ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf16h11 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os05g08554:12005.t004720:unspliced-genomic expressed protein| Length = 2656 Score = 65.2 bits (136), Expect = 3e-10 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +1 / +3 Query: 121 KMYDAPSGQEMSYTDHVQRRHEEKGCLYA 207 KMY+ PS QEM+Y DHVQRRHEEKGCLYA Sbjct: 183 KMYNPPSAQEMTYKDHVQRRHEEKGCLYA 269 Score = 35.4 bits (71), Expect = 0.25 Identities = 18/30 (60%), Positives = 20/30 (66%) Frame = -1 / -1 Query: 209 HA*RQPFSSWRLCTWSV*DISCPDGASYIL 120 HA +QPFSSWRL T S+ IS G YIL Sbjct: 271 HAYKQPFSSWRL*T*SLYVISWALGGLYIL 182
>LOC_Os06g05120:12006.t00401:unspliced-genomic expressed protein| Length = 2326 Score = 62.9 bits (131), Expect = 1e-09 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +1 / +2 Query: 121 KMYDAPSGQEMSYTDHVQRRHEEKGCLYA 207 KMY+AP Q+MSY +HVQRRHEEKGCLYA Sbjct: 1328 KMYNAPMAQDMSYYEHVQRRHEEKGCLYA 1414 Score = 57.9 bits (120), Expect = 4e-08 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = +1 / +1 Query: 118 AKMYDAPSGQEMSYTDHVQRRHEEKGCLYA 207 AKMY+ P+ Q+MSY DH +RHEEKGCLYA Sbjct: 94 AKMYNPPAQQDMSYYDHCTKRHEEKGCLYA 183 Score = 56.5 bits (117), Expect = 1e-07 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 / -2 Query: 209 HA*RQPFSSWRLCTWSV*DISCPDGASYILA 117 HA*RQPFSSWRLCT S *D+SC GA YIL+ Sbjct: 1416 HA*RQPFSSWRLCTCS**DMSCAIGALYILS 1324 Score = 41.4 bits (84), Expect = 0.004 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = -1 / -3 Query: 209 HA*RQPFSSWRLCTWSV*DISCPDGASYILA 117 HA*RQPFSS RL S *D+SC G YILA Sbjct: 185 HA*RQPFSSCRLVQ*S**DMSCCAGGLYILA 93 Score = 34.5 bits (69), Expect = 0.47 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = +3 / +1 Query: 120 QDVRRSVGAGDVLHRPRAEAPRGEGLP 200 QDV RS G G VL AEAP GEGLP Sbjct: 1327 QDV*RSNGTGHVLL*TCAEAP*GEGLP 1407
>LOC_Os01g08300:12001.t00708:unspliced-genomic expressed protein| Length = 973 Score = 60.6 bits (126), Expect = 7e-09 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +1 / +3 Query: 118 AKMYDAPSGQEMSYTDHVQRRHEEKGCLYA 207 A MY+ P+ QEMSY+DHV++RHE+KGCLYA Sbjct: 96 AAMYNPPAAQEMSYSDHVKKRHEDKGCLYA 185 Score = 54.2 bits (112), Expect = 6e-07 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -1 / -1 Query: 209 HA*RQPFSSWRLCTWSV*DISCPDGASYILAK 114 HA*RQP SSWR TWS *DISC G YI A+ Sbjct: 187 HA*RQPLSSWRFLTWSE*DISCAAGGLYIAAR 92 Score = 36.8 bits (74), Expect = 0.097 Identities = 17/26 (65%), Positives = 19/26 (73%) Frame = +3 / +2 Query: 123 DVRRSVGAGDVLHRPRAEAPRGEGLP 200 DV+ S GAGDVL RP EAP G+ LP Sbjct: 101 DVQPSGGAGDVLLRPCQEAP*GQRLP 178
>LOC_Os02g11770:12002.t00976:unspliced-genomic expressed protein| Length = 970 Score = 36.3 bits (73), Expect = 0.13 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +1 / +2 Query: 145 QEMSYTDHVQRRHEEKGCLYA 207 Q++S +HV++RHEEKG LYA Sbjct: 167 QKLSAMEHVKKRHEEKGFLYA 229
>LOC_Os02g50550:12002.t04639:unspliced-genomic dynamin-2B, putative, expressed| Length = 9681 Score = 34.5 bits (69), Expect = 0.47 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -1 / +3 Query: 350 RPVGVSAAPCGLRPWRPW 297 RP S PC RPWRPW Sbjct: 57 RPASRSQRPCRRRPWRPW 110
>LOC_Os01g40200:12001.t03546:unspliced-genomic XIK, putative, expressed| Length = 4144 Score = 34.5 bits (69), Expect = 0.47 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 / -2 Query: 300 WPPWTEAARRSRDPHRPQPP 359 WP W ARRS P RP PP Sbjct: 1029 WPSWPPPARRSPAPPRPPPP 970
>LOC_Os09g38750:12009.t03343:unspliced-genomic expressed protein| Length = 3215 Score = 33.1 bits (66), Expect(2) = 0.48 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 / +2 Query: 300 WPPWTEAARRSRDPHRPQPP 359 WPP + RRSR P RP PP Sbjct: 89 WPPCAGSLRRSRWPPRPPPP 148 Score = 22.1 bits (42), Expect(2) = 0.48 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +3 / +2 Query: 351 QPPFIISIYVCL 386 +PPF +S+ CL Sbjct: 2447 EPPFFLSVCACL 2482
>LOC_Os11g05280:12011.t00421:unspliced-genomic conserved hypothetical protein| Length = 1017 Score = 28.1 bits (55), Expect(2) = 0.56 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 / +3 Query: 153 VLHRPRAEAPRGEGLP 200 V HRPR AP EGLP Sbjct: 288 VAHRPRHPAPTEEGLP 335 Score = 25.4 bits (49), Expect(2) = 0.56 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 / +2 Query: 326 AQQRPPPASAAFHNKHICVSSVSAR 400 A + PPPA AA C S+ SAR Sbjct: 710 AARPPPPAPAAEGTSCGCASTASAR 784
>LOC_Os10g42280:12010.t03457:unspliced-genomic cyclase/dehydrase family protein, putative, expressed| Length = 1089 Score = 31.3 bits (62), Expect(2) = 0.81 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 / +3 Query: 360 FIISIYVCLVSQLDQKNCIRYFCTAFHNKHIY 455 F + + VCL S L+ R+FC++F K IY Sbjct: 981 FYLPLCVCLTS*LESIFAFRWFCSSFKFKLIY 1076 Score = 21.7 bits (41), Expect(2) = 0.81 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +2 / +2 Query: 320 RKAQQRPPPASAAFHNKHI 376 R+ +QRPPP +H+ Sbjct: 386 RRQRQRPPPRPPPRGQRHL 442
>LOC_Os04g42750:12004.t03821:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1839 Score = 27.2 bits (53), Expect(2) = 0.97 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +2 / -3 Query: 371 HICVSSVSARSEELYQI 421 H+C +SVS SE +YQI Sbjct: 118 HLCGTSVSVLSERVYQI 68 Score = 26.3 bits (51), Expect(2) = 0.97 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 / -3 Query: 301 GRHGRRPQGAAETPTGLSR 357 G HGRRP + +P+ SR Sbjct: 1078 GEHGRRPPSISASPSSSSR 1022
>LOC_Os08g45170:12008.t04238:unspliced-genomic carboxyl-terminal proteinase, putative, expressed| Length = 5438 Score = 33.1 bits (66), Expect = 1.2 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 / +3 Query: 303 PPWTEAARRSRDPHRPQPP 359 PPW+ A RS P RP PP Sbjct: 5019 PPWSSGAARSSTPTRPAPP 5075
>LOC_Os10g22510:12010.t01731:unspliced-genomic mla1, putative, expressed| Length = 4002 Score = 32.7 bits (65), Expect = 1.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 / +1 Query: 356 RLRPVGVSAAPCGLRPWRP 300 R PV ++ A CG RPWRP Sbjct: 70 REEPVALAQADCGWRPWRP 126
>LOC_Os04g13220:12004.t01143:unspliced-genomic multidrug resistance-associated protein 4, putative, expressed| Length = 8557 Score = 32.7 bits (65), Expect = 1.7 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +3 / -3 Query: 312 TEAARRSRDPHRPQPPFIISIYVCLVSQ 395 T+ A+ +R PH+PQ + S+Y C +++ Sbjct: 5381 TDTAKMTRTPHQPQASVMYSLYTCQLTR 5298
>LOC_Os02g30110:12002.t02704:unspliced-genomic cytochrome P450, putative, expressed| Length = 5541 Score = 32.7 bits (65), Expect = 1.7 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +2 / +3 Query: 311 DGGRKAQQRPPPASAAFHNKHICVSSVSARS 403 DGG + +QRPP +A F H +++VS+ S Sbjct: 2478 DGGARERQRPPRQAALFAAAHSALTAVSSDS 2570
>LOC_Os10g09550:12010.t00769:unspliced-genomic OsWAK106 - OsWAK receptor-like protein kinase| Length = 3323 Score = 25.4 bits (49), Expect(2) = 1.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 / +1 Query: 144 AGDVLHRPRAEAPRGEGLP 200 AGD P A P G GLP Sbjct: 370 AGDRARHPEAPPPDGSGLP 426 Score = 24.4 bits (47), Expect(2) = 1.7 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 / +3 Query: 300 WPPWTEAARRSR 335 WPPW RR R Sbjct: 417 WPPWPRPPRRRR 452
>LOC_Os06g41110:12006.t03806:unspliced-genomic expressed protein| Length = 7809 Score = 29.9 bits (59), Expect(2) = 1.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 / +1 Query: 294 QPWPPWTEAARRSRDPHRPQPP 359 QPWP RR R RP PP Sbjct: 133 QPWPTSPSTPRRRRRRRRPPPP 198 Score = 24.4 bits (47), Expect(2) = 1.9 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +3 / +1 Query: 339 PHRPQPPFIISIYVCLVSQLDQKNCIRYFC 428 P P PP + +I V + + +K YFC Sbjct: 7495 PTEPDPPVLQAIVVFFLGKNVKKKRDAYFC 7584
>LOC_Os07g45430:12007.t04181:unspliced-genomic conserved hypothetical protein| Length = 2622 Score = 32.2 bits (64), Expect = 2.3 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = +1 / +3 Query: 397 SIRRTVSDISVLPFTISIY 453 S RTVSD+SVLPF+I +Y Sbjct: 1176 SSSRTVSDLSVLPFSIYLY 1232
>LOC_Os05g12410:12005.t01069:unspliced-genomic polygalacturonase-1 non-catalytic beta subunit precursor, putative,| expressed Length = 1052 Score = 32.2 bits (64), Expect = 2.3 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 / -2 Query: 303 PPWTEAARRSRDPHRP 350 PPWT A RS PHRP Sbjct: 346 PPWTRATSRSAWPHRP 299
>LOC_Os02g58290:12002.t05400:unspliced-genomic expressed protein| Length = 372 Score = 32.2 bits (64), Expect = 2.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 / -3 Query: 300 WPPWTEAARRSRDPHRP 350 WPPW ARR R P RP Sbjct: 97 WPPWCGRARR*RRPRRP 47
>LOC_Os01g62180:12001.t05594:unspliced-genomic thaumatin-like protein precursor, putative| Length = 921 Score = 32.2 bits (64), Expect = 2.3 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -1 / -1 Query: 65 QPPRVVLCSALLSCGFGKMW 6 +PPR ++C +SCG G+ W Sbjct: 810 KPPRDLVCPVFISCGTGRSW 751
>LOC_Os11g29290:12011.t02534:unspliced-genomic cytochrome P450 86A2, putative, expressed| Length = 2231 Score = 27.6 bits (54), Expect(2) = 2.8 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 / -1 Query: 129 RRSVGAGDVLHRPRAEAPRGEG 194 RR+ G G RPRA PRG G Sbjct: 692 RRAPGRGGPAPRPRAR*PRGPG 627 Score = 24.4 bits (47), Expect(2) = 2.8 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +1 / -3 Query: 193 GCLYACVF 216 GC+YACVF Sbjct: 24 GCIYACVF 1
>LOC_Os11g29930:12011.t02597:unspliced-genomic hypothetical protein| Length = 297 Score = 31.8 bits (63), Expect = 3.2 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 / -3 Query: 297 PWPPWTEAARRSRDPHRPQPP 359 P P W RR+ HRPQPP Sbjct: 241 PRPRWRRRGRRTLTRHRPQPP 179
>LOC_Os02g42310:12002.t03816:unspliced-genomic lysosomal protective protein precursor, putative, expressed| Length = 7255 Score = 31.8 bits (63), Expect = 3.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 / -1 Query: 294 QPWPPWTEAARRSRDPHRP 350 QPWPPW A RR R RP Sbjct: 4549 QPWPPWALAYRRFRYFPRP 4493
>LOC_Os02g01440:12002.t00044:unspliced-genomic nitric-oxide synthase, putative, expressed| Length = 4144 Score = 31.8 bits (63), Expect = 3.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 / +2 Query: 297 PWPPWTEAARRSRDPHRPQP 356 P PP T AARR R P RP+P Sbjct: 344 PPPPATAAARRCRRPTRPRP 403
>LOC_Os04g38860:12004.t03456:unspliced-genomic amino acid permease, putative, expressed| Length = 2394 Score = 26.3 bits (51), Expect(2) = 4.0 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 / -3 Query: 297 PWPPWTEAARRSRDPHRPQPP 359 P PP + RS PHR PP Sbjct: 1006 PSPPPSRPCTRSSPPHRRPPP 944 Score = 25.4 bits (49), Expect(2) = 4.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 / -1 Query: 381 CLVSQLDQKNCIRYFCTAFHNKHIY 455 C+ S + QK RY C H++HI+ Sbjct: 243 CV*S*IKQKIDGRYICPLTHSRHIH 169
>LOC_Os10g32750:12010.t02583:unspliced-genomic protein binding protein, putative| Length = 1821 Score = 27.2 bits (53), Expect(2) = 4.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 / -3 Query: 294 QPWPPWTEAARRSRDPHRPQP 356 +P PPW ARR+ RP P Sbjct: 400 RPRPPWRARARRTCPGTRPSP 338 Score = 24.0 bits (46), Expect(2) = 4.2 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 / -3 Query: 11 SSQSHRKGERSRAQP 55 S +SHR+G R RA P Sbjct: 658 SWRSHRRGTRRRASP 614
>LOC_Os12g22670:12012.t02005:unspliced-genomic conserved hypothetical protein| Length = 1245 Score = 31.3 bits (62), Expect = 4.4 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 / -3 Query: 297 PWPPWTEAARRSRDPHRPQPPFIISI 374 PWPP SR P RP PP S+ Sbjct: 1021 PWPPAHPHVAASRAPPRPPPPLRASV 944
>LOC_Os09g28750:12009.t02553:unspliced-genomic gibberellin receptor GID1L2, putative, expressed| Length = 1176 Score = 31.3 bits (62), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 / +3 Query: 129 RRSVGAGDVLHRPRAEAPRGEG 194 RR G G RPRA PRGEG Sbjct: 771 RRRAGVGRAGLRPRARVPRGEG 836
>LOC_Os05g24810:12005.t02138:unspliced-genomic hypothetical protein| Length = 2782 Score = 31.3 bits (62), Expect = 4.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 / +3 Query: 356 RLRPVGVSAAPCGLRPWRP 300 R+RP+ V+ PC R WRP Sbjct: 15 RVRPLAVAGGPCVRRQWRP 71
>LOC_Os01g71670:12001.t06460:unspliced-genomic glucan endo-1,3-beta-glucosidase GII precursor, putative, expressed| Length = 2346 Score = 31.3 bits (62), Expect = 4.4 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 / -2 Query: 157 RTSPAPTERRTSWQRVGW 104 R SPA RR SW+R GW Sbjct: 1802 RPSPARRTRRPSWRRTGW 1749
>LOC_Os01g42870:12001.t03804:unspliced-genomic 10-deacetylbaccatin III 10-O-acetyltransferase, putative, expressed| Length = 1755 Score = 31.3 bits (62), Expect = 4.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 / -2 Query: 291 NQPWPPWTEAARRSRDPHRPQPP 359 + PWPP T RR P RP+ P Sbjct: 425 SSPWPPRTTPPRRCSPPPRPRGP 357
>LOC_Os03g40610:12003.t03487:unspliced-genomic cytochrome P450 78A11, putative, expressed| Length = 1303 Score = 25.4 bits (49), Expect(2) = 5.6 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 / +2 Query: 141 GAGDVLHRPRAEAPRGEGLP 200 GAG RPR +PRG P Sbjct: 383 GAGCAAWRPRTRSPRGGSRP 442 Score = 24.9 bits (48), Expect(2) = 5.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 / +3 Query: 301 GRHGRRPQG 327 GRHGRRP G Sbjct: 867 GRHGRRPMG 893
>LOC_Os10g05940:12010.t00466:unspliced-genomic expressed protein| Length = 1356 Score = 30.9 bits (61), Expect = 6.0 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 / +2 Query: 338 PPPASAAFHNKHICVSSVSARSEELYQI 421 PPP +AA H +CVS RS +I Sbjct: 59 PPPPTAAHHGPRVCVSFAPPRSRSSGEI 142
>LOC_Os09g32850:12009.t02898:unspliced-genomic hypothetical protein| Length = 790 Score = 30.9 bits (61), Expect = 6.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 / -1 Query: 300 WPPWTEAARRSRDPHRPQP 356 WPP T AARR R P R P Sbjct: 118 WPPATAAARRRRAPRRRWP 62
>LOC_Os07g03100:12007.t00200:unspliced-genomic F-box domain containing protein, expressed| Length = 2742 Score = 30.9 bits (61), Expect = 6.0 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +3 / +3 Query: 300 WPPWTEAARRSRDPHRPQPPFIISIYVCLVSQLDQKNC 413 W P T RR R+P+ F + +C V D +C Sbjct: 417 WDPMTGDVRRQREPYGTLCTFATAAVLCAVPGCDHHDC 530
>LOC_Os02g29150:12002.t02609:unspliced-genomic ribosomal RNA apurinic site specific lyase, putative, expressed| Length = 4683 Score = 30.9 bits (61), Expect = 6.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 / +2 Query: 297 PWPPWTEAARRSRDPHRPQPP 359 P PPW RSR RP PP Sbjct: 446 PPPPWRRTGARSRAGSRPSPP 508
>LOC_Os02g15000:12002.t01293:unspliced-genomic RING-H2 finger protein ATL2L, putative, expressed| Length = 636 Score = 30.9 bits (61), Expect = 6.0 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 / -3 Query: 292 TSHGRHGRRPQGAAETPTGLSR 357 T R G+ P GAA TPTG +R Sbjct: 256 TGRARPGQEPAGAAATPTGRTR 191
>LOC_Os09g30466:12009.t02731:unspliced-genomic nuclear ribonuclease Z, putative, expressed| Length = 3161 Score = 24.0 bits (46), Expect(2) = 7.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 / +2 Query: 132 RSVGAGDVLHRPRAEAPRGEGLP 200 R+V + HRPRA R GLP Sbjct: 398 RAVPQRRLRHRPRAALRREPGLP 466 Score = 23.5 bits (45), Expect(2) = 7.5 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +2 / +2 Query: 320 RKAQQRPPPASAAFHNKHICVSSVSAR 400 R ++RP P H+ C S +S R Sbjct: 488 RPHRERPEPCPGLIHSCAACAS*ISCR 568
>LOC_Os08g34760:12008.t03216:unspliced-genomic expressed protein| Length = 7223 Score = 28.6 bits (56), Expect(2) = 7.6 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = +3 / +2 Query: 339 PHRPQPPFIISIYV 380 PHRP+PP+I+S+ V Sbjct: 6143 PHRPKPPWIVSMGV 6184 Score = 23.5 bits (45), Expect(2) = 7.6 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 / +3 Query: 314 GGRKAQQRPPPA 349 GG + ++RPPPA Sbjct: 5901 GGARGRRRPPPA 5936
>LOC_Os02g07810:12002.t00677:unspliced-genomic ATP binding protein, putative, expressed| Length = 2729 Score = 26.7 bits (52), Expect(2) = 8.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 / -2 Query: 306 PWTEAARRSRDPHRPQPP 359 P T +ARR R P R +PP Sbjct: 160 PGTRSARRPRAPRRRRPP 107 Score = 24.0 bits (46), Expect(2) = 8.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 / -3 Query: 16 PKPQERRAEQSTTLGG 63 P P RRA +STT GG Sbjct: 2220 PPPCRRRAARSTT*GG 2173
>LOC_Os11g41560:12011.t03692:unspliced-genomic F-box domain containing protein, expressed| Length = 2678 Score = 30.4 bits (60), Expect = 8.3 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 / +2 Query: 359 RRLRPVGVSAAPCGLRPWR 303 RRL P G++AA C +PWR Sbjct: 74 RRLPPRGLAAARCVCKPWR 130
>LOC_Os10g35490:12010.t02845:unspliced-genomic epoxide hydrolase, putative, expressed| Length = 2114 Score = 30.4 bits (60), Expect = 8.3 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 / -3 Query: 378 VCLVSQLDQKNCIRYFCTAFHNKHIYG 458 + + S D +NC+ YF F H+YG Sbjct: 1596 IVIASYQDTENCLSYFVVFFACAHLYG 1516
>LOC_Os10g11980:12010.t00988:unspliced-genomic transferase family protein, expressed| Length = 5561 Score = 30.4 bits (60), Expect = 8.3 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +3 / -3 Query: 297 PWPPWTEAARRSRDPHRP 350 PWPPW A+ P RP Sbjct: 5157 PWPPWAAASTPPSTPRRP 5104
>LOC_Os09g30090:12009.t02687:unspliced-genomic WD40-like, putative| Length = 1332 Score = 30.4 bits (60), Expect = 8.3 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 / -3 Query: 335 SAAPCGLRPWRPW 297 ++ PC RPWRPW Sbjct: 700 ASRPCTCRPWRPW 662
>LOC_Os07g29450:12007.t02635:unspliced-genomic expressed protein| Length = 6001 Score = 30.4 bits (60), Expect = 8.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 / +2 Query: 338 PPPASAAFHNKHICVSSVSAR 400 PPP +A+FH +C S AR Sbjct: 5087 PPPVTASFHRYELCFSGEKAR 5149
>LOC_Os05g25480:12005.t02204:unspliced-genomic hydrolase, hydrolyzing O-glycosyl compounds, putative, expressed| Length = 2319 Score = 30.4 bits (60), Expect = 8.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 / -3 Query: 300 WPPWTEAARRSRDPHRPQPP 359 WPP A RRSR P P PP Sbjct: 2161 WPPPGAARRRSRRPCNPCPP 2102
>LOC_Os04g40950:12004.t03656:unspliced-genomic glyceraldehyde-3-phosphate dehydrogenase, cytosolic 3, putative,| expressed Length = 3721 Score = 30.4 bits (60), Expect = 8.3 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 / -1 Query: 303 PPWTEAARRSRDPHRPQP 356 PPW A+R SR H P P Sbjct: 373 PPWPRASRSSRTLHNPHP 320
>LOC_Os04g33960:12004.t03071:unspliced-genomic hypothetical protein| Length = 1295 Score = 30.4 bits (60), Expect = 8.3 Identities = 13/27 (48%), Positives = 21/27 (77%) Frame = +1 / +3 Query: 391 LSSIRRTVSDISVLPFTISIYMVSSLK 471 L+SI+ +S +S L FT+S+Y VS+L+ Sbjct: 780 LTSIK*GISSLSSLNFTLSVYDVSNLQ 860
>LOC_Os02g38120:12002.t03450:unspliced-genomic photoreceptor-interacting protein-like, putative, expressed| Length = 2847 Score = 30.4 bits (60), Expect = 8.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 / +1 Query: 160 CRTSPAPTERRTSWQRVGW 104 CRT A T RRTS R GW Sbjct: 2068 CRTRRARTRRRTSSSRCGW 2124
>LOC_Os01g43280:12001.t03844:unspliced-genomic hydroquinone glucosyltransferase, putative, expressed| Length = 1975 Score = 30.4 bits (60), Expect = 8.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 / -3 Query: 297 PWPPWTEAARRSRDPHRPQPP 359 PWPP A S P RP PP Sbjct: 1448 PWPPPPAAPAPSSAPRRPSPP 1386
>LOC_Os01g12880:12001.t01154:unspliced-genomic VHS and GAT domain protein, putative, expressed| Length = 8181 Score = 30.4 bits (60), Expect = 8.3 Identities = 8/14 (57%), Positives = 14/14 (100%) Frame = +2 / +1 Query: 356 AFHNKHICVSSVSA 397 +FHNKH+C++S+S+ Sbjct: 2131 SFHNKHVCINSLSS 2172
>LOC_Os10g35030:12010.t02798:unspliced-genomic IAP100, putative, expressed| Length = 5854 Score = 24.0 bits (46), Expect(2) = 9.5 Identities = 8/22 (36%), Positives = 10/22 (45%) Frame = +3 / -3 Query: 294 QPWPPWTEAARRSRDPHRPQPP 359 +P P W+ R P P PP Sbjct: 359 RPPPSWSACPPRGARPRTPPPP 294 Score = 23.1 bits (44), Expect(2) = 9.5 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 / -1 Query: 138 VGAGDVLHRPRAEAPRGEGL 197 VGAGDV+ +PR P G+ Sbjct: 463 VGAGDVVVQPRRGDPGHGGV 404 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 167,537,020 Number of extensions: 2289121 Number of successful extensions: 15250 Number of sequences better than 10.0: 52 Length of query: 157 Length of database: 55,613,886 Length adjustment: 47 Effective length of query: 110 Effective length of database: 52,968,820 Effective search space: 5826570200 Effective search space used: 5826570200 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
