| Clone Name | FLbaf13g03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q58193:Y783_METJA Uncharacterized protein MJ0783 - Methanococcus... | 34 | 1.2 | 2 | Q7RZ35:DBP4_NEUCR ATP-dependent RNA helicase dbp-4 - Neurospora ... | 33 | 2.6 | 3 | O43426:SYNJ1_HUMAN Synaptojanin-1 - Homo sapiens (Human) | 31 | 9.8 |
|---|
>Q58193:Y783_METJA Uncharacterized protein MJ0783 - Methanococcus jannaschii| Length = 186 Score = 33.9 bits (76), Expect = 1.2 Identities = 23/86 (26%), Positives = 46/86 (53%), Gaps = 2/86 (2%) Frame = +3 Query: 627 VGFMEDGAQWLIDNTDIQLVGVDYLSVGAYDECIPAHLVFLEKREVILVEALN--LEHVA 800 + F++D I ++I+ VG+D ++G ++E H L ++++E LN L+++ Sbjct: 110 IPFLDD-----IIKSNIKCVGIDACTIGGFEE----HKRLLSNN-ILIIENLNENLKNLV 159 Query: 801 TGIYTLHCLPLRLRGAEGSPARCILV 878 + LPL++ + SP RCI + Sbjct: 160 GKSFYFLGLPLKIFDIDASPIRCIAI 185
>Q7RZ35:DBP4_NEUCR ATP-dependent RNA helicase dbp-4 - Neurospora crassa| Length = 823 Score = 32.7 bits (73), Expect = 2.6 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Frame = +3 Query: 390 VDAPGHVFEHY-YDAGFDIDTLDLAVLNGPALLVDVPRDTNITADVMESLHIPKGVRRVL 566 V PG + +H AGFD+D L + VL+ ++D+ + A V H+PK + +L Sbjct: 183 VCTPGRMLQHLDQTAGFDVDNLQMLVLDEADRIMDMGFQQAVDALVE---HLPKSRQTLL 239 Query: 567 FRTLNTDR 590 F + R Sbjct: 240 FSATQSKR 247
>O43426:SYNJ1_HUMAN Synaptojanin-1 - Homo sapiens (Human)| Length = 1575 Score = 30.8 bits (68), Expect = 9.8 Identities = 18/45 (40%), Positives = 21/45 (46%) Frame = -2 Query: 409 TWPGASTWVPECAVSRSSEKLAMSEPLRMERASRRNPGVPSADSN 275 T P +S C SE S P+R RA R PG PSA S+ Sbjct: 1040 TSPSSSPRTSPCQSPTISEGPVPSLPIRPSRAPSRTPGPPSAQSS 1084 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 151,287,859 Number of extensions: 3091950 Number of successful extensions: 7203 Number of sequences better than 10.0: 3 Number of HSP's gapped: 7200 Number of HSP's successfully gapped: 3 Length of query: 353 Length of database: 100,686,439 Length adjustment: 114 Effective length of query: 239 Effective length of database: 69,416,809 Effective search space: 16590617351 Effective search space used: 16590617351 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)