| Clone Name | FLbaf12o11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | P48236:YG3L_YEAST Uncharacterized membrane protein YGR149W - Sac... | 30 | 6.1 |
|---|
>P48236:YG3L_YEAST Uncharacterized membrane protein YGR149W - Saccharomyces cerevisiae| (Baker's yeast) Length = 432 Score = 30.0 bits (66), Expect = 6.1 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +2 Query: 350 Y*TSNYLFYALLNLEQFMYYCHALFLLSIWTYPFE*L*FMSC 475 Y T N+ F A F Y+ + L LL IW +P+ F SC Sbjct: 157 YKTKNHYFLA-----DFCYFVNMLCLLFIWIFPYSYSLFQSC 193 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 89,749,714 Number of extensions: 1760019 Number of successful extensions: 3314 Number of sequences better than 10.0: 1 Number of HSP's gapped: 3314 Number of HSP's successfully gapped: 1 Length of query: 191 Length of database: 100,686,439 Length adjustment: 107 Effective length of query: 84 Effective length of database: 71,336,874 Effective search space: 5992297416 Effective search space used: 5992297416 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)