ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf19g11 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os06g29210:12006.t02625:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5964 Score = 28.1 bits (55), Expect(3) = 0.39 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 / +2 Query: 319 SRQTNSIGKVKTTTKELQSIQRCHDESEP 233 S+ SI T T+ L+S QRC +EP Sbjct: 5444 SKPRPSISSRSTVTRGLRSCQRCSGRTEP 5530 Score = 24.0 bits (46), Expect(3) = 0.39 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 / +3 Query: 449 LEALQHHIMHPTT 411 L + QHH MHP T Sbjct: 1023 LSSPQHHTMHPRT 1061 Score = 24.0 bits (46), Expect(3) = 0.39 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -2 / +2 Query: 403 TTNITATADVSCHSPPNNYNRHRR*CPVS 317 TTN + SC P + RR CP S Sbjct: 2417 TTNRKTRSSPSCGQTPTSSTGDRRTCPGS 2503
>LOC_Os01g29804:12001.t006868:unspliced-genomic expressed protein| Length = 6780 Score = 34.5 bits (69), Expect = 0.57 Identities = 11/41 (26%), Positives = 17/41 (41%) Frame = +1 / +1 Query: 175 ERSAEGRLKLKPTVNFPRKWARSHHGTVVWIVTPWSLFLPY 297 E A + + FP W + HG + +T W F P+ Sbjct: 2032 ESPAHSSTGTRSEITFPSHWLGAQHGFTFYFITHWGFFSPF 2154
>LOC_Os06g07500:12006.t00633:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3321 Score = 33.6 bits (67), Expect = 1.1 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -3 / +2 Query: 276 RSYNPYNGAMMRASPFTREVHGWFKLKPS 190 R + P G +RA+P T++V GW +KP+ Sbjct: 1772 RPWTPRLGPPLRATPKTKQVRGWPAMKPA 1858
>LOC_Os01g47490:12001.t04197:unspliced-genomic negatively light-regulated protein, putative, expressed| Length = 4121 Score = 33.1 bits (66), Expect = 1.5 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 / +1 Query: 451 EHLVCVECCCSQLIHLLFI*AIFHQKKKK 537 E +C CC LIHLLF * + KKK Sbjct: 430 ESPICAVSCCFLLIHLLFW*CAYISSKKK 516
>LOC_Os02g39920:12002.t03628:unspliced-genomic AT hook motif family protein, expressed| Length = 6953 Score = 26.3 bits (51), Expect(2) = 1.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -2 / -3 Query: 67 DPDPLPTTGALFGFRPGL 14 D P A FGFRPGL Sbjct: 6315 DSSPATAAPATFGFRPGL 6262 Score = 23.5 bits (45), Expect(2) = 1.9 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -3 / -1 Query: 198 KPSFCASF 175 KPSFCASF Sbjct: 6443 KPSFCASF 6420
>LOC_Os06g43540:12006.t04044:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 4384 Score = 32.7 bits (65), Expect = 2.0 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 / +2 Query: 400 SWLYVVGCMM*CCRASREHLVCVEC 474 SWL GC+ R S EHLVC+ C Sbjct: 1022 SWLTSWGCLSPVRRHSGEHLVCMRC 1096
>LOC_Os08g38640:12008.t03599:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4297 Score = 32.2 bits (64), Expect = 2.8 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 / +2 Query: 400 SWLYVVGCMM*CCRASREHLVCVEC 474 SWL GC+ R S EHLVC C Sbjct: 1022 SWLTPWGCLSPVRRHSGEHLVCTRC 1096
>LOC_Os07g34410:12007.t03117:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 4400 Score = 32.2 bits (64), Expect = 2.8 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 / +1 Query: 400 SWLYVVGCMM*CCRASREHLVCVEC 474 SWL GC+ R S EHLVC C Sbjct: 400 SWLTSWGCLSPVRRHSGEHLVCTRC 474
>LOC_Os07g02230:12007.t00114:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 11762 Score = 32.2 bits (64), Expect = 2.8 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 / +3 Query: 464 QTRCSLEALQHHIMHPTT*SHD*HYSYC 381 Q +CS + + H++H TT S+ ++ YC Sbjct: 10065 QGKCSFDGPREHLLHLTTFSYSQYFGYC 10148
>LOC_Os05g36940:12005.t03238:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4308 Score = 32.2 bits (64), Expect = 2.8 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 / +2 Query: 400 SWLYVVGCMM*CCRASREHLVCVEC 474 SWL GC+ R S EHLVC C Sbjct: 1022 SWLTSWGCLSPVRRHSGEHLVCTRC 1096
>LOC_Os09g28370:12009.t02515:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 12702 Score = 25.8 bits (50), Expect(3) = 3.1 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 / -1 Query: 41 SSGG*WIWICS 73 SS G*W+W+CS Sbjct: 10011 SSIG*WLWLCS 9979 Score = 25.8 bits (50), Expect(3) = 3.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 / -2 Query: 442 ASREHLVCVECCCS 483 AS HL+C ECC S Sbjct: 7301 ASFNHLICRECCGS 7260 Score = 23.1 bits (44), Expect(3) = 3.1 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +1 / -2 Query: 223 PRKWARSHHGTVVW 264 PR +++SH+ T VW Sbjct: 7415 PRTFSKSHYRTHVW 7374
>LOC_Os11g42710:12011.t03801:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5359 Score = 31.8 bits (63), Expect = 3.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 / +2 Query: 421 CMM*CCRASREHLVCVECCC 480 C CCR SR H C + CC Sbjct: 1649 CCCCCCRCSRRHRRCSDYCC 1708
>LOC_Os10g24380:12010.t01863:unspliced-genomic retrotransposon, putative, centromere-specific| Length = 2701 Score = 31.8 bits (63), Expect = 3.8 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -3 / -2 Query: 279 PRSYNPYNGAMMRASPFTREVHGWFKLKPSF 187 P S YNG R S F+ ++ WF LK SF Sbjct: 1032 PLSVLGYNGQCCRGSEFSLKILFWFALKNSF 940
>LOC_Os07g31194:12007.t004643:unspliced-genomic expressed protein| Length = 1729 Score = 31.3 bits (62), Expect = 5.3 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 / +3 Query: 472 CCCSQLIHLLFI*AIFHQK 528 CCCS+LI L F A++H K Sbjct: 480 CCCSRLIFL*FCSAVYHTK 536
>LOC_Os06g42850:12006.t03975:unspliced-genomic expressed protein| Length = 2882 Score = 31.3 bits (62), Expect = 5.3 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 / +3 Query: 400 SWLYVVGCMM*CCRASREHLVCVECCCSQLIHLLFI*AI 516 SW+ V G + C R R H+ C C + L+F+* + Sbjct: 2535 SWILVSGVIFGCSR**RAHVCVYACMCIRTYVLMFV*KL 2651
>LOC_Os04g08000:12004.t00675:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 9388 Score = 31.3 bits (62), Expect = 5.3 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 / -3 Query: 439 RASREHLVCVECCCSQLIHLLFI*AIFHQ 525 R R +L+C CCCS + + L ++HQ Sbjct: 8045 RTYRLNLLCFRCCCSPVEYFLCNLPVYHQ 7959
>LOC_Os02g46850:12002.t05461:unspliced-genomic oligopeptide transporter 4, putative, expressed| Length = 2897 Score = 31.3 bits (62), Expect = 5.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 / +3 Query: 232 WARSHHGTVVWIVTPWS 282 W+ HHG W+ PWS Sbjct: 1194 WSERHHGVCHWVDNPWS 1244
>LOC_Os12g42140:12012.t03888:unspliced-genomic tuftelin-interacting protein 11, putative, expressed| Length = 2869 Score = 30.9 bits (61), Expect = 7.2 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -1 / -3 Query: 464 QTRCSLEALQHHIMHPTT*SHD*HYSYC 381 Q S+E QH +MH H HYS C Sbjct: 1877 QIHPSMETTQHRLMHRELAKHGEHYSVC 1794
>LOC_Os10g30740:12010.t02405:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 6051 Score = 30.9 bits (61), Expect = 7.2 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 / -1 Query: 211 TVNFPRKWARSHHGTVVWIVTPW 279 +++FP+ A HHG + TPW Sbjct: 2742 SISFPKSKALLHHGIACCVTTPW 2674
>LOC_Os02g27230:12002.t02417:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5945 Score = 24.4 bits (47), Expect(3) = 8.1 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -2 / +1 Query: 337 RR*CPVSRQTNSIGKVKTTTKELQSIQRCHDESEP 233 R+ S+ S T T+ +S QRC ++EP Sbjct: 5407 RKSSKASKPRPSTSSRSTATRGSRSCQRCSGQTEP 5511 Score = 24.0 bits (46), Expect(3) = 8.1 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 / +3 Query: 449 LEALQHHIMHPTT 411 L + QHH MHP T Sbjct: 1005 LSSPQHHTMHPRT 1043 Score = 22.6 bits (43), Expect(3) = 8.1 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -2 / +2 Query: 403 TTNITATADVSCHSPPNNYNRHRR*CPVS 317 TTN + SC P + RR CP S Sbjct: 2399 TTNRKTRSSPSCGQTPTSSLGDRRTCPGS 2485
>LOC_Os09g24770:12009.t02158:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5316 Score = 25.4 bits (49), Expect(3) = 8.9 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 / +2 Query: 403 TTNITATADVSCHSPPNNYNRHRR*CPVS 317 TTN + SC P + R RR CP S Sbjct: 2078 TTNRKTRSSPSCGQTPMSSPRDRRTCPGS 2164 Score = 23.1 bits (44), Expect(3) = 8.9 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -2 / +2 Query: 319 SRQTNSIGKVKTTTKELQSIQRCHDESEP 233 S+ S T T+ +S QRC +EP Sbjct: 5105 SKPRPSTSSRSTATRGSRSCQRCSGRTEP 5191 Score = 22.1 bits (42), Expect(3) = 8.9 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -1 / +3 Query: 449 LEALQHHIMHPTT 411 L + QHH +HP T Sbjct: 684 LSSPQHHTVHPRT 722
>LOC_Os01g17360:12001.t01580:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5677 Score = 24.0 bits (46), Expect(3) = 9.9 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 / +1 Query: 449 LEALQHHIMHPTT 411 L + QHH MHP T Sbjct: 1021 LSSPQHHTMHPRT 1059 Score = 23.5 bits (45), Expect(3) = 9.9 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -2 / +2 Query: 403 TTNITATADVSCHSPPNNYNRHRR*CPVS 317 TTN + SC P + RR CP S Sbjct: 2414 TTNRKTRSSPSCGQTPTSLPGDRRTCPGS 2500 Score = 23.1 bits (44), Expect(3) = 9.9 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -2 / +3 Query: 319 SRQTNSIGKVKTTTKELQSIQRCHDESEP 233 S+ S T T+ +S QRC +EP Sbjct: 5442 SKPRPSTSSRSTATRGSRSCQRCSGRTEP 5528
>LOC_Os09g08370:12009.t00631:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 7757 Score = 30.4 bits (60), Expect = 9.9 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +1 / +3 Query: 451 EHLVCVECCCSQL 489 EHL VECCC+QL Sbjct: 5298 EHLCYVECCCTQL 5336
>LOC_Os07g08790:12007.t00754:unspliced-genomic seed specific protein Bn15D14A, putative, expressed| Length = 6167 Score = 30.4 bits (60), Expect = 9.9 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 / +2 Query: 421 IPQHKATTNITATADVSCHSPPNNYN 344 +P H + + I TADV+CH+ +N Sbjct: 3812 VPNHHSPSRIVRTADVACHTDMTWHN 3889
>LOC_Os01g60630:12001.t05444:unspliced-genomic hypothetical protein| Length = 769 Score = 30.4 bits (60), Expect = 9.9 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = -2 / +1 Query: 478 NNIRHKLDVPLRLCNI 431 +++RH+ DVPLR CN+ Sbjct: 67 SSLRHRRDVPLRCCNV 114 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 174,301,783 Number of extensions: 2233142 Number of successful extensions: 10956 Number of sequences better than 10.0: 25 Length of query: 180 Length of database: 55,613,886 Length adjustment: 48 Effective length of query: 132 Effective length of database: 52,912,542 Effective search space: 6984455544 Effective search space used: 6984455544 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
