RAG+ +AP A Sbjct: 1591 SRRPPPRRRRAARAGTGRGCCAAPAA 1514
>LOC_Os09g21890:12009.t01923:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2330 Score = 28.6 bits (56), Expect(3) = 2.7 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 / +3 Query: 820 PLSDYWERQRQRLTGHSRRCC 758 P+S W R+ R T RRCC Sbjct: 165 PVSSSWLRRTWRTTPRQRRCC 227 Score = 24.0 bits (46), Expect(3) = 2.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 / +3 Query: 746 AGDELMHTALRTDEGK 699 AGD HTA TD G+ Sbjct: 486 AGDTAAHTATHTDTGQ 533 Score = 23.1 bits (44), Expect(3) = 2.7 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -1 / +1 Query: 46 EGGNWRRWGDR 14 EG WRRW R Sbjct: 781 EGAGWRRWWRR 813
>LOC_Os07g07800:12007.t00658:unspliced-genomic PHA synthase, putative| Length = 857 Score = 29.9 bits (59), Expect(2) = 2.7 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 / -3 Query: 111 SASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDP 227 S + PP LR PPC R P P P P P Sbjct: 777 STAPAPPPHPSLRRPPPCQPPRRPPPHPPPRRTPPCQPP 661 Score = 24.9 bits (48), Expect(2) = 2.7 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = +2 / -1 Query: 593 PGSSCAAWLLPGELECRCVCSRGPSPRRWVSSRAGSSPRRFSAPCA 730 PGS+ AA + P R R P+P R R S+P SA A Sbjct: 485 PGSASAASVAPCRGARRRPLLRRPAPPRRPPQRRPSTPPAASAGSA 348
>LOC_Os12g04130:12012.t00303:unspliced-genomic kelch motif family protein, expressed| Length = 2788 Score = 26.3 bits (51), Expect(3) = 2.7 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -2 / +3 Query: 603 LLPG*PTAALPQRGQPSPGAATTRGGSPSA 514 L P P + PQR +P A+ T SPSA Sbjct: 2274 LRPTPPPSRPPQRTSAAPCASATASPSPSA 2363 Score = 24.9 bits (48), Expect(3) = 2.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -1 / +1 Query: 766 RCCYAALPAMNSCTRR*EPTRGRARPA 686 R C+ + + ++ RR TR ARPA Sbjct: 529 RSCWVGMSSSSAAGRRCASTRSPARPA 609 Score = 24.9 bits (48), Expect(3) = 2.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -3 / +1 Query: 644 TCTPTRPAKATPRSCCRGSLP 582 T +P RPA+A PRS S P Sbjct: 586 TRSPARPARARPRSSRGRSSP 648
>LOC_Os05g10780:12005.t00911:unspliced-genomic 1-aminocyclopropane-1-carboxylate synthase 7, putative, expressed| Length = 1696 Score = 27.2 bits (53), Expect(3) = 2.7 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 / +1 Query: 561 QPSPGAATTRGGSPSAQR 508 +P PGAA RGG +A+R Sbjct: 1360 RPPPGAARARGGRAAARR 1413 Score = 24.0 bits (46), Expect(3) = 2.7 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -3 / +3 Query: 1421 SSKQGREEQNKKNISKWGALTTTSSP 1344 S+++ R ++ + + W A T TSSP Sbjct: 963 SARRRRVASSRASSTSWRATTCTSSP 1040 Score = 23.5 bits (45), Expect(3) = 2.7 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -3 / +3 Query: 698 SPPCWTPIYAGRGPCYKHTCTPTRPAKATPRSC 600 S P TP + RG C R + +PR C Sbjct: 1221 STPTTTPWWPRRGACRASRWCRRRRSGRSPRCC 1319
>LOC_Os03g59010:12003.t05151:unspliced-genomic germin-like protein subfamily T member 1 precursor, putative,| expressed Length = 881 Score = 28.6 bits (56), Expect(2) = 2.7 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 / -2 Query: 342 PFGAPSSPKVRPRLPPSFLLRGSARIRRGAC 434 P+ P R R PS RGSAR R G C Sbjct: 448 PWSRTPPPCSRTRRAPSQRRRGSARWRAGGC 356 Score = 26.3 bits (51), Expect(2) = 2.7 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +3 / -1 Query: 1023 AAQWMCCGVLYQGIWGSNPRETPYI 1097 A W+C G+ G + P ETP + Sbjct: 371 ARGWLCSGLTPPGARSTRPMETPSV 297
>LOC_Os04g33680:12004.t03044:unspliced-genomic electron transporter, putative, expressed| Length = 1749 Score = 31.8 bits (63), Expect(2) = 2.8 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = -2 / -2 Query: 627 PGKSHAAQLLPG*PTAALPQRGQPSPGAATTRGGSPSAQRT 505 PG++ A+ P P AA RG PSP R S R+ Sbjct: 1277 PGRTPPARAPPARPAAAAAPRGSPSPWTRPARSTSRRGPRS 1155 Score = 24.0 bits (46), Expect(2) = 2.8 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -3 / -2 Query: 185 GAAPSPRTWRPVPETTERRVDGGGAA 108 G P P P+P + R GGG A Sbjct: 377 GTPPPPPLLPPLPRQPQPRAWGGGRA 300
>LOC_Os07g41820:12007.t03837:unspliced-genomic expressed protein| Length = 2460 Score = 32.7 bits (65), Expect(2) = 2.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 / +2 Query: 365 QGEAAPSPFLPPPRIGSDPTWC 430 +G ++P+ PPP GS P WC Sbjct: 824 RGTSSPTRSTPPPSTGSTPPWC 889 Score = 23.5 bits (45), Expect(2) = 2.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 / +3 Query: 168 GARGGSPRPIPGVRTPRSDPPV 233 GA G R + R PR+ PPV Sbjct: 651 GAVHGGARAVVHPRRPRAPPPV 716
>LOC_Os02g56120:12002.t05186:unspliced-genomic OsIAA9 - Auxin-responsive Aux/IAA gene family member, expressed| Length = 1275 Score = 28.6 bits (56), Expect(2) = 2.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -3 / -3 Query: 653 YKHTCTPTRPAKATPRSCC 597 Y H CTPTR +AT C Sbjct: 1039 YIHQCTPTRRCQATKTELC 983 Score = 26.7 bits (52), Expect(2) = 2.9 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -1 / -2 Query: 1342 TYPINSTYKLHAQMPICQHTNNMNYKTTYHCPT 1244 T + TY+ +C+H+ N+ T CPT Sbjct: 1223 TRSVCKTYRRCKNTELCKHSQNLALGTHEMCPT 1125
>LOC_Os06g06950:12006.t00580:unspliced-genomic hypothetical protein| Length = 1782 Score = 28.1 bits (55), Expect(2) = 2.9 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = -1 / +2 Query: 763 CCYAALPAMNSCTRR*EPTRGRARPAGHPSTRGGAPATNTPA 638 C + P+ +C+ R R+RP G S + + TPA Sbjct: 296 CAFRCTPSPATCSGTSASRRARSRPTGGASWPASSCSPTTPA 421 Score = 27.6 bits (54), Expect(2) = 2.9 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -3 / +1 Query: 263 PVRPVDEDELDGGVAPRGPNAGNGTRG 183 PV D+DE GG RG G+G G Sbjct: 901 PVSL*DDDEHAGGEGGRGAGTGDGAEG 981
>LOC_Os11g03110:12011.t00202:unspliced-genomic DELLA protein GAIP-B, putative, expressed| Length = 3605 Score = 28.6 bits (56), Expect(2) = 3.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 / -3 Query: 650 CSRGPSPRRWVSSRAGSSPRRFSAPCA 730 C R P+PR ++ AG P R +A A Sbjct: 1083 CPRSPTPRTGAAASAGGGPPRRAASAA 1003 Score = 28.1 bits (55), Expect(2) = 3.0 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 / -3 Query: 132 PFRRLRHRPPCPGARGGSPRPIPGVRTP 215 P RR R P PG G+ R PG +P Sbjct: 1278 PRRRARGDAPPPGTGWGAARTAPGTSSP 1195
>LOC_Os03g14500:12003.t01239:unspliced-genomic expressed protein| Length = 1888 Score = 32.7 bits (65), Expect(2) = 3.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 / -2 Query: 230 GGVAPRGPNAGNGTRGAAPSPRTWRP 153 G APR G RG AP R WRP Sbjct: 1401 GRRAPRAAAGGRTARGGAPPTRPWRP 1324 Score = 23.1 bits (44), Expect(2) = 3.0 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = -1 / -2 Query: 763 CCYAALPAMNSCTRR*EPTRGRARP 689 CC + P S RR TRG P Sbjct: 1563 CCCRSTPPCTSPRRRRRRTRGTPAP 1489
>LOC_Os12g06630:12012.t00548:unspliced-genomic tubby-like protein, putative, expressed| Length = 5203 Score = 33.6 bits (67), Expect(2) = 3.0 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 / +1 Query: 841 LYETLLSVSSRVIAEW*LAWCACRRAWVRVPPSAPFVLLF 960 +Y L + +IA W + C R W R+PP F+ F Sbjct: 2404 IYSLFLQNTRCIIARWLVGSVPCMRYWDRIPPVPLFLTFF 2523 Score = 23.5 bits (45), Expect(2) = 3.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 / +1 Query: 623 PGELECRCVCSRGPSPRRWVSSRAGSSPRRFS 718 P CR RG SP SS SPR S Sbjct: 118 PATASCRRRHPRGSSPPDPCSSSPSESPRPIS 213
>LOC_Os12g29620:12012.t02671:unspliced-genomic conserved hypothetical protein| Length = 1535 Score = 27.6 bits (54), Expect(3) = 3.0 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -3 / +3 Query: 248 DEDELDGGVAPRGPNAGNGTRGAAPSPR 165 +E + GGV R G G G P PR Sbjct: 252 EEAQAGGGVRRRRGGGGGGAGGVVPGPR 335 Score = 24.4 bits (47), Expect(3) = 3.0 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -1 / +2 Query: 67 AYQGRTREGGNWRR 26 A QGR R G WRR Sbjct: 1256 ALQGRRRAGRRWRR 1297 Score = 22.1 bits (42), Expect(3) = 3.0 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 / +2 Query: 176 PSPRTWRPVPETTERR 129 P RP PETT R+ Sbjct: 824 PQELAQRPAPETTRRQ 871
>LOC_Os07g04970:12007.t00382:unspliced-genomic transferase, putative, expressed| Length = 1562 Score = 27.6 bits (54), Expect(3) = 3.1 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +2 / -2 Query: 653 SRGPSPRRWVSSRAGSSPRRFSAPCA*VHRRQR 751 +R SP R + RA S PRR +P HRR R Sbjct: 616 ARATSPPRSRA*RARSRPRR*GSPRRRCHRRAR 518 Score = 24.0 bits (46), Expect(3) = 3.1 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 / -2 Query: 132 PFRRLRHRPPCPGARGGSPRPIP 200 P R R RPP G+P P P Sbjct: 1075 PPRGPRRRPPTRARAPGAPTPAP 1007 Score = 22.6 bits (43), Expect(3) = 3.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 / -3 Query: 6 VPSLSPQRRQFPPSLVLP 59 VP +P+R + PP V P Sbjct: 1248 VPLAAPRRHRLPPPEVAP 1195
>LOC_Os10g16530:12010.t01218:unspliced-genomic ligA, putative| Length = 1031 Score = 32.2 bits (64), Expect(2) = 3.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 / +1 Query: 79 YFSEAYQGRTREGGNWRRWGD 17 +F + G GG WRRWGD Sbjct: 880 WFGAGFGGGKSGGGEWRRWGD 942 Score = 22.6 bits (43), Expect(2) = 3.2 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = -1 / +2 Query: 706 RGRARPAGHPSTRGGAPATNTP 641 RGR G P+ RGG P Sbjct: 383 RGRRSSGGFPAKRGGGRGPPRP 448
>LOC_Os11g12530:12011.t01140:unspliced-genomic receptor-like protein kinase 5 precursor, putative, expressed| Length = 7272 Score = 27.2 bits (53), Expect(3) = 3.2 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -3 / +2 Query: 671 AGRGPCYKHTCTPTRPAKATPRSCC 597 AG GPC P A A +SCC Sbjct: 6806 AGAGPCSPRGQPPAARACARSKSCC 6880 Score = 26.7 bits (52), Expect(3) = 3.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 / +2 Query: 1262 HIPLPYIHALSHPP 1221 H+P P +HA HPP Sbjct: 6203 HVPPPRLHAGDHPP 6244 Score = 24.4 bits (47), Expect(3) = 3.2 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -1 / +3 Query: 796 QRQRLTGHSRRCCYAALPAMNSCTRR 719 +R+R S CC+++ PA TRR Sbjct: 6495 RRRRTCTASASCCWSSSPAGARSTRR 6572
>LOC_Os03g25869:12003.t02280:unspliced-genomic expressed protein| Length = 7899 Score = 25.8 bits (50), Expect(2) = 3.2 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 / -1 Query: 354 PSSPKVRPRLPPSFLLRGSARIRRGA 431 PS+ + RPR P + RG+ R RGA Sbjct: 7476 PSTRRRRPRTPGTPTARGTWRRARGA 7399 Score = 24.9 bits (48), Expect(2) = 3.2 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +3 / -2 Query: 168 GARGGSPRPIPGVRTPRSDPPVE 236 G RG P P+PG P P + Sbjct: 7580 GNRGVEPEPLPGPAHPHGAVPAD 7512
>LOC_Os03g43880:12003.t03778:unspliced-genomic patatin-like protein, putative, expressed| Length = 1599 Score = 27.2 bits (53), Expect(3) = 3.3 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 / +3 Query: 585 TAALPQRGQPSPGAATTRGGSPSA 514 T + R PSP +TT SPSA Sbjct: 846 TCSTTSRSSPSPPPSTTSSSSPSA 917 Score = 24.4 bits (47), Expect(3) = 3.3 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -3 / +3 Query: 173 SPRTWRPVPETTERRVDGGGAA 108 +PR W P R GGGAA Sbjct: 1197 TPRRWTPRRRRW*RSTSGGGAA 1262 Score = 22.6 bits (43), Expect(3) = 3.3 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 / +3 Query: 778 GHSRRCCYAALPAMNSCTRR 719 G SRRCC P TRR Sbjct: 402 GCSRRCCS*GAPTGGRGTRR 461
>LOC_Os08g30170:12008.t02770:unspliced-genomic conserved hypothetical protein| Length = 414 Score = 28.6 bits (56), Expect(2) = 3.3 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +3 / +2 Query: 111 SASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRT 212 SA+++ P R RPP P SPRP V T Sbjct: 113 SATTLTPSPSPRRRRPPRPS*SSTSPRPTSTVAT 214 Score = 24.9 bits (48), Expect(2) = 3.3 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 / +2 Query: 542 AAPGLGWPRCGRAAVGYPGS 601 A+PG W RC R G S Sbjct: 275 ASPGSSWTRCSRRCGGSTSS 334
>LOC_Os12g05360:12012.t00424:unspliced-genomic PE-PGRS family protein, putative, expressed| Length = 1510 Score = 30.4 bits (60), Expect(2) = 3.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 / -2 Query: 138 RRLRHRPPCPGARGGSPRPIPGVRTPRSDPPVEL 239 RR RPP P G R PG P S P L Sbjct: 1095 RRPARRPPPPAIGGSRARSSPGASPPPSPAPAAL 994 Score = 24.9 bits (48), Expect(2) = 3.3 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 / -3 Query: 641 RCVCSRGPSPRRWVSSRAGSSPRRFSAPCA 730 R C R P R RAGS+PR A A Sbjct: 422 RAPCDRTPRGRTTGWGRAGSAPR*AGAAAA 333
>LOC_Os11g13670:12011.t01201:unspliced-genomic gibberellin receptor GID1L2, putative, expressed| Length = 1541 Score = 32.2 bits (64), Expect(2) = 3.4 Identities = 22/95 (23%), Positives = 31/95 (32%) Frame = -1 / +3 Query: 760 CYAALPAMNSCTRR*EPTRGRARPAGHPSTRGGAPATNTPALQLARQKPXXXXXXXXXXX 581 C + +C RR PT RA + R P+T A ++P Sbjct: 378 CSSTAAGSRTCPRRRAPTTPRADASPGTPARPCCPSTTAARRSTATRRPTTTASPRSASS 557 Query: 580 GSPTARPT*PWRGYHEGREPLCAAHARTLHCRTSR 476 +PT P+ P A+ T TSR Sbjct: 558 TTPTTTPSPPTTATFHHSTSPAASSPGTARAPTSR 662 Score = 23.1 bits (44), Expect(2) = 3.4 Identities = 11/37 (29%), Positives = 15/37 (40%) Frame = -3 / +1 Query: 218 PRGPNAGNGTRGAAPSPRTWRPVPETTERRVDGGGAA 108 P P+ G R P+P P+ R +GG A Sbjct: 913 PGVPSGHGGDRRLRPAPGLAAPLLRDAPREGEGGARA 1023
>LOC_Os07g31500:12007.t02838:unspliced-genomic leucine-rich repeat receptor protein kinase EXS precursor,| putative, expressed Length = 4192 Score = 27.2 bits (53), Expect(2) = 3.4 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = -1 / -1 Query: 799 RQRQRLTGHSRRCCYAALPAMNSCTRR*EPTRGRARPAGHPSTRGG 662 R+R R +RR P C RR P RARPA + R G Sbjct: 547 RRRAR*GWRARRARRGWGPTAPGCRRRGAPGARRARPATAGARRRG 410 Score = 23.5 bits (45), Expect(2) = 3.4 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -2 / -1 Query: 597 PG*PTAALPQRGQPSPGAATT 535 P P A P+RG P P T Sbjct: 313 PAGPAAPAPRRGPPRPARRRT 251
>LOC_Os03g39390:12003.t03375:unspliced-genomic hypothetical protein| Length = 441 Score = 29.0 bits (57), Expect(2) = 3.5 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +3 / +3 Query: 111 SASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTP 215 +A+ + PP RR R RPP R P P G P Sbjct: 63 AAARLRPPPRRRRRRPPPRHGRRRRPPPRGGWHRP 167 Score = 24.4 bits (47), Expect(2) = 3.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 / +2 Query: 351 APSSPKVRPRLPPS 392 APSS RP LPPS Sbjct: 158 APSSTAPRPPLPPS 199
>LOC_Os06g03610:12006.t00253:unspliced-genomic protein kinase, putative, expressed| Length = 3048 Score = 25.4 bits (49), Expect(2) = 3.5 Identities = 16/51 (31%), Positives = 21/51 (41%) Frame = -1 / +2 Query: 772 SRRCCYAALPAMNSCTRR*EPTRGRARPAGHPSTRGGAPATNTPALQLARQ 620 SRR C RR R R+RP S+ A A + PA + R+ Sbjct: 65 SRRPCRGRGGRSPRAARRRRRRRRRSRPRTTSSSTAAARAPSPPAARCTRR 217 Score = 25.4 bits (49), Expect(2) = 3.5 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -2 / +2 Query: 588 PTAALPQRGQPSPGAATTRGGSPSAQRTHA 499 PT P+R PG++ TR + S + A Sbjct: 272 PTPTCPRRSTSPPGSSATRPSTASRSPSRA 361
>LOC_Os01g08140:12001.t00692:unspliced-genomic signal transducer, putative| Length = 1164 Score = 33.1 bits (66), Expect(2) = 3.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 / -2 Query: 215 RGPNAGNGTRGAAPSPRTWR 156 R P G G RGA +PR WR Sbjct: 794 RSPRGGGGARGAGRAPRAWR 735 Score = 21.7 bits (41), Expect(2) = 3.5 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 / -1 Query: 670 RGGAPATNTPALQLARQKP 614 RGG PAL AR++P Sbjct: 1128 RGGGAGGAAPALLPARRRP 1072
>LOC_Os05g06600:12005.t00550:unspliced-genomic hypothetical protein| Length = 2405 Score = 28.1 bits (55), Expect(2) = 3.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 / -2 Query: 147 RHRPPCPGARGGSP 188 RH PPCP R +P Sbjct: 208 RHTPPCPAVRAAAP 167 Score = 22.6 bits (43), Expect(2) = 3.5 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +3 / -3 Query: 189 RPIPGVRTPRSDPP 230 +P+P TPR PP Sbjct: 123 QPLPPATTPRPPPP 82
>LOC_Os06g16310:12006.t01504:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3186 Score = 32.7 bits (65), Expect(2) = 3.6 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 / -3 Query: 730 CTRR*EPTRGRARPAGHPSTRGGAPATNTP 641 C RR P G R AG TRG A TP Sbjct: 1837 CLRRPRPAEGARRSAGRQKTRGRAALKKTP 1748 Score = 23.5 bits (45), Expect(2) = 3.6 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -3 / -3 Query: 176 PSPRTWRPVP 147 P+P +WRP P Sbjct: 571 PAPASWRPAP 542
>LOC_Os12g12740:12012.t01142:unspliced-genomic protein binding protein, putative, expressed| Length = 5346 Score = 33.6 bits (67), Expect = 3.6 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -3 / -3 Query: 227 GVAPRGPNAGNGTRGAAPSPRTWRPVP 147 G APR AG GTRG +PR P P Sbjct: 319 GGAPRARRAGGGTRGGGGAPRAAPPPP 239
>LOC_Os12g06820:12012.t00567:unspliced-genomic neurofilament protein H form H2, putative, expressed| Length = 2235 Score = 33.6 bits (67), Expect = 3.6 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 / -3 Query: 138 RRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 RR R RPP A +PRP P P PP Sbjct: 1369 RRTRCRPPTAAAAAAAPRPRPASPPPPPPPP 1277
>LOC_Os09g29460:12009.t02624:unspliced-genomic homeobox-leucine zipper protein ATHB-6, putative, expressed| Length = 1723 Score = 33.6 bits (67), Expect = 3.6 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -3 / -2 Query: 716 RTDEGKSPPCWTPIYAGRGPCYKHTCTPTRPAKATPRS 603 RT SPP P R + TCTP PA+ +PR+ Sbjct: 1254 RTPPRGSPPPLRPRPRPRRAARRETCTPPEPARPSPRA 1141
>LOC_Os08g20400:12008.t01858:unspliced-genomic adenylate cyclase, putative, expressed| Length = 1100 Score = 33.6 bits (67), Expect = 3.6 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 / +1 Query: 138 RRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 RRL RPP P A P PIP S PP Sbjct: 208 RRLAPRPPSPTASASLPIPIPTPNPSLSSPP 300
>LOC_Os07g11000:12007.t00974:unspliced-genomic expressed protein| Length = 8470 Score = 33.6 bits (67), Expect = 3.6 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +3 / -1 Query: 114 ASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 A++ P RR R P P R G+ P P TPR PP Sbjct: 145 ATTARPRRRRRRRPPARPTPRAGATPPGPPWCTPRPSPP 29
>LOC_Os07g05740:12007.t00457:unspliced-genomic receptor-like protein kinase precursor, putative, expressed| Length = 4699 Score = 33.6 bits (67), Expect = 3.6 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +3 / -1 Query: 138 RRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 RR R RPP P +RG PR TP + PP Sbjct: 475 RRRRCRPPRPSSRGARPRRPAWS*TPSTPPP 383
>LOC_Os07g04950:12007.t00380:unspliced-genomic protein app1, putative, expressed| Length = 804 Score = 33.6 bits (67), Expect = 3.6 Identities = 17/47 (36%), Positives = 20/47 (42%) Frame = -3 / +3 Query: 695 PPCWTPIYAGRGPCYKHTCTPTRPAKATPRSCCRGSLPRLSHSEANL 555 PPC TP PC + C R + PR CR P HS +L Sbjct: 414 PPCRTPCCRRCRPCRR*RCRRCRRCRPCPR*RCRRCHPCRCHSWRHL 554
>LOC_Os07g04930:12007.t00378:unspliced-genomic vegetative cell wall protein gp1 precursor, putative, expressed| Length = 1072 Score = 33.6 bits (67), Expect = 3.6 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -3 / +2 Query: 695 PPCWTPIYAGRGPCYKHTCTPTRPAKATPRSCCRGSLP 582 PPC TP Y PC + C R + PR CR P Sbjct: 683 PPCRTPCYRPFRPCRR*RCRRCRRFRRCPR*RCRRCHP 796
>LOC_Os06g49680:12006.t04652:unspliced-genomic expressed protein| Length = 1204 Score = 33.6 bits (67), Expect = 3.6 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 / +3 Query: 111 SASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPR 218 ++SS +PP R LR RPP P A RP R R Sbjct: 258 ASSSPSPPRRCLRRRPPSPWAAAPPRRPTTPTRRHR 365
>LOC_Os06g24704:12006.t02280:unspliced-genomic acyl-coenzyme A oxidase 2, putative, expressed| Length = 8874 Score = 33.6 bits (67), Expect = 3.6 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 / -2 Query: 141 RLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 R R RPPC A G R PG R+ S PP Sbjct: 2186 RPRRRPPCL*AIHGIRRAAPGTRSASSSPP 2097
>LOC_Os05g05660:12005.t00456:unspliced-genomic PWWP domain containing protein, expressed| Length = 7963 Score = 33.6 bits (67), Expect = 3.6 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -3 / +2 Query: 695 PPCWTPIYAGRGPCYKHTCTPTRPAKATPRSCCRGSLPR 579 PP T G P + +P P+ T SCCRG+L R Sbjct: 5252 PPLSTTSRRGSLPIPRRRRSPAAPSPPTRSSCCRGALHR 5368
>LOC_Os05g03480:12005.t00245:unspliced-genomic isovaleryl-CoA dehydrogenase, mitochondrial precursor, putative,| expressed Length = 10908 Score = 33.6 bits (67), Expect = 3.6 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -3 / -1 Query: 221 APRGPNAGNGTRGAAPSPRTWRPVPETTERRVDGGG 114 A R G G++GA+ +PR WR + +GGG Sbjct: 300 AARARPLGGGSQGASAAPRPWRRLASPRSTTQEGGG 193
>LOC_Os05g01880:12005.t00087:unspliced-genomic hypothetical protein| Length = 648 Score = 33.6 bits (67), Expect = 3.6 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -3 / -1 Query: 218 PRGPNAGNGTRGAAPSPRTWRPVPETTERRVDG 120 PR P+ RG++P PR PVP TT + V G Sbjct: 198 PRPPSCTPMPRGSSPRPRPPPPVPHTTLKLVAG 100
>LOC_Os04g56180:12004.t05090:unspliced-genomic peroxidase 16 precursor, putative, expressed| Length = 6169 Score = 33.6 bits (67), Expect = 3.6 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +3 / +1 Query: 111 SASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 ++S PP PP P + G + RP P R+ S PP Sbjct: 5764 TSSPPTPPPSSTPSSPPWPSSAGSASRPAPTARSAASAPP 5883
>LOC_Os03g62630:12003.t05489:unspliced-genomic structural constituent of ribosome, putative, expressed| Length = 1939 Score = 33.6 bits (67), Expect = 3.6 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +3 / -1 Query: 126 NPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 +PP RR RHRP P R R P R P PP Sbjct: 250 HPPPRRSRHRPQPPPRRRTPRRIRPTPRAPPEPPP 146
>LOC_Os03g10090:12003.t00812:unspliced-genomic polyol transporter protein 4, putative, expressed| Length = 2452 Score = 33.6 bits (67), Expect = 3.6 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = -3 / -2 Query: 716 RTDEGKSPPCWTPIYAGRGPCYKHTCTPTRPAKATPRSCCRGSLPR 579 R+ G +P W P P TCTPTR A R+ R + R Sbjct: 1635 RSSAGSAPSRWPPPAHAAAPGRSPTCTPTRRGPAPRRTTPRTTASR 1498
>LOC_Os02g03470:12002.t00247:unspliced-genomic tetratricopeptide repeat protein KIAA0103, putative, expressed| Length = 3899 Score = 33.6 bits (67), Expect = 3.6 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 / -3 Query: 132 PFRRLRHRPPCPGARGGSPRPIPGVRTPRSDPP 230 P RR R PP P A +PRP P+ PP Sbjct: 201 PTRRRRRAPPAPPAAAAAPRPPRPSPPPQMPPP 103
>LOC_Os01g21070:12001.t01844:unspliced-genomic endoglucanase 1 precursor, putative, expressed| Length = 2799 Score = 33.6 bits (67), Expect = 3.6 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 / +1 Query: 138 RRLRHRPPCPGARGGSPRPIPGVRTPRS 221 RR R PP AR GSPR P TP S Sbjct: 2164 RRWRRTPPGSAARRGSPRSTPASPTPTS 2247 Score = 33.6 bits (67), Expect = 3.6 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -2 / -1 Query: 588 PTAALPQRGQPSPGAATTRGGSPSA 514 P ++ RG P P AATTRGG SA Sbjct: 2205 PASSRSWRGAPPPTAATTRGGGSSA 2131
>LOC_Os01g01190:12001.t00019:unspliced-genomic hydrolase, acting on ester bonds, putative, expressed| Length = 1856 Score = 33.6 bits (67), Expect = 3.6 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +3 / +1 Query: 114 ASSVNPPFRRLRHRPPCPGARGGSPRPIPGVRTPRSDP 227 A++ PP RR R PG+R S R P +R PR P Sbjct: 229 AAAAGPPHRRPHRRRVQPGSRTRSSRLPPPLRLPRRRP 342
>LOC_Os12g41720:12012.t03848:unspliced-genomic patatin-like phospholipase family protein, expressed| Length = 1916 Score = 33.6 bits (67), Expect = 3.6 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -2 / +3 Query: 597 PG*PTAALPQRGQPSPGAATTRGGSPSA 514 P PT++ R PSP A+TT SPSA Sbjct: 858 PPSPTSSTTSRSSPSPPASTTSSSSPSA 941
>LOC_Os10g03110:12010.t00200:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4941 Score = 33.6 bits (67), Expect = 3.6 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +2 / -1 Query: 650 CSRGPSPRRWVSSRAGSSPRRFSAPCA*VHRRQRSVATSARMSRQSLSL 796 C R R WV + + P PCA V +R+ VA + RQ+L L Sbjct: 3882 CRRAWHSRPWVLAGVRTRPCEAGKPCALVPQRKNPVAVARTPPRQALRL 3736
>LOC_Os08g01220:12008.t00022:unspliced-genomic VAMP protein SEC22, putative, expressed| Length = 1567 Score = 33.6 bits (67), Expect = 3.6 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = -2 / +2 Query: 696 PALLDTHLRGEGPLLQTHLHSNSPGKSHAAQLLPG*PTAALPQR 565 PALL HLR P H + H A LLP P LPQR Sbjct: 398 PALLRGHLRHPSPPPPHRPHRLAHPPPHQASLLPQRPHRRLPQR 529
>LOC_Os07g46610:12007.t04297:unspliced-genomic cis-zeatin O-glucosyltransferase, putative, expressed| Length = 1689 Score = 33.6 bits (67), Expect = 3.6 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = +2 / +3 Query: 641 RCVCSRGPSPRRWVSSRAGSSPRRFSA 721 RC R RR V+SR+GSSPRR +A Sbjct: 861 RCCTYRSARRRRSVASRSGSSPRRCAA 941
>LOC_Os05g31914:12005.t02787:unspliced-genomic hypothetical protein| Length = 1725 Score = 33.6 bits (67), Expect = 3.6 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 / +2 Query: 645 HLHSNSPGKSHAAQLLPG*PTAALPQRGQPSP 550 H+ SN+P + +A LP PT LPQ P P Sbjct: 227 HMASNTPDRRPSASRLPVLPTTRLPQHQSPWP 322
>LOC_Os04g31710:12004.t02852:unspliced-genomic expressed protein| Length = 1186 Score = 33.6 bits (67), Expect = 3.6 Identities = 18/51 (35%), Positives = 23/51 (45%) Frame = +2 / +2 Query: 572 GRAAVGYPGSSCAAWLLPGELECRCVCSRGPSPRRWVSSRAGSSPRRFSAP 724 GR+A SS ++W P R S PSP SS + +SP S P Sbjct: 197 GRSASSSSSSSPSSWSSPPPASSRSSTSPSPSPPPSTSSSSPASPSPLSTP 349
>LOC_Os03g03890:12003.t00270:unspliced-genomic serine/threonine-protein kinase Cx32, chloroplast precursor,| putative, expressed Length = 2864 Score = 33.6 bits (67), Expect = 3.6 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = +2 / +2 Query: 656 RGPSPRRWVSSRAGSSPRRFSAPCA*VHRRQRSVATSARMSRQS 787 RG S RRW S+RAGS P + R R+ S+ SR S Sbjct: 203 RGGSSRRWCSARAGSGRCTRGGPTSARSTRPRAPPASSSPSRSS 334
>LOC_Os06g15680:12006.t01441:unspliced-genomic cytochrome P450 71A6, putative| Length = 1707 Score = 26.3 bits (51), Expect(3) = 3.6 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -1 / +2 Query: 571 TARPT*PWRGYHEGREPLCAAHARTLHCRTSRCYCILLSR 452 ++ P PWR G C+A R+ R +RC SR Sbjct: 263 SSSPRRPWRRPCSGTRTTCSAAGRSSTRRGARCTAAGTSR 382 Score = 24.0 bits (46), Expect(3) = 3.6 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -1 / +1 Query: 706 RGRARPAGHPSTRGGAPATNTPAL 635 R R G RGGA T+ PAL Sbjct: 76 RSYLRSGGADGGRGGAAITSPPAL 147 Score = 24.0 bits (46), Expect(3) = 3.6 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 / +3 Query: 245 EDELDGGVAPRGPNAGNGTRGAAPSPRTWR 156 EDE DGG A RG G A P R R Sbjct: 738 EDEEDGGQARRGSRDGAP*PRAEPRGRRRR 827
>LOC_Os05g05680:12005.t00458:unspliced-genomic 1-aminocyclopropane-1-carboxylate oxidase, putative, expressed| Length = 1670 Score = 29.9 bits (59), Expect(2) = 3.6 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 / -3 Query: 362 PQGEAAPSPFLPPPRIGSDPT 424 P AP+P PPP +GS P+ Sbjct: 621 PASSPAPTP*TPPPGVGSSPS 559 Score = 25.4 bits (49), Expect(2) = 3.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 / -2 Query: 907 CRRAWVRVPPSAPFVLL 957 CRRAW P PF L+ Sbjct: 163 CRRAWRSRSPEQPFCLV 113
>LOC_Os11g15570:12011.t01386:unspliced-genomic expressed protein| Length = 1509 Score = 27.2 bits (53), Expect(2) = 3.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -1 / -3 Query: 67 AYQGRTREGGNWRRWGDREGT 5 A +GRTR RWG R GT Sbjct: 793 ARRGRTRSRRRRARWGGRRGT 731 Score = 23.5 bits (45), Expect(2) = 3.7 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -3 / -3 Query: 188 RGAAPSPRTWRP 153 R P+PR WRP Sbjct: 901 RAQTPAPRHWRP 866
>LOC_Os05g23190:12005.t01977:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3321 Score = 32.7 bits (65), Expect(2) = 3.7 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 / -3 Query: 730 CTRR*EPTRGRARPAGHPSTRGGAPATNTP 641 C RR P G R AG TRG A TP Sbjct: 1972 CLRRPRPAEGARRSAGRQKTRGRAALKKTP 1883 Score = 23.5 bits (45), Expect(2) = 3.7 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -3 / -3 Query: 176 PSPRTWRPVP 147 P+P +WRP P Sbjct: 571 PAPASWRPAP 542
>LOC_Os02g57530:12002.t05324:unspliced-genomic ethylene receptor, putative, expressed| Length = 4651 Score = 33.1 bits (66), Expect(2) = 3.7 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 / +2 Query: 1337 PHQLHLQAPCTNAYLPTHQQHELQDHIPLPYIHALSHP 1224 PH+LHL+A + P H L LP+ H +HP Sbjct: 1265 PHRLHLRAAPVHGGAPPHHGQVLDGARLLPHRHHAAHP 1378 Score = 23.5 bits (45), Expect(2) = 3.7 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -2 / +1 Query: 555 SPGAATTRGGSPS 517 SPGA+ T GGS S Sbjct: 2326 SPGASATSGGSAS 2364
>LOC_Os03g44780:12003.t03863:unspliced-genomic GTP binding protein, putative, expressed| Length = 3357 Score = 27.6 bits (54), Expect(3) = 3.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 / +3 Query: 129 PPFRRLRHRPPCPGARGGSP 188 PP R LR RP P ARG P Sbjct: 222 PPRRLLRGRPRPPEARGAPP 281 Score = 25.4 bits (49), Expect(3) = 3.7 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = +1 / +2 Query: 1261 WSCSSCCWCVGK 1296 WSC++C C+G+ Sbjct: 1571 WSCNTCMRCLGR 1606 Score = 23.1 bits (44), Expect(3) = 3.7 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 / +2 Query: 351 APSSPKVRPRLPPSFLLRGSARIR 422 +PSSP R LPP L R ++ R Sbjct: 662 SPSSPPSRTNLPPPPLPRRTSSPR 733
>LOC_Os12g06410:12012.t00526:unspliced-genomic ubiquitin-protein ligase, putative, expressed| Length = 1314 Score = 26.7 bits (52), Expect(2) = 3.7 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 / -3 Query: 147 RHRPPCPGARGGSPRPIPGVRTPRSDPP 230 RH P ARGG+ R P R PP Sbjct: 472 RHTTPPNAARGGARRRPPCASARRRSPP 389 Score = 24.0 bits (46), Expect(2) = 3.7 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +3 / -3 Query: 342 PFGAPSSPKVRPRLPPSFLLRGSARIRR 425 P +P+SP+ R R PP ++ RR Sbjct: 322 PSPSPASPRRRRRQPPEAAAATASNARR 239 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 547,097,562 Number of extensions: 9906550 Number of successful extensions: 101095 Number of sequences better than 10.0: 516 Length of query: 496 Length of database: 55,613,886 Length adjustment: 51 Effective length of query: 445 Effective length of database: 52,743,708 Effective search space: 23470950060 Effective search space used: 23470950060 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
