ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf19i14 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os10g39870:12010.t03230:unspliced-genomic ATG1, putative, expressed| Length = 1164 Score = 36.8 bits (74), Expect = 0.20 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 / -2 Query: 142 RHPLPVDALDHRCSCRTPPTISGDCCSRTPDTPDHLCQCRR 264 + P P L+ + R PP + CC+R P P C RR Sbjct: 887 KQPRPSPTLERQRRRRRPPPRASSCCARAPRRPPWACTSRR 765
>LOC_Os01g52420:12001.t04669:unspliced-genomic conserved hypothetical protein| Length = 231 Score = 35.9 bits (72), Expect = 0.37 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 / +3 Query: 154 PVDALDHRCSCRTPPTISGDCCSRTPDTPDHLCQC 258 P AL RC C P C R P P HL QC Sbjct: 63 PSQALG*RCQCPVPHGTP*PLCPRAPPPPAHLLQC 167
>LOC_Os01g03170:12001.t00209:unspliced-genomic seven in absentia protein family protein, expressed| Length = 3729 Score = 30.9 bits (61), Expect(2) = 0.42 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +1 / -3 Query: 148 PLPVDALDHRCSCRTPPTISGDCCSRTPDTPDHLCQC 258 P P R C +P T S CC R P C C Sbjct: 3583 PCPPPGTRRRGRCSSPSTSSWPCCRRC*APPPTTCTC 3473 Score = 22.1 bits (42), Expect(2) = 0.42 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 / -1 Query: 124 ALDHLRRHP 150 A+ HLRRHP Sbjct: 3621 AVQHLRRHP 3595
>LOC_Os02g56250:12002.t05198:unspliced-genomic GATA zinc finger family protein, expressed| Length = 5317 Score = 35.4 bits (71), Expect = 0.52 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 / +3 Query: 295 VISPRVCHPGRCRARHPGCRSLQLV 369 V+ RV PG RARHPG R+ Q V Sbjct: 3780 VVRARVAAPGAARARHPGARAQQTV 3854
>LOC_Os02g53130:12002.t04892:unspliced-genomic nitrate reductase, putative, expressed| Length = 3417 Score = 35.4 bits (71), Expect = 0.52 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 / -2 Query: 274 WASNGDTDTGGRGCPASGCSSHQRWS 197 W + +TGGRGC +G SS RW+ Sbjct: 1076 WRARRRRETGGRGCRGNGSSSPTRWT 999
>LOC_Os10g01660:12010.t00063:unspliced-genomic hypersensitivity-related gene, putative, expressed| Length = 2637 Score = 29.0 bits (57), Expect(2) = 0.57 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +1 / -1 Query: 175 RCSCRTPPTISGDCCSRTPDTPDHLCQCRRWTPKSIFAVAVISPRVCHPGRCR 333 R CRTP +G C TP R P A +S C P CR Sbjct: 2130 RTPCRTPAPGTGRRCGAGAATPGRRRWTSRAPPSCRPASPRVSAPPCEPAWCR 1972 Score = 23.5 bits (45), Expect(2) = 0.57 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 / -1 Query: 322 GRCRARHPGC 351 GRCR+ PGC Sbjct: 1932 GRCRSTPPGC 1903
>LOC_Os06g02170:12006.t00111:unspliced-genomic heat shock protein binding protein, putative, expressed| Length = 1797 Score = 27.2 bits (53), Expect(2) = 0.79 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -1 / -3 Query: 359 RERQPGWRARQR 324 R R+PGWRAR+R Sbjct: 508 RGRRPGWRARRR 473 Score = 24.9 bits (48), Expect(2) = 0.79 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 / -2 Query: 380 FLRPTSWRERQP 345 +LR SWR RQP Sbjct: 572 YLRSNSWRRRQP 537
>LOC_Os12g12934:12012.t01161:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 5219 Score = 34.5 bits (69), Expect = 0.97 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 / +1 Query: 247 GGRGCPASGCSSHQRWSGAFGSCS 176 GGR ++G S RW G++GSCS Sbjct: 2461 GGRRASSTGSPSASRWGGSWGSCS 2532
>LOC_Os05g01820:12005.t00081:unspliced-genomic cytochrome b5, putative, expressed| Length = 2078 Score = 34.5 bits (69), Expect = 0.97 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 178 CSCRTPPTISGDCCSRTPDTPDHLCQC 258 C+ R PP + CC T +P LC C Sbjct: 324 CAWRPPPGYTPSCCRSTSSSPSFLCLC 244
>LOC_Os04g14470:12004.t01266:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1008 Score = 34.5 bits (69), Expect = 0.97 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = +1 / +1 Query: 148 PLPVDALDHRCSCRTPPTISGDCCSRTP 231 PL D L HRCS R PPT + SR P Sbjct: 430 PLHRDPLSHRCSTREPPTRRCNSQSRNP 513
>LOC_Os10g25349:12010.t01956:unspliced-genomic hypothetical protein| Length = 750 Score = 26.7 bits (52), Expect(2) = 1.1 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -2 / -3 Query: 247 GGRGCPASGCSSHQRWSGAFG 185 GGR SG S Q WSG +G Sbjct: 412 GGRARRRSGGSGAQWWSGGYG 350 Score = 24.9 bits (48), Expect(2) = 1.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -1 / -3 Query: 371 PTSWRERQPGW 339 P+SWR QP W Sbjct: 490 PSSWRRAQPQW 458
>LOC_Os03g41080:12003.t03526:unspliced-genomic seed maturation protein PM23, putative, expressed| Length = 5592 Score = 28.6 bits (56), Expect(2) = 1.2 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +1 / +3 Query: 247 LCQCRRWTPKSIFAVAVISPRVCHPGRCRARHPGCRSLQLVGRKNFLLVSFKI 405 +C+C+ W + V V+ + + R+ GC +L + K L+V++ I Sbjct: 1152 ICKCKEWQLNVVSLVDVLCAILVRNHKQRSSRNGCMALIYILVKIVLIVTYII 1310 Score = 28.1 bits (55), Expect(2) = 1.2 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +1 / +2 Query: 139 RRHPLPVDALDHRCSCRTPPTISGDCCSRTPDTP 240 R P P A D R +CR PP + C + P P Sbjct: 101 RLDPHPPHAGDGRPTCRPPPASARRCPTPPPPPP 202
>LOC_Os09g15830:12009.t01371:unspliced-genomic hypothetical protein| Length = 1140 Score = 34.1 bits (68), Expect = 1.3 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +2 / -2 Query: 137 SAATLYRWTPSIIAAAAERPR 199 S T Y WTPS +AA A RPR Sbjct: 530 SVMTRYPWTPSALAAGASRPR 468
>LOC_Os07g07230:12007.t00601:unspliced-genomic ATP binding protein, putative, expressed| Length = 5223 Score = 34.1 bits (68), Expect = 1.3 Identities = 19/63 (30%), Positives = 23/63 (36%) Frame = +1 / +3 Query: 148 PLPVDALDHRCSCRTPPTISGDCCSRTPDTPDHLCQCRRWTPKSIFAVAVISPRVCHPGR 327 P A R S R + SG C T + +C R P S A + C P Sbjct: 1572 PATGSATASRRSSRRSTSSSGSTCPGTGSSARSCRRCSRCRPSSTSASPATASPACSPAT 1751 Query: 328 CRA 336 CRA Sbjct: 1752 CRA 1760
>LOC_Os02g39560:12002.t03594:unspliced-genomic non-receptor tyrosine kinase spore lysis A, putative, expressed| Length = 5208 Score = 34.1 bits (68), Expect = 1.3 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -1 / +1 Query: 620 LTSFCFIIYSRLTSIAAKSFSLHCLNHGTTSINKLDLVWRVPA 492 L+++CF+++ S A + HC + ++N L WR PA Sbjct: 2140 LSTWCFLLFFFYFSCCASNSKFHCYINSEMNLNTSLLYWRRPA 2268
>LOC_Os07g36544:12007.t03324:unspliced-genomic serine/threonine-protein kinase receptor precursor, putative,| expressed Length = 4971 Score = 33.6 bits (67), Expect = 1.8 Identities = 20/60 (33%), Positives = 23/60 (38%) Frame = +1 / +2 Query: 175 RCSCRTPPTISGDCCSRTPDTPDHLCQCRRWTPKSIFAVAVISPRVCHPGRCRARHPGCR 354 R SC T SG C R P +CR + S A + P RC A PG R Sbjct: 1019 RGSC*TSRARSGTCGCRRPAGGASTGRCRGTSATSTRTAAPTASATSAPRRCAAARPGSR 1198
>LOC_Os05g28129:12005.t02463:unspliced-genomic conserved hypothetical protein| Length = 1218 Score = 33.1 bits (66), Expect = 2.5 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -1 / +2 Query: 419 AQVNGILKETSKKFLRPTSWRERQPGWRARQRPG*HTRGEMTA 291 A+ GIL + RP+SWR R+P R G +RG A Sbjct: 137 ARGRGILPRITAAATRPSSWRRRRPRTRRESGRGAPSRGRACA 265
>LOC_Os05g27749:12005.t02426:unspliced-genomic conserved hypothetical protein| Length = 1218 Score = 33.1 bits (66), Expect = 2.5 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -1 / +2 Query: 419 AQVNGILKETSKKFLRPTSWRERQPGWRARQRPG*HTRGEMTA 291 A+ GIL + RP+SWR R+P R G +RG A Sbjct: 137 ARGRGILPRITAAATRPSSWRRRRPRTRRESGRGAPSRGRACA 265
>LOC_Os03g35620:12003.t03047:unspliced-genomic conserved hypothetical protein| Length = 1943 Score = 33.1 bits (66), Expect = 2.5 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 / +3 Query: 253 QCRRWTPKSIFAVAVISPRVCHPGRCRARHPGCR 354 Q +RW P + A A + R+ PGR R P CR Sbjct: 924 QDQRWRPVVVIAAAFPALRLFSPGRGRRAGPACR 1025
>LOC_Os12g30980:12012.t02804:unspliced-genomic hypothetical protein| Length = 4770 Score = 29.5 bits (58), Expect(2) = 2.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 / -3 Query: 316 HPGRCRARHPGCRSLQLVGRKN 381 H R R+RH GCR + GR+N Sbjct: 1672 HDERRRSRHAGCR*TRRTGRRN 1607 Score = 25.8 bits (50), Expect(2) = 2.6 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +3 / -2 Query: 27 PDYHHGLAPVDLSASRCPRGPEAPNLPDHL 116 P HH + L+ C G + NLP H+ Sbjct: 3527 PTLHHTVTSTHLTPKTCYLGLGSNNLPRHM 3438
>LOC_Os04g10600:12004.t00891:unspliced-genomic conserved hypothetical protein| Length = 558 Score = 25.8 bits (50), Expect(2) = 2.8 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -1 / +3 Query: 374 RPTSWRERQPGWR 336 RP WR Q GWR Sbjct: 99 RPALWRGNQSGWR 137 Score = 24.4 bits (47), Expect(2) = 2.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 / +3 Query: 353 RQPGWRARQRPG*HTRGEMTATAKILLGVQRRH*HRWSGVSG 228 RQ GWR R G G T A RRH G G Sbjct: 216 RQRGWRRRAEEGGGDVGRCTGEAAQAARGGRRHGREKEGRRG 341
>LOC_Os09g38660:12009.t03334:unspliced-genomic expressed protein| Length = 2495 Score = 26.3 bits (51), Expect(2) = 3.4 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 / -2 Query: 277 SWASNGDTDTGGRGCPASGCSSHQR 203 +W + TG GC A GC++ R Sbjct: 133 AWGQPAEGTTGCPGCTAPGCAAATR 59 Score = 23.5 bits (45), Expect(2) = 3.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 / -2 Query: 374 RPTSWRERQPGWRARQRPG 318 R + WR GW+AR+ PG Sbjct: 253 RWSCWRGG*RGWQARRWPG 197
>LOC_Os12g44030:12012.t04069:unspliced-genomic purple acid phosphatase precursor, putative, expressed| Length = 1320 Score = 32.7 bits (65), Expect = 3.5 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 / +1 Query: 739 KRVENGLMLPL*LLFNSYYHVCSLQ 813 + E+ L+LPL + N Y H+CSLQ Sbjct: 1237 RSTEHCLLLPLKIYLNIYIHICSLQ 1311
>LOC_Os08g07200:12008.t00609:unspliced-genomic cytokinin-O-glucosyltransferase 2, putative| Length = 2160 Score = 32.7 bits (65), Expect = 3.5 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 / +1 Query: 133 HLRRHPLPVDALDHRCSCRTPPTISG 210 HLRR PLP+ + RC+ R P ++G Sbjct: 430 HLRRLPLPLSGIHCRCTRRRMPELNG 507
>LOC_Os03g21300:12003.t01885:unspliced-genomic hypothetical protein| Length = 2958 Score = 32.7 bits (65), Expect = 3.5 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -1 / +2 Query: 401 LKETSKKFLRPTSWRERQPGWRARQRPG 318 L + + LR WR R+P WR + PG Sbjct: 761 LSHRAGELLRQGQWRRRRPKWRGNELPG 844
>LOC_Os03g08790:12003.t00734:unspliced-genomic aspartic proteinase nepenthesin-1 precursor, putative, expressed| Length = 1752 Score = 31.8 bits (63), Expect(2) = 3.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -1 / -1 Query: 368 TSWRERQPGWRARQRPG 318 T WR R+ WR R+RPG Sbjct: 1365 TPWRSRRGSWRRRRRPG 1315 Score = 21.7 bits (41), Expect(2) = 3.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 / -1 Query: 250 TGGRGCPASGC 218 +G R CPAS C Sbjct: 636 SGWRPCPASAC 604
>LOC_Os03g10970:12003.t00898:unspliced-genomic hypothetical protein| Length = 2052 Score = 26.3 bits (51), Expect(2) = 4.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 / +1 Query: 235 TPDHLCQCRRWTPKS 279 TP H QCRR TP S Sbjct: 202 TPHHSDQCRRRTPSS 246 Score = 23.1 bits (44), Expect(2) = 4.6 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 / +1 Query: 121 AALDHLRRHPLPVDALDHRCSCRTP 195 AAL RHP P++ + RTP Sbjct: 133 AALSRSPRHPSPLEPIPPPVHRRTP 207
>LOC_Os10g40210:12010.t03265:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2448 Score = 32.2 bits (64), Expect = 4.8 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -1 / -3 Query: 362 WRERQPGWRARQRPG*HTRGEMTATAKILLGVQRR 258 WR R+ WR R R G R A + +LG++RR Sbjct: 139 WRGRRSTWRGRTRRGNRQRRRSRAGGEGVLGLRRR 35
>LOC_Os10g35180:12010.t02813:unspliced-genomic ATP-binding cassette sub-family G member 2, putative, expressed| Length = 6155 Score = 32.2 bits (64), Expect = 4.8 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 / -1 Query: 32 LSPWPSPCRSVRL 70 LS WPSPCRS+RL Sbjct: 3005 LSEWPSPCRSLRL 2967
>LOC_Os09g08254:12009.t00620:unspliced-genomic hypothetical protein| Length = 2368 Score = 32.2 bits (64), Expect = 4.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 / -1 Query: 163 ALDHRCSCRTPPTISGDCCSRTPDTPDHLCQCRR 264 A RCS PP C R P P C CRR Sbjct: 781 AAHRRCSSPLPPPCRRSHCCRLPPRPCCCCCCRR 680
>LOC_Os08g06620:12008.t00552:unspliced-genomic delta DNA polymerase, putative, expressed| Length = 748 Score = 32.2 bits (64), Expect = 4.8 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -2 / -3 Query: 295 RQQQRYSWASNGDTDTGGRGCPASGCSSHQRWS 197 R QR+ W+S T G G S + QRW+ Sbjct: 527 RPSQRHGWSSEQTAMTAGGGARPSAAARRQRWA 429
>LOC_Os07g11970:12007.t01069:unspliced-genomic cytochrome P450 71D7, putative, expressed| Length = 2837 Score = 32.2 bits (64), Expect = 4.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -2 / +2 Query: 241 RGCPASGCSSHQRWSGAFGSC 179 RGC SG S+ +RW G+ +C Sbjct: 437 RGCARSGASARRRWRGSCATC 499
>LOC_Os06g39780:12006.t03675:unspliced-genomic cytochrome P450 76C1, putative, expressed| Length = 1742 Score = 32.2 bits (64), Expect = 4.8 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -2 / +1 Query: 283 RYSWASNGDTDTGGRGCPASGCSSHQRWSGA 191 R W S G T + R P GC+ RW A Sbjct: 1318 RRCWTSGGRTPSSCRSAPGGGCAPGCRWRSA 1410
>LOC_Os06g38294:12006.t03524:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 9472 Score = 32.2 bits (64), Expect = 4.8 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 / -3 Query: 241 RGCPASGCSSHQRWSGAFGSC 179 RGCP+S + +RW+ A GSC Sbjct: 8570 RGCPSSPPAPRRRWTAAPGSC 8508
>LOC_Os04g04999:12004.t00383:unspliced-genomic hypothetical protein| Length = 537 Score = 32.2 bits (64), Expect = 4.8 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -3 / -3 Query: 351 ATGMACSTASGMTYSRRNDGNS 286 A +A S+ASGM+ SRRNDG S Sbjct: 319 AAPVASSSASGMSPSRRNDGKS 254 Score = 32.2 bits (64), Expect = 4.8 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = +2 / +3 Query: 281 SLLLPSFRLEYVIPDAVEHAIPVAVLSNLLDVRISC 388 S L PSFR + IPDA + A A S LL V C Sbjct: 249 SQLFPSFRRDGDIPDADDEATGAAARSRLLPVADRC 356
>LOC_Os02g13820:12002.t01178:unspliced-genomic hypothetical protein| Length = 282 Score = 32.2 bits (64), Expect = 4.8 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 / -3 Query: 154 PVDALDHRCSCRTPPTISGDCCSRTPDTPDHLCQC 258 P +HRC C CCSRT T H C Sbjct: 160 PYSCSEHRCPCLCSKEEGWSCCSRTGCTALHRHHC 56
>LOC_Os08g21530:12008.t01947:unspliced-genomic hypothetical protein| Length = 432 Score = 26.3 bits (51), Expect(2) = 5.2 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 / +3 Query: 353 RQPGWRARQRPG*HTRGEMTATAK 282 R GW+A+Q G RGE+ T K Sbjct: 15 RSSGWQAKQ**GRDRRGEVATTEK 86 Score = 23.1 bits (44), Expect(2) = 5.2 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = -2 / +2 Query: 247 GGRGCPASGCSSHQRW 200 GGRG P C RW Sbjct: 128 GGRGRPRGCCDGGGRW 175
>LOC_Os08g09340:12008.t00819:unspliced-genomic bromodomain containing protein, expressed| Length = 2119 Score = 29.0 bits (57), Expect(2) = 5.6 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 / -3 Query: 406 PFTCAIPRPS*ISCYAPA 459 P TCA PR S SC+AP+ Sbjct: 1040 PSTCAFPRRSSPSCWAPS 987 Score = 24.0 bits (46), Expect(2) = 5.6 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 / -1 Query: 39 HGLAPVDLSASRCPRGPEAPN 101 H ++ L RC GP++PN Sbjct: 1885 HPISYTTLLKIRCQNGPQSPN 1823
>LOC_Os03g06220:12003.t00491:unspliced-genomic ATP-dependent RNA helicase DBP5, putative, expressed| Length = 4802 Score = 26.3 bits (51), Expect(2) = 5.8 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 / +1 Query: 100 ISRTIFVAALDHLRRHPLPVDALDHR 177 I + + V LD LRR PL DHR Sbjct: 4561 IEKKLQVVVLDDLRRPPLLAGVDDHR 4638 Score = 22.6 bits (43), Expect(2) = 5.8 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 / +3 Query: 175 RCSCRTPPTISGDC 216 R SC +PP +G C Sbjct: 4683 RTSCTSPPGCTGTC 4724
>LOC_Os03g06230:12003.t00492:unspliced-genomic expressed protein| Length = 3928 Score = 26.3 bits (51), Expect(2) = 5.9 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 / -3 Query: 100 ISRTIFVAALDHLRRHPLPVDALDHR 177 I + + V LD LRR PL DHR Sbjct: 3233 IEKKLQVVVLDDLRRPPLLAGVDDHR 3156 Score = 22.6 bits (43), Expect(2) = 5.9 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 / -2 Query: 175 RCSCRTPPTISGDC 216 R SC +PP +G C Sbjct: 3111 RTSCTSPPGCTGTC 3070
>LOC_Os01g12890:12001.t01155:unspliced-genomic expressed protein| Length = 6606 Score = 28.1 bits (55), Expect(2) = 6.2 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 / +2 Query: 241 DHLCQCRRWTPKSIFAVAVISPRVC 315 +H C C W PKS+ +IS C Sbjct: 2903 EHFCAC*CWFPKSVS*HTIISREEC 2977 Score = 26.3 bits (51), Expect(2) = 6.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 / +2 Query: 5 GSHGSIPARLSPWPSP 52 G H PARL P PSP Sbjct: 119 GIHRGAPARLRPLPSP 166
>LOC_Os02g48640:12002.t04448:unspliced-genomic expressed protein| Length = 3506 Score = 28.1 bits (55), Expect(2) = 6.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -2 / -1 Query: 271 ASNGDTDTGGRGCPASGCSSHQRWSGAFG 185 A G GRGCP CS +R +G Sbjct: 2144 ARRGSRRWRGRGCPRRSCSGRRRGRAPWG 2058 Score = 25.4 bits (49), Expect(2) = 6.5 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 / -1 Query: 69 RRTDRQGLGHGDNLAGIDPCDP 4 RR+ R+ LGHG + A C P Sbjct: 500 RRSRRRSLGHGSSGARTGGCGP 435
>LOC_Os08g07010:12008.t00590:unspliced-genomic ABC-2 type transporter family protein, expressed| Length = 5116 Score = 31.8 bits (63), Expect = 6.5 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -3 / -2 Query: 621 ADIFLLHHLLEVNINCRKKLQSSLSQPRHDIH 526 AD+ L+HHLLE++ +KK +S P +H Sbjct: 855 ADLHLVHHLLELHQLSQKKKHGHVSSPTSLMH 760
>LOC_Os07g47400:12007.t04376:unspliced-genomic SRC2, putative, expressed| Length = 1280 Score = 31.8 bits (63), Expect = 6.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 / +2 Query: 277 SWASNGDTDTGGRGCPASGCSSHQRW 200 +W+S+G + G P++GC S RW Sbjct: 869 AWSSSGGSTPGWSAAPSAGCWSAPRW 946
>LOC_Os06g46690:12006.t04355:unspliced-genomic catalytic/ transferase, transferring glycosyl groups, putative,| expressed Length = 4418 Score = 31.8 bits (63), Expect = 6.5 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +1 / +3 Query: 166 LDHRCSCRTPPTISGDCCSRTPDTPDHLCQCRRWTP 273 L R TP RT TP +CRRW+P Sbjct: 3516 LPRRSYAATPSASCATPTCRTASTPPRTSRCRRWSP 3623
>LOC_Os06g01490:12006.t00047:unspliced-genomic monocopper oxidase precursor, putative, expressed| Length = 4653 Score = 31.8 bits (63), Expect = 6.5 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -3 / -1 Query: 546 QPRHDIHQ*VRSGLACSC*KLRFNR 472 QP+ IH+ RSGL+C C +++F R Sbjct: 3297 QPKMHIHRYGRSGLSCHCSEIQFPR 3223
>LOC_Os04g06160:12004.t00495:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1172 Score = 31.8 bits (63), Expect = 6.5 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 / +1 Query: 373 RKNFLLVSFKIPFTCAIPRP 432 R FL + ++PFTC +PRP Sbjct: 880 RPQFLQLQLQLPFTCQLPRP 939
>LOC_Os03g61750:12003.t05405:unspliced-genomic expressed protein| Length = 3182 Score = 31.8 bits (63), Expect = 6.5 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -1 / -1 Query: 611 FCFIIYSRLTSIAAKSFSLHCLNHGTTSINKLDLVWRVPAR 489 F I+ LTS+ ++ LH N G + L LVW +PA+ Sbjct: 995 FHTILLRHLTSLLQQTKCLHIANDGCLLRDMLFLVWHLPAQ 873
>LOC_Os01g66100:12001.t05971:unspliced-genomic gibberellin 20 oxidase 2, putative, expressed| Length = 3123 Score = 31.8 bits (63), Expect = 6.5 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 / -3 Query: 229 PDTPDHLCQCRRWTPKSIFAVAVIS 303 P P CQ RRW+P ++ AV++ Sbjct: 178 PPPPGRQCQSRRWSPWAVVGAAVVA 104
>LOC_Os01g14310:12001.t01289:unspliced-genomic hypothetical protein| Length = 2484 Score = 31.8 bits (63), Expect = 6.5 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 / +2 Query: 256 TDTGGRGCPASGCSSHQRWSGAFGSC 179 T + RGC AS C+ + WSG+ C Sbjct: 998 TSSCARGCSASTCTRARSWSGSSSRC 1075
>LOC_Os04g58370:12004.t05300:unspliced-genomic hypothetical protein| Length = 534 Score = 25.4 bits (49), Expect(2) = 6.9 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 / -3 Query: 362 WRERQPGWRARQRP 321 WR R PG AR+RP Sbjct: 229 WRRRCPGGGARRRP 188 Score = 23.5 bits (45), Expect(2) = 6.9 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -2 / -3 Query: 247 GGRGCPASGCSSHQRWSG 194 G R P GC +RW G Sbjct: 205 GARRRPRCGCRRRRRWFG 152
>LOC_Os03g03540:12003.t00236:unspliced-genomic ANAC037, putative, expressed| Length = 2648 Score = 25.4 bits (49), Expect(2) = 8.2 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 / -3 Query: 228 AGHPRPPVSVSPLDAQEYLCCC 293 A PRPPV + L A E CC Sbjct: 2298 AEQPRPPVDLVSLVAVEKQQCC 2233 Score = 23.1 bits (44), Expect(2) = 8.2 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +1 / -1 Query: 154 PVDALDHRCSCRTPPTISGDCCSRTPDTP 240 PVD ++ C P +S R+P TP Sbjct: 2402 PVDVMNTSCCECFVPHLSNTQIPRSPSTP 2316
>LOC_Os02g36070:12002.t03244:unspliced-genomic cytochrome P450 76C4, putative, expressed| Length = 1809 Score = 29.9 bits (59), Expect(2) = 8.8 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -2 / +2 Query: 283 RYSWASNGDTDTGGRGCPASGCSSHQRW 200 R SW S G T + R P GC+ RW Sbjct: 1361 RRSWTSEGRTWSSCRSGPGGGCALGCRW 1444 Score = 22.1 bits (42), Expect(2) = 8.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 / +2 Query: 506 WRVPARS*DSTGSWNHAGA 450 W ARS S+G+W+ + A Sbjct: 248 WSAAARSTTSSGTWHASTA 304
>LOC_Os10g42072:12010.t03436:unspliced-genomic hypothetical protein| Length = 840 Score = 25.4 bits (49), Expect(2) = 8.9 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 / +2 Query: 103 SRTIFVAALDHLRRHPLPVDALDHRCSCRTPPTI 204 SR ++ LR P + +R SCRTPP + Sbjct: 389 SRRETTPSIRRLRS*SPPCASPPNRVSCRTPPAV 490 Score = 23.1 bits (44), Expect(2) = 8.9 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +1 / +2 Query: 301 SPRVCHPGRCRARHPGCRSLQLVGRK 378 S RV P RAR CR + R+ Sbjct: 575 SSRVAPPSSLRARRSSCRRCRSTPRR 652
>LOC_Os11g46000:12011.t04125:unspliced-genomic von Willebrand factor type A domain containing protein, expressed| Length = 3870 Score = 31.3 bits (62), Expect = 9.0 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 / +1 Query: 250 TGGRGCPASGCSSHQRW 200 T RGCPA+ CS +RW Sbjct: 2602 TYSRGCPATRCSGRRRW 2652
>LOC_Os11g11660:12011.t01053:unspliced-genomic conserved hypothetical protein| Length = 1926 Score = 31.3 bits (62), Expect = 9.0 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +1 / -3 Query: 229 PDTPDHLCQCRRWTPKSIFAVAVISPRVCHPGRCRAR 339 P P + RR P ++ VAV SPR RCR R Sbjct: 316 PSPPARISPLRRLPPAAVRVVAVTSPRRRRRLRCRRR 206
>LOC_Os08g35210:12008.t03261:unspliced-genomic ferric reductase like transmembrane component family protein,| expressed Length = 9672 Score = 31.3 bits (62), Expect = 9.0 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 / -3 Query: 214 CCSRTPDTPDHLCQCRRWTP 273 C RTP +P L QCRR TP Sbjct: 811 CPRRTPSSPPSLHQCRRRTP 752
>LOC_Os07g06840:12007.t00563:unspliced-genomic gibberellin receptor GID1L2, putative, expressed| Length = 1437 Score = 31.3 bits (62), Expect = 9.0 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 / +2 Query: 175 RCSCRTPPTISGDCCSRTPDTPDHLCQCRRW 267 R SC TPPT S C+ + CR W Sbjct: 236 RTSCTTPPTASASACTGRRRRGERRRSCRWW 328
>LOC_Os06g39680:12006.t03665:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 2779 Score = 31.3 bits (62), Expect = 9.0 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +1 / -2 Query: 136 LRRHPLPVDALDHRCSCRTPPTISGDCCSRTPDTPDHLCQCRRWT 270 L+ H + CS RT P+ C + DHLCQ W+ Sbjct: 2103 LQAHACTILLRKRTCSNRTKPSSRQHCRKQCALLEDHLCQHSTWS 1969
>LOC_Os05g49960:12005.t04429:unspliced-genomic hypothetical protein| Length = 477 Score = 31.3 bits (62), Expect = 9.0 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 / +2 Query: 163 ALDHRCSCRTPPTISGDCCSRTPDTPDHLCQCRR 264 AL R + RTPP+ +G C TP C CRR Sbjct: 122 ALAARGARRTPPSGAGACRPGTPGRRRARCYCRR 223
>LOC_Os03g36460:12003.t03115:unspliced-genomic conserved hypothetical protein| Length = 519 Score = 31.3 bits (62), Expect = 9.0 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 / -1 Query: 133 HLRRHPLPVDALDHRCSCRTPPTISG 210 HL R PLP+ + RC+ R P ++G Sbjct: 459 HLHRRPLPLSGIRCRCARRRMPELNG 382
>LOC_Os02g13310:12002.t01128:unspliced-genomic homeodomain protein JUBEL1, putative, expressed| Length = 3537 Score = 31.3 bits (62), Expect = 9.0 Identities = 16/52 (30%), Positives = 19/52 (36%) Frame = +1 / -1 Query: 148 PLPVDALDHRCSCRTPPTISGDCCSRTPDTPDHLCQCRRWTPKSIFAVAVIS 303 P P R CR+PP S R P CR W P+ +A S Sbjct: 867 PWPDGTAARRRHCRSPP*SSRRSWRRPPHRAARTMDCRSWPPRKSPRIAETS 712
>LOC_Os01g38110:12001.t03349:unspliced-genomic cytochrome P450 76C4, putative, expressed| Length = 1938 Score = 31.3 bits (62), Expect = 9.0 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -2 / +2 Query: 295 RQQQRYSWASNGDTDTGGRGCPASGCSSHQRWSGA 191 R + R W S G T R P GC+ RW A Sbjct: 1430 RGRGRRRWTSAGRRPTSSRSGPGGGCAPGFRWRSA 1534
>LOC_Os01g23330:12001.t02060:unspliced-genomic retrotransposon, putative, centromere-specific| Length = 6502 Score = 31.3 bits (62), Expect = 9.0 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 / -1 Query: 220 SRTPDTPDHLCQCRRWTPKSIFAVAVISPRVCHP 321 S P +P L + R + P+ FAVAV+ R HP Sbjct: 241 SLLPHSPHWLAESRPYRPRLPFAVAVVFLRAGHP 140
>LOC_Os07g03458:12007.t00236:unspliced-genomic pathogenesis-related protein 1 precursor, putative, expressed| Length = 693 Score = 28.6 bits (56), Expect(2) = 9.0 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 / -2 Query: 178 CSCRTPPTISGDCCSRTPDTPDHLCQCRR 264 CS T PT G CC R+ P C R Sbjct: 401 CSGGTSPTTPGSCCCRSRTDPSPPPSC*R 315 Score = 22.1 bits (42), Expect(2) = 9.0 Identities = 5/16 (31%), Positives = 12/16 (75%) Frame = +1 / -2 Query: 259 RRWTPKSIFAVAVISP 306 R+W P+ + ++++SP Sbjct: 59 RQWLPQVLLPISLVSP 12
>LOC_Os01g02520:12001.t00147:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2664 Score = 30.4 bits (60), Expect(2) = 9.2 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +1 / +3 Query: 238 PDHLCQCRRWTPKSIFAVAVISPRVCHPGRCRA 336 P C R P+ IF+ A + CHP CRA Sbjct: 1188 PRAQCVFWRAEPRRIFSKAALLLVFCHPAECRA 1286 Score = 22.1 bits (42), Expect(2) = 9.2 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 / +3 Query: 322 GRCRARHPGCR 354 GRC PGCR Sbjct: 2499 GRCARTGPGCR 2531
>LOC_Os02g49750:12002.t04559:unspliced-genomic conserved hypothetical protein| Length = 420 Score = 25.8 bits (50), Expect(2) = 9.4 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +1 / -2 Query: 319 PGRCRARHPGCRS 357 P CRA PGCRS Sbjct: 83 PASCRACAPGCRS 45 Score = 22.6 bits (43), Expect(2) = 9.4 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +1 / -1 Query: 256 CRRWTPKSIFAVAVISPRVCHPGRCRA 336 CRRW + A A+ + H CRA Sbjct: 213 CRRWPSDRVAAAALRASCPRHCRWCRA 133
>LOC_Os01g26824:12001.t02372:unspliced-genomic hypothetical protein| Length = 1456 Score = 28.6 bits (56), Expect(2) = 9.7 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 / -2 Query: 274 KSIFAVAVISPRVCHPGRCRARHPGCR 354 +S+ VAV PR+ GR R HP CR Sbjct: 240 RSLLGVAVGRPRLRITGRHRRLHPLCR 160 Score = 23.1 bits (44), Expect(2) = 9.7 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 / -1 Query: 222 PDAGHPRPPVSVSPL 266 P GHP PP + +P+ Sbjct: 724 PPVGHP*PPAARAPV 680
>LOC_Os07g03279:12007.t00218:unspliced-genomic pathogenesis-related protein 1 precursor, putative, expressed| Length = 773 Score = 28.6 bits (56), Expect(2) = 9.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 / -3 Query: 178 CSCRTPPTISGDCCSRTPDTPDHLCQCRR 264 CS T PT G CC R+ P C R Sbjct: 468 CSGGTSPTTPGSCCCRSRTDPSPPPSC*R 382 Score = 22.1 bits (42), Expect(2) = 9.9 Identities = 5/16 (31%), Positives = 12/16 (75%) Frame = +1 / -3 Query: 259 RRWTPKSIFAVAVISP 306 R+W P+ + ++++SP Sbjct: 126 RQWLPQVLLPISLVSP 79
>LOC_Os01g03452:12001.t00237:unspliced-genomic hypothetical protein| Length = 8069 Score = 25.4 bits (49), Expect(2) = 10.0 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 / -3 Query: 178 CSCRTPPTISGDCCS 222 C RTP T S CCS Sbjct: 2301 CRTRTPGTCSPGCCS 2257 Score = 22.6 bits (43), Expect(2) = 10.0 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +1 / -3 Query: 157 VDALDHRCSCRT 192 + LDHR +CRT Sbjct: 2328 ITILDHRITCRT 2293 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 319,848,203 Number of extensions: 5150971 Number of successful extensions: 30044 Number of sequences better than 10.0: 70 Length of query: 275 Length of database: 55,613,886 Length adjustment: 49 Effective length of query: 226 Effective length of database: 52,856,264 Effective search space: 11945515664 Effective search space used: 11945515664 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
