| Clone Name | FLbaf13p23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q8EVM0:Y544_MYCPE UPF0144 protein MYPE5440 - Mycoplasma penetrans | 28 | 7.4 | 2 | P37483:YYCA_BACSU Uncharacterized protein yycA - Bacillus subtilis | 28 | 9.6 | 3 | Q6PQD5:ATM_PIG Serine-protein kinase ATM - Sus scrofa (Pig) | 28 | 9.6 | 4 | P27743:ACVS_NOCLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-v... | 28 | 9.6 |
|---|
>Q8EVM0:Y544_MYCPE UPF0144 protein MYPE5440 - Mycoplasma penetrans| Length = 469 Score = 28.5 bits (62), Expect = 7.4 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = -2 Query: 250 VSLLNKRRSVLVLRVCHHKVVRDDQHEYEDAQEVGEETQ 134 +S++NK+R +L + + +++ Q Y+ QEV E Q Sbjct: 65 ISIINKKREILNHQRADYLKIKETQESYQQLQEVISEYQ 103
>P37483:YYCA_BACSU Uncharacterized protein yycA - Bacillus subtilis| Length = 685 Score = 28.1 bits (61), Expect = 9.6 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -3 Query: 192 WYAMTSTNMKMPRKLVKKPKSWSSNILPAAVRI 94 WY M +L K K WSS +LPAAV I Sbjct: 439 WYTM--------HRLYKNNKDWSSYLLPAAVLI 463
>Q6PQD5:ATM_PIG Serine-protein kinase ATM - Sus scrofa (Pig)| Length = 3057 Score = 28.1 bits (61), Expect = 9.6 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 151 LPGHLHIRAGHRVPLCDGRPEVRELI 228 L HLH+ G +PL DG+ EV++ + Sbjct: 1514 LESHLHVIVGTLIPLVDGQMEVQKQV 1539
>P27743:ACVS_NOCLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase -| Nocardia lactamdurans Length = 3649 Score = 28.1 bits (61), Expect = 9.6 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 148 QLPGHLHIRAGHRVPLCDGRPEVRELISFCLAMRPYYTESK*GNM 282 Q HL + GH L +G P+VR+ + + M P+ E G++ Sbjct: 3243 QATNHLTVE-GHGRELFEGAPDVRDTVGWFTTMHPFAVEVDPGDL 3286 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 57,493,424 Number of extensions: 1128305 Number of successful extensions: 2186 Number of sequences better than 10.0: 4 Number of HSP's gapped: 2186 Number of HSP's successfully gapped: 4 Length of query: 124 Length of database: 100,686,439 Length adjustment: 91 Effective length of query: 33 Effective length of database: 75,725,594 Effective search space: 2498944602 Effective search space used: 2498944602 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)