ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf17a23 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os03g45280:12003.t03905:unspliced-genomic dehydrin 13, putative, expressed| Length = 915 Score = 51.0 bits (105), Expect = 8e-06 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -3 / -3 Query: 118 RPCGASPRSCG*CRPWCCP 62 RPCGASPRSCG*CRPW P Sbjct: 133 RPCGASPRSCG*CRPWLAP 77 Score = 46.0 bits (94), Expect = 3e-04 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 / +3 Query: 63 GQHHGRHHPQDRGEAPH 113 G +HGRHHPQDRGEAPH Sbjct: 78 GANHGRHHPQDRGEAPH 128 Score = 43.7 bits (89), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 / +1 Query: 70 TMAGIIHKIEEKLHMGG 120 TMAGIIHKIEEKLHMGG Sbjct: 85 TMAGIIHKIEEKLHMGG 135 Score = 40.9 bits (83), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 / -2 Query: 113 MWSFSSILWMMPAMV 69 MWSFSSILWMMPAMV Sbjct: 128 MWSFSSILWMMPAMV 84
>LOC_Os10g29514:12010.t02294:unspliced-genomic expressed protein| Length = 5518 Score = 30.9 bits (61), Expect(2) = 0.17 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -2 / -2 Query: 458 PKPSISPALHLHAAGAR 408 P PS+SP+ HL AAGAR Sbjct: 2673 PAPSLSPSPHLAAAGAR 2623 Score = 28.1 bits (55), Expect(2) = 0.17 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 / -2 Query: 124 CCRPCGASPRSCG 86 CCRP G PRS G Sbjct: 1380 CCRPSGVRPRSTG 1342
>LOC_Os05g31530:12005.t02750:unspliced-genomic disease resistance protein RGA4, putative, expressed| Length = 5749 Score = 35.9 bits (72), Expect = 0.29 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 / -2 Query: 587 LNVIITSTVQCSAAQRSPAGYYITRSMRHVAHYIHMLPHA 468 +N+ I+ V C PAG YI R+ H+IH H+ Sbjct: 5658 INISISQFVHCYKEALIPAGSYIRCEQRNAMHFIHFKTHS 5539
>LOC_Os05g40360:12005.t03575:unspliced-genomic hypothetical protein| Length = 883 Score = 35.0 bits (70), Expect = 0.55 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -1 / +1 Query: 570 KHRAVQCSAAQPSRLLHHKIHETCRA 493 +HR C QP RLLHH+ H RA Sbjct: 379 RHRQPPCWRRQPRRLLHHRCHARLRA 456
>LOC_Os11g38610:12011.t03404:unspliced-genomic expressed protein| Length = 8141 Score = 27.6 bits (54), Expect(3) = 0.59 Identities = 12/45 (26%), Positives = 19/45 (42%) Frame = -1 / -1 Query: 567 HRAVQCSAAQPSRLLHHKIHETCRALHTYATTRSKLTQAFHLACT 433 H A++ A P ++ HK+ T + H R +HL T Sbjct: 938 HFALRAQPADPFSIVLHKVQCTSESTHLTLVRRLSTAVCYHLVNT 804 Score = 24.9 bits (48), Expect(3) = 0.59 Identities = 7/21 (33%), Positives = 16/21 (76%) Frame = -3 / -2 Query: 640 RNDDTKLPMEIHQYQHDSSTL 578 + ++T LPM++H+Y+ + T+ Sbjct: 4024 KKNNTWLPMQVHEYEEINLTV 3962 Score = 24.9 bits (48), Expect(3) = 0.59 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -3 / -3 Query: 112 CGASPRSC 89 CGASPRSC Sbjct: 789 CGASPRSC 766
>LOC_Os10g01410:12010.t00037:unspliced-genomic OsWAK94 - OsWAK receptor-like protein (OsWAK-RLP)| Length = 2099 Score = 27.2 bits (53), Expect(2) = 0.62 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -3 / -2 Query: 127 RCCRPCGASPRSCG*CRPWCC 65 RC R C R G RP CC Sbjct: 499 RCSRRCSRCSRGTGIGRPHCC 437 Score = 24.9 bits (48), Expect(2) = 0.62 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -3 / -2 Query: 82 CRPWCCPYFSPRKMANSR 29 C PWCC P A+ R Sbjct: 427 CTPWCCSRGRPACSAHRR 374
>LOC_Os11g13520:12011.t01187:unspliced-genomic hypothetical protein| Length = 3018 Score = 34.5 bits (69), Expect = 0.75 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -2 / +1 Query: 554 SAAQRSPAGYYITRSMRHVAHYIHMLPHAPN*PKPSISP 438 SA R P G+Y+ R R V H + M H P P + +P Sbjct: 2743 SARVRGPLGHYVRRQRRMVEHRVPMSLHCPATPHGTWTP 2859
>LOC_Os07g14470:12007.t01311:unspliced-genomic OsWAK67 - OsWAK short gene| Length = 624 Score = 27.2 bits (53), Expect(2) = 0.90 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -3 / -3 Query: 127 RCCRPCGASPRSCG*CRPWCC 65 RC R C R G RP CC Sbjct: 508 RCSRRCSRCSRGTGIGRPHCC 446 Score = 24.4 bits (47), Expect(2) = 0.90 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -3 / -3 Query: 82 CRPWCCPYFSPRKMANSR 29 C PWCC P A+ R Sbjct: 436 CTPWCCRRGRPACSAHRR 383
>LOC_Os05g11730:12005.t01005:unspliced-genomic shaggy-related protein kinase dzeta, putative, expressed| Length = 4013 Score = 33.6 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -3 / +2 Query: 130 RRCCRPCGASPRSCG*CRPWCCPYFSPRKMANSRTLMG 17 RR CR G S C PW P SP +A+S+ +G Sbjct: 1010 RRYCRTDGTRTVSFSLCAPWTTPMSSP*SIASSQPQVG 1123
>LOC_Os02g57480:12002.t05320:unspliced-genomic anthocyanin 5-aromatic acyltransferase, putative, expressed| Length = 2083 Score = 33.6 bits (67), Expect = 1.4 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -3 / +1 Query: 115 PCGASPRSCG*CRPWCCPYFSPRKMANSRTLMGW 14 P G S RSC *CR CP + R A + GW Sbjct: 1537 PTGGSRRSCR*CRTGRCPSAARRGTACTTPTSGW 1638
>LOC_Os03g58500:12003.t05105:unspliced-genomic hypothetical protein| Length = 246 Score = 33.1 bits (66), Expect = 1.9 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -3 / -3 Query: 130 RRCCRPCGASPRSCG*CRPWCCPYFSPRKMANSR 29 RRCCR C ++ + CR C P PR+ A R Sbjct: 208 RRCCRRCSSTAATTRWCRCRCRPAPPPRRPAARR 107
>LOC_Os02g36040:12002.t03241:unspliced-genomic conserved hypothetical protein| Length = 1239 Score = 27.2 bits (53), Expect(2) = 2.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 / +3 Query: 130 RRCCRPCGASPRSC 89 R CCR G +PR+C Sbjct: 108 RHCCRARGGAPRNC 149 Score = 23.1 bits (44), Expect(2) = 2.1 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 / +2 Query: 97 RSCG*CRPWCCPYFSPR 47 RS * R W CP +PR Sbjct: 221 RSMR*WRSWACPARAPR 271
>LOC_Os07g35740:12007.t03248:unspliced-genomic protein kinase, putative, expressed| Length = 3784 Score = 31.8 bits (63), Expect(2) = 2.4 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -2 / -1 Query: 521 ITRSMRHVAHYIHMLPHAPN*PKPSISPALHLHAA 417 I S H+ Y H L APN P PS +L L A Sbjct: 2002 IISSKEHIKGYFHTL*TAPNPPSPSFMLSLKLSVA 1898 Score = 22.6 bits (43), Expect(2) = 2.4 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = -3 / -3 Query: 130 RRCCRPC 110 RRCC PC Sbjct: 164 RRCCSPC 144
>LOC_Os07g01520:12007.t00051:unspliced-genomic expressed protein| Length = 2561 Score = 32.7 bits (65), Expect = 2.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 / -2 Query: 130 RRCCRPCGASPRSCG*CRPWCCP 62 RRC R G S SCG PWC P Sbjct: 1045 RRCRRSGGRSLPSCGTRAPWCTP 977
>LOC_Os04g40320:12004.t03596:unspliced-genomic expressed protein| Length = 4013 Score = 32.7 bits (65), Expect = 2.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -3 / +1 Query: 130 RRCCRPCGASPRSCG*CRPWCCP 62 RRC PC P RPWC P Sbjct: 373 RRCAPPCARPPSRAPSRRPWCSP 441
>LOC_Os02g08330:12002.t00729:unspliced-genomic expressed protein| Length = 2175 Score = 32.7 bits (65), Expect = 2.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 / -2 Query: 130 RRCCRPCGASPRSCG*CRPWCC 65 R CCR PRSCG CR C Sbjct: 1487 RSCCRTRRTRPRSCGACRGRAC 1422
>LOC_Os11g27730:12011.t02387:unspliced-genomic cytochrome P450 71C4, putative, expressed| Length = 3855 Score = 32.7 bits (65), Expect = 2.7 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -1 / -1 Query: 582 RYYYKHRAVQCSAAQPSRLLHHKIHETCRALHTYATTRSKLTQAFHLAC 436 RY KH +Q + ++HH IH+ + +TT KL H+ C Sbjct: 3810 RY*LKH*LLQMARQLTKLIIHHCIHKVNKQTD*ASTTMQKLLLVTHIFC 3664
>LOC_Os07g48060:12007.t04440:unspliced-genomic cationic peroxidase 1 precursor, putative, expressed| Length = 2033 Score = 30.9 bits (61), Expect(2) = 3.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 / -2 Query: 124 CCRPCGASPRSCG*CRP 74 CC ASPRSC CRP Sbjct: 451 CCSASPASPRSCRRCRP 401 Score = 22.1 bits (42), Expect(2) = 3.3 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -1 / -1 Query: 534 SRLLHHKIHETCR 496 +R HHKI TC+ Sbjct: 1961 TRAGHHKIRSTCK 1923
>LOC_Os09g17930:12009.t01578:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 3702 Score = 32.2 bits (64), Expect = 3.7 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 / -3 Query: 479 LPHAPN*PKPSISPALHLHAAGARPEVA 396 LP +P P PS++P+LH H P A Sbjct: 2884 LPPSPYAPAPSLAPSLHAHTPSPAPSPA 2801
>LOC_Os02g47830:12002.t04367:unspliced-genomic expressed protein| Length = 1314 Score = 32.2 bits (64), Expect = 3.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -3 / -1 Query: 124 CCRPCGASPRSCG*CRPWCC 65 CC C P CG C WCC Sbjct: 654 CCGWCWGMPCCCGWCWCWCC 595
>LOC_Os02g33720:12002.t03013:unspliced-genomic RING-H2 finger protein ATL3C, putative, expressed| Length = 609 Score = 32.2 bits (64), Expect = 3.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 / +2 Query: 130 RRCCRPCGASPRSCG*CRPWC 68 RR RP G R CG CR WC Sbjct: 305 RRRRRPPGCGGRRCGRCRRWC 367
>LOC_Os01g20780:12001.t01816:unspliced-genomic anther-specific protein SF18 precursor, putative, expressed| Length = 919 Score = 32.2 bits (64), Expect = 3.7 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -3 / -2 Query: 130 RRCCRPCGASPRSCG*CRPWCCPYFSPRKMANSRTLMG 17 RR CR C R+C CRP ++ PR+ A R G Sbjct: 219 RRGCRGCRRRRRACRWCRP*ARWWWRPRRWAAGRHWRG 106
>LOC_Os01g01484:12001.t00047:unspliced-genomic light-mediated development protein DET1, putative, expressed| Length = 8172 Score = 32.2 bits (64), Expect = 3.7 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +1 / -1 Query: 400 TSGRAPAACRCSAGEMEGLG*FGACGSIC 486 T G PA C A E G+ G CG +C Sbjct: 399 TGGGPPACCGAGAAEERGIWLVGWCGGVC 313
>LOC_Os07g32630:12007.t02945:unspliced-genomic hydroquinone glucosyltransferase, putative, expressed| Length = 1962 Score = 31.8 bits (63), Expect = 5.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 / +3 Query: 130 RRCCRPCGASPRSCG*CRP 74 R CC PCGA SC * RP Sbjct: 240 RWCCCPCGAPATSCP*SRP 296
>LOC_Os01g50170:12001.t04454:unspliced-genomic aspartic proteinase nepenthesin-1 precursor, putative, expressed| Length = 1643 Score = 31.8 bits (63), Expect = 5.0 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 / -1 Query: 130 RRCCRPCGASPRSCG 86 RRCC GA+PR+CG Sbjct: 542 RRCCTVVGAAPRTCG 498
>LOC_Os01g18584:12001.t01651:unspliced-genomic OsWRKY9 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 8261 Score = 31.8 bits (63), Expect = 5.0 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 / +2 Query: 63 GQHHGRHHPQDRGEAP 110 G HHG+HH + RG AP Sbjct: 7583 GHHHGQHHLRRRGHAP 7630
>LOC_Os07g30950:12007.t02782:unspliced-genomic taxane 10-beta-hydroxylase, putative, expressed| Length = 1846 Score = 27.2 bits (53), Expect(2) = 5.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -3 / +1 Query: 124 CCRPCGASPRSCG 86 CC PCGA+P + G Sbjct: 181 CCAPCGATPPTGG 219 Score = 24.9 bits (48), Expect(2) = 5.5 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -3 / +1 Query: 106 ASPRSCG*CRPWCCPYFSPRKMANSRTLMGW 14 A R+CG CR C S +R L GW Sbjct: 640 ACTRACGRCRWTCRSPRSAEASWRARGLAGW 732
>LOC_Os02g29220:12002.t02616:unspliced-genomic expressed protein| Length = 4920 Score = 24.9 bits (48), Expect(2) = 6.1 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 / +1 Query: 518 TRSMRHVAHYIHMLPH 471 T + HV H+I LPH Sbjct: 802 TAAASHVTHHIRFLPH 849 Score = 23.5 bits (45), Expect(2) = 6.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 / +2 Query: 488 IHMLPHAPN*PKPSISPALHLHAAGARPE 402 + + P P P P+ +PA HA RP+ Sbjct: 899 LQLPPPPPLWPPPAAAPAPASHAPRGRPK 985
>LOC_Os07g11510:12007.t01024:unspliced-genomic seed allergenic protein RA5 precursor, putative, expressed| Length = 813 Score = 28.1 bits (55), Expect(2) = 6.4 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 / -2 Query: 127 RCCRPCGASPRSCG*CR 77 RC CG SPR+C CR Sbjct: 434 RCLPACG*SPRTCTSCR 384 Score = 22.6 bits (43), Expect(2) = 6.4 Identities = 11/39 (28%), Positives = 17/39 (43%) Frame = -1 / -2 Query: 633 MIPNYQWRYINTNTTPQRYYYKHRAVQCSAAQPSRLLHH 517 M+PN + I TTP + ++ S P+ HH Sbjct: 683 MLPNKRKTLIILVTTPHTCTASYSSLASSQISPASSRHH 567
>LOC_Os08g24980:12008.t02268:unspliced-genomic hypothetical protein| Length = 6090 Score = 31.3 bits (62), Expect = 6.9 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 / -2 Query: 130 RRCCRPCGASPRSC 89 R+C RPCG PRSC Sbjct: 4142 RQCNRPCGPRPRSC 4101
>LOC_Os06g40110:12006.t03707:unspliced-genomic RNA polymerase Rpc34 subunit family protein, expressed| Length = 1245 Score = 31.3 bits (62), Expect = 6.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 / -2 Query: 127 RCCRPCGASPRSCG*CRP 74 RC RPC +S R+CG C P Sbjct: 428 RCGRPCRSSRRACGRC*P 375
>LOC_Os06g04520:12006.t00342:unspliced-genomic expressed protein| Length = 10822 Score = 31.3 bits (62), Expect = 6.9 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -3 / -1 Query: 667 FFFFFHKRLRNDDTKLPMEIHQYQHDSSTL 578 FF F+HK L + + LP+ I + + SSTL Sbjct: 5089 FFMFYHKFLEHYQSSLPIVIVKIEGSSSTL 5000
>LOC_Os05g32030:12005.t02799:unspliced-genomic conserved hypothetical protein| Length = 4221 Score = 31.3 bits (62), Expect = 6.9 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 / -3 Query: 130 RRCCRPCGASPRSC 89 R+C RPCG PRSC Sbjct: 1627 RQCNRPCGPRPRSC 1586
>LOC_Os04g09580:12004.t00793:unspliced-genomic expressed protein| Length = 6917 Score = 31.3 bits (62), Expect = 6.9 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 / -3 Query: 121 CRPCGASPRSCG*CRPWCCP 62 CRPCGA G RP+C P Sbjct: 6255 CRPCGAGGVRSGVRRPYCAP 6196
>LOC_Os04g09570:12004.t00792:unspliced-genomic expressed protein| Length = 1151 Score = 31.3 bits (62), Expect = 6.9 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 / +2 Query: 121 CRPCGASPRSCG*CRPWCCP 62 CRPCGA G RP+C P Sbjct: 662 CRPCGAGGVRSGVRRPYCAP 721
>LOC_Os02g49970:12002.t04581:unspliced-genomic ZIM motif family protein, expressed| Length = 2476 Score = 31.3 bits (62), Expect = 6.9 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -3 / -2 Query: 661 FFFHKRLRNDDTKLPMEIHQYQHDSSTLLLQAPCSAVQR 545 FFFHK R K P + D++ LL PC +R Sbjct: 264 FFFHKEKRERSLKHPRRA*EAPLDTNLALLMIPCGGRRR 148
>LOC_Os02g36380:12002.t03275:unspliced-genomic cryptochrome 1 apoprotein, putative, expressed| Length = 3787 Score = 31.3 bits (62), Expect = 6.9 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 / +3 Query: 130 RRCCRPCGASPRSC 89 RRCCRP G+ P SC Sbjct: 1581 RRCCRPRGSRPASC 1622
>LOC_Os02g34550:12002.t03094:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 6767 Score = 31.3 bits (62), Expect = 6.9 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 / -3 Query: 130 RRCCRPCGASPRSC 89 R+C RPCG PRSC Sbjct: 4191 RQCNRPCGPRPRSC 4150
>LOC_Os07g23110:12007.t02012:unspliced-genomic poly synthetase 1, putative, expressed| Length = 10722 Score = 31.3 bits (62), Expect = 7.0 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = -1 / -1 Query: 561 AVQCSAAQPSRLLHHKIHETCRALHTYATTRSKLTQAFHLACT 433 A CSA P + H+T RA TY T +++CT Sbjct: 6051 AAVCSARLPCENNAKRFHQTLRAYLTYETMTKSHDSVHYISCT 5923
>LOC_Os11g38360:12011.t03378:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3898 Score = 27.6 bits (54), Expect(2) = 7.8 Identities = 12/45 (26%), Positives = 19/45 (42%) Frame = -1 / -2 Query: 567 HRAVQCSAAQPSRLLHHKIHETCRALHTYATTRSKLTQAFHLACT 433 H A++ A P ++ HK+ T + H R +HL T Sbjct: 687 HFALRAQPADPFSIVLHKVQCTSESTHLTLVRRLSTVVCYHLVNT 553 Score = 24.9 bits (48), Expect(2) = 7.8 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -3 / -1 Query: 112 CGASPRSC 89 CGASPRSC Sbjct: 538 CGASPRSC 515
>LOC_Os10g39060:12010.t03147:unspliced-genomic hypothetical protein| Length = 857 Score = 30.9 bits (61), Expect = 9.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 / +2 Query: 487 YICYHTLQINPSLPSRLHCTCT 422 Y+CY T ++ +PSRLH T Sbjct: 560 YVCYSTTPVSHGVPSRLHANRT 625
>LOC_Os10g21110:12010.t01602:unspliced-genomic 1,4-beta-xylanase, putative, expressed| Length = 3613 Score = 30.9 bits (61), Expect = 9.5 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 / +1 Query: 470 RVVAYVCNARHVSWIL*CNNRLGCAALHCTA 562 + A++C + + L*C+N L C C+A Sbjct: 784 KFTAFMCTVKKIEMFL*CSNELACMPHICSA 876
>LOC_Os05g16160:12005.t01387:unspliced-genomic conserved hypothetical protein| Length = 549 Score = 30.9 bits (61), Expect = 9.5 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -3 / +2 Query: 115 PCGASPRSCG*CRPWCCPYFSPRKMANSRTLMGW 14 P G S RSC *CR CP + R + GW Sbjct: 143 PTGGSRRSCR*CRTGRCPSAARRCTPCTTPTSGW 244
>LOC_Os05g08000:12005.t00681:unspliced-genomic hypothetical protein| Length = 1299 Score = 30.9 bits (61), Expect = 9.5 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 / -1 Query: 667 FFFFFHKRLRNDDTKLPMEIHQYQHDSSTLLLQAPCS 557 FF H R R D LP+ IH + H+S+ CS Sbjct: 915 FFRIVHLRHRQDPPYLPLHIHCHYHNSTRG*RMTKCS 805
>LOC_Os02g02400:12002.t00139:unspliced-genomic catalase isozyme A, putative, expressed| Length = 2795 Score = 30.9 bits (61), Expect = 9.5 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -2 / +2 Query: 506 RHVAHYIHMLPHAPN*PKPSISPALHLHAAGARP 405 R H++ LP P P P P LH H +P Sbjct: 599 RRHRHHLRRLPPVPGRPDPRHRPLLHRHPRARQP 700
>LOC_Os01g40480:12001.t03572:unspliced-genomic phosphoribosylanthranilate transferase, 3 partial, putative,| expressed Length = 3329 Score = 30.9 bits (61), Expect = 9.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 / +1 Query: 130 RRCCRPCGASPRSCG*CRPWCCP 62 RRCCR C S RS R C P Sbjct: 2536 RRCCRGCTTSARSASRSRRRCAP 2604
>LOC_Os11g46050:12011.t04130:unspliced-genomic conserved hypothetical protein| Length = 963 Score = 30.9 bits (61), Expect = 9.6 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -1 / -1 Query: 555 QCSAAQPSRLLHHKIHETCRALHTYATTRSKLTQAFHL 442 +C QP RLLHH H L + R+ A HL Sbjct: 369 RCRRQQPPRLLHHAHHRRRHELRRHLLRRAHGGGALHL 256
>LOC_Os03g22490:12003.t02000:unspliced-genomic heavy metal-associated domain containing protein, expressed| Length = 1859 Score = 30.9 bits (61), Expect = 9.6 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 / +1 Query: 424 CRCSAGEMEGLG*FGACGSICM*CATCLMD 513 CRCS+G +G*F +CG C C + D Sbjct: 184 CRCSSGADMVVG*FCSCGPWC*GCPSTASD 273
>LOC_Os03g10650:12003.t00866:unspliced-genomic cyclin delta-3, putative, expressed| Length = 2517 Score = 30.9 bits (61), Expect = 9.6 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = -1 / -2 Query: 663 FFFSTNDLEMMIPNYQWRYINTNTTPQRYYYKHRAVQCSAA 541 FF S++ + IPN+ W I T R Y R C A Sbjct: 2492 FFLSSHRYQ*TIPNHSWSAIAHETRESRVKYSERDGPCPLA 2370 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 198,836,097 Number of extensions: 3122361 Number of successful extensions: 17020 Number of sequences better than 10.0: 49 Length of query: 223 Length of database: 55,613,886 Length adjustment: 48 Effective length of query: 175 Effective length of database: 52,912,542 Effective search space: 9259694850 Effective search space used: 9259694850 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
