ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf20p06 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os02g30110:12002.t02704:unspliced-genomic cytochrome P450, putative, expressed| Length = 5541 Score = 37.3 bits (75), Expect = 0.20 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +3 / -3 Query: 915 SRRSVPSRPVHCRPVSSLSPFAIPCSQETR*LPL 1016 + R PS P HC PV SP A PC +R PL Sbjct: 1969 AHRRPPSAPAHCPPVRRRSPPAAPCRCRSRRRPL 1868
>LOC_Os08g37810:12008.t03517:unspliced-genomic expressed protein| Length = 1649 Score = 24.4 bits (47), Expect(3) = 0.24 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = +3 / +2 Query: 822 YHHHNHNRSQPQM*TCGG*VHDSQHSRDPY 911 +HHH H ++ + C H + +R P+ Sbjct: 155 HHHHRHRSARGRWPKCPTPPHPEKPNRPPH 244 Score = 23.1 bits (44), Expect(3) = 0.24 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +3 / +2 Query: 795 HKIKPKLSTYHHHNHNR 845 H P HHH+H+R Sbjct: 119 HARSPPRDPRHHHHHHR 169 Score = 22.6 bits (43), Expect(3) = 0.24 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 / +1 Query: 914 QPTLCPVPSCPLPSRVVPLPF 976 +PT P P P+P +P P+ Sbjct: 229 EPTAPPPPPPPIPLLRLPSPY 291
>LOC_Os07g20160:12007.t01821:unspliced-genomic conserved hypothetical protein| Length = 657 Score = 36.3 bits (73), Expect = 0.38 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +3 / -1 Query: 807 PKLSTYHHHNHNRSQPQM*TCGG*VHDSQHSRDPYLSRRSVPSRPV 944 P + +HH+H RS P + T H + S P+ RR P P+ Sbjct: 192 PTAAAPNHHSHRRSPPPLPTAAPHTHSRRRSPPPHPHRRRFPLLPL 55
>LOC_Os01g27370:12001.t02440:unspliced-genomic hypothetical protein| Length = 1746 Score = 35.9 bits (72), Expect = 0.52 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +2 / -2 Query: 905 SLPQPTLCPVPSCPLPSRVVPLP 973 +LP T CP P+ PLPSR PLP Sbjct: 1265 TLPPRTPCPCPASPLPSRRWPLP 1197
>LOC_Os11g26080:12011.t02224:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 6526 Score = 35.9 bits (72), Expect = 0.53 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +1 / +3 Query: 622 LLLMSREVTVDANGTVVPWTEPPRETCLHRVWRRV 726 LL +++ TVDA+GT + WTE T H W+R+ Sbjct: 1737 LLKLTQTRTVDAHGTYLSWTEVLMLTIHHAGWKRM 1841
>LOC_Os06g03830:12006.t00274:unspliced-genomic retinol dehydrogenase 14, putative, expressed| Length = 3183 Score = 28.1 bits (55), Expect(2) = 0.58 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 / +1 Query: 955 GRQWTGRDGTERRLR*GSREC*ESCTQPP 869 GR W R G RR R R C S PP Sbjct: 271 GRGWCCRRGASRRRRRRGRGCSPSAPPPP 357 Score = 24.9 bits (48), Expect(2) = 0.58 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 / +1 Query: 1017 PTAAIESPANTGWRKGRGTTRDG 949 PT+A P++ G R+G G R G Sbjct: 187 PTSATSPPSSPGRRRG*GRRRRG 255
>LOC_Os02g40710:12002.t03707:unspliced-genomic ammonium transporter 1, member 1 precursor, putative, expressed| Length = 1573 Score = 29.0 bits (57), Expect(2) = 0.60 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 / +3 Query: 906 PYLSRRSVPSRPVHCRPVSSLSP 974 P +RR+ SRP C P SS SP Sbjct: 177 PRWTRRTCSSRPTSCSPCSSGSP 245 Score = 24.0 bits (46), Expect(2) = 0.60 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +3 / +1 Query: 792 QHKIKPKLSTYHHHNHNRSQPQ 857 QHK P L++ HH QP+ Sbjct: 37 QHKTLPHLASETHHGDVLGQPR 102
>LOC_Os12g41780:12012.t03854:unspliced-genomic acetylglucosaminyltransferase, putative, expressed| Length = 2946 Score = 35.4 bits (71), Expect = 0.72 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 / -3 Query: 744 WPDDASHPTHVGLTPSQHKIKPKLSTYHHHNHNR 845 WP + +H T + K+KP S HHH H+R Sbjct: 568 WPKNKNHLTARTKKKKKMKMKPSPSLLHHHRHHR 467
>LOC_Os05g40740:12005.t03613:unspliced-genomic pollen-specific protein NTP303 precursor, putative, expressed| Length = 2722 Score = 35.4 bits (71), Expect = 0.72 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -3 / -3 Query: 976 KGERDDTGRQWTGRDGTERRLR*GSREC*ESCTQPP 869 + R +GR+ GR G+ RR R GSR C C PP Sbjct: 1043 RSSRRASGRRRRGRRGSGRRGRRGSRTCPAPCGSPP 936
>LOC_Os04g02200:12004.t00115:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2913 Score = 33.6 bits (67), Expect(2) = 0.72 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 / -3 Query: 660 WHGCAMDRTSP*DMSTPCLAPCHVH 734 WH C T * + PCL PC H Sbjct: 2743 WHQCRFSDTRT*SLPEPCLLPCFQH 2669 Score = 24.0 bits (46), Expect(2) = 0.72 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +3 / -3 Query: 810 KLSTYHHHNHNRSQPQM*TCGG 875 KL HHH N P+ C G Sbjct: 211 KLEEKHHHRRNGKIPRPHACPG 146
>LOC_Os08g14364:12008.t04300:unspliced-genomic expressed protein| Length = 2127 Score = 35.0 bits (70), Expect = 0.99 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -2 / -2 Query: 983 DGERGEGRHGTAVDRTGRD 927 DG+RG+GRHG A+ R RD Sbjct: 1259 DGDRGDGRHGRALQRQDRD 1203
>LOC_Os05g24684:12005.t02126:unspliced-genomic expressed protein| Length = 7090 Score = 35.0 bits (70), Expect = 0.99 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 / +3 Query: 406 CRVIGVCYNMPVEMAAQWSVPRAWTRYVTHTNH 504 C ++G CY +A + PR W R+V +T+H Sbjct: 1011 CALLGTCYPNGA*VAVYIAPPRLWIRWVLYTSH 1109
>LOC_Os05g06120:12005.t00502:unspliced-genomic ubiquitin-conjugating enzyme family protein| Length = 4008 Score = 35.0 bits (70), Expect = 0.99 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -1 / +2 Query: 1014 TAAIESPANTGWRKGRGTTRDGSGQDGTGQS 922 T A SPA T WR+ R +R G GTG S Sbjct: 596 TQASASPATTSWRRRRSPSRTRGG*GGTGSS 688
>LOC_Os04g10760:12004.t00907:unspliced-genomic hypothetical protein| Length = 972 Score = 28.1 bits (55), Expect(2) = 1.2 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -3 / +1 Query: 793 WLGVNPTCVGWEASSGQGRWW 731 W+G+ P W+ + RWW Sbjct: 847 WMGMEPERRRWKRAESMRRWW 909 Score = 27.2 bits (53), Expect(2) = 1.2 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -2 / +3 Query: 971 GEGRHGTAVDRTGRDRASAEVGITRMLRIVHSASARSHL 855 GEG G A+ R G SA +T +H+ S R H+ Sbjct: 594 GEGGLGMALHRLGHKPRSAAAILTLPELNLHACSGRGHV 710
>LOC_Os01g71430:12001.t06439:unspliced-genomic F-box domain containing protein| Length = 1140 Score = 29.0 bits (57), Expect(2) = 1.5 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 / -1 Query: 917 AEVGITRMLRIVHSASARSHLRLTA 843 AEV ++RM+ +VH A A H ++ A Sbjct: 822 AEVAVSRMVFVVHGADAAHHEQVAA 748 Score = 22.6 bits (43), Expect(2) = 1.5 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -2 / -3 Query: 749 RPRALVDMTRRQTRCRHVSRGGSVHGTTVP 660 RPR TR R R + S+ GTT P Sbjct: 637 RPRGSPCRTRPCGRRRRRTCAASISGTTAP 548
>LOC_Os02g33010:12002.t02944:unspliced-genomic expressed protein| Length = 5635 Score = 26.3 bits (51), Expect(2) = 1.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 / +1 Query: 765 PTHVGLTPSQHKIKPKLSTYHHHNH 839 P H P +H LS YHHH H Sbjct: 52 PPHRRGRPPRHAPFLPLSPYHHHLH 126 Score = 24.9 bits (48), Expect(2) = 1.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 / +3 Query: 905 SLPQPTLCPVPSCPLPSRVVPLP 973 SLP P P P P P R P P Sbjct: 105 SLPPPPPPPPPRRPPPPRPAPAP 173
>LOC_Os08g02000:12008.t00099:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 7012 Score = 34.1 bits (68), Expect = 1.9 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -2 / -3 Query: 191 YKYMLDGEINCGLICVLTSINCCNSWHISG 102 Y +L+G +C +IC + S+ SWHI+G Sbjct: 2462 YDTILEGARSCKMICSMLSLQVRCSWHITG 2373
>LOC_Os01g50090:12001.t04446:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 3114 Score = 26.7 bits (52), Expect(2) = 1.9 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 / -3 Query: 908 LPQPTLCPVPSCPLPSRVVPLPFRHP 985 LP T PVP P P +PLP P Sbjct: 2575 LPLATSAPVPDHPTPLLRLPLPSPPP 2498 Score = 24.4 bits (47), Expect(2) = 1.9 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +3 / -1 Query: 747 PDDASHPTHVGLTPSQHKIKPKLSTYHHHNH 839 P ++H + + PS+ P+LS + H+H Sbjct: 2733 PQGSTHGEYSSVAPSRLIRLPRLSRHIRHHH 2641
>LOC_Os08g16420:12008.t01515:unspliced-genomic hypothetical protein| Length = 2929 Score = 30.4 bits (60), Expect(2) = 2.4 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 / -1 Query: 917 PTLCPVPSCPLPSRVVPLPFRH 982 P +C +P P +PLP+RH Sbjct: 610 PAVCSIPPLLHPPATIPLPYRH 545 Score = 25.4 bits (49), Expect(2) = 2.4 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +3 / -1 Query: 324 CCWPPF 341 CCWPPF Sbjct: 1750 CCWPPF 1733
>LOC_Os03g37670:12003.t03219:unspliced-genomic DNA binding protein, putative| Length = 3551 Score = 26.3 bits (51), Expect(2) = 2.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 / +1 Query: 731 PPTPLAG*RFPSNACGVDTKPTQN 802 PP PL PS CGV +P N Sbjct: 2779 PPLPLLTFSSPSLGCGVPRQPPPN 2850 Score = 24.4 bits (47), Expect(2) = 2.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 / +2 Query: 908 LPQPTLCPVPSCPLPSRVVPLPFRHP 985 LP P L +P+ PLP + F P Sbjct: 2843 LPTPELAGIPTSPLPPLGAVVVFPSP 2920
>LOC_Os04g14580:12004.t01277:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 10225 Score = 33.6 bits (67), Expect = 2.6 Identities = 19/54 (35%), Positives = 25/54 (46%) Frame = -3 / -2 Query: 1072 VCLRVCMCSLLVAIVLSLPNGSYRVSCEHGMAKGERDDTGRQWTGRDGTERRLR 911 VC+R ++VA++ + V HG G R G G DGTER LR Sbjct: 312 VCIRDSDVRIMVALMKGTFTWVHNVIRTHGPLMGHRAIVGLTVPGVDGTERLLR 151
>LOC_Os12g06870:12012.t00572:unspliced-genomic nucleoporin autopeptidase family protein, expressed| Length = 6281 Score = 33.6 bits (67), Expect = 2.6 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -1 / +2 Query: 516 LVLVMVRVCDISCPCTRHAPLGSHLHRHIVTH 421 LVLV+ C I P +H +HLH+ VTH Sbjct: 3431 LVLVLFHPCSIQYPVIQHQQAQAHLHQL*VTH 3526
>LOC_Os07g49114:12007.t04700:unspliced-genomic wound-induced protein WI12 containing protein, expressed| Length = 877 Score = 33.6 bits (67), Expect = 2.6 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -1 / -3 Query: 984 GWRKGRGTTRDGSGQDGTGQSVG*GR 907 GWR G GTT G G+ G + G GR Sbjct: 299 GWRVGHGTTTRGPGRGGRARRCGLGR 222
>LOC_Os02g44010:12002.t03986:unspliced-genomic expressed protein| Length = 3461 Score = 29.9 bits (59), Expect(2) = 2.7 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +1 / -1 Query: 589 WYDMSGGECQSLLLMSREVTVDANGTVVPWTEPPRETCLHRVWRRVMSTN 738 W D++ G + L+ ++VD G+ W PR TC + R S+N Sbjct: 3365 WCDLT*GWWVLVDLLLDILSVDGEGSFRDWA*QPRSTCCCKAATRRASSN 3216 Score = 25.8 bits (50), Expect(2) = 2.7 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 / -3 Query: 780 LTPSQHKIKPKLSTYHHHN 836 +TPS H+ K + S +HH + Sbjct: 2688 MTPSLHQCKGRASLHHHQS 2632
>LOC_Os05g43650:12005.t03855:unspliced-genomic expressed protein| Length = 3312 Score = 26.3 bits (51), Expect(2) = 3.4 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 / +2 Query: 944 PLPSRVVPLPFRHP 985 PLP+R VP P HP Sbjct: 275 PLPARAVPQPPHHP 316 Score = 24.0 bits (46), Expect(2) = 3.4 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = +3 / +2 Query: 810 KLSTYHHHNHNRSQPQM*TC 869 +L HHH H+R + C Sbjct: 185 RLGVLHHHRHHRDDERTRRC 244
>LOC_Os12g41770:12012.t03853:unspliced-genomic hypothetical protein| Length = 402 Score = 33.1 bits (66), Expect = 3.5 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +2 / +1 Query: 911 PQPTLCPVPSCPLPSRVVPLP 973 P+P L PVP CPLPS + P Sbjct: 79 PRPLLIPVPYCPLPSPSLSTP 141
>LOC_Os10g11240:12010.t00925:unspliced-genomic hypothetical protein| Length = 3064 Score = 33.1 bits (66), Expect = 3.5 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +2 / +3 Query: 875 LSARFSTFA*SLPQPTLCPVPSCPLPSRVVPLPFR 979 +S+ FS LP P C V P+PS PLP R Sbjct: 189 ISSSFSLPHRELPLPLRCSVSVLPVPSPAAPLPLR 293
>LOC_Os06g49690:12006.t04653:unspliced-genomic expressed protein| Length = 799 Score = 33.1 bits (66), Expect = 3.5 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 / -2 Query: 914 QPTLCPVPSCPLPSRVVPLPFRHP 985 +P+LCP+ CPLP P HP Sbjct: 612 RPSLCPLSHCPLPRSPAAAPRGHP 541
>LOC_Os07g42280:12007.t03882:unspliced-genomic von Willebrand factor type A domain containing protein, expressed| Length = 7302 Score = 33.1 bits (66), Expect = 3.5 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -1 / +2 Query: 735 GGHDTAPNTV*TCLTGRFCPWHNRAISIDSHF 640 GG TA T + CPW R ISI SHF Sbjct: 350 GGGCTASPAAATATSASSCPWATR*ISIGSHF 445
>LOC_Os03g05850:12003.t00456:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4301 Score = 33.1 bits (66), Expect = 3.5 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 / +3 Query: 676 WTEPPRETCLHRVWRRVMSTNALGRMTLPIQRMWG*HQAN 795 W P R R WRR +A GR+ + R W * +++ Sbjct: 738 WARPGRSRSRQRPWRRRTRRDAAGRLRCRLWRRWP*QESH 857
>LOC_Os01g27630:12001.t02464:unspliced-genomic glutathione S-transferase GSTF2, putative, expressed| Length = 1305 Score = 28.1 bits (55), Expect(2) = 3.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 / +3 Query: 318 RTCCWPPFICLISIS 362 RT CWPP + L S+S Sbjct: 1026 RTTCWPPLMLLCSMS 1070 Score = 22.1 bits (42), Expect(2) = 3.6 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +3 / +1 Query: 417 WRVLQYACGDGCPVERASCMDK 482 W V Q C +G + +C++K Sbjct: 1096 WHVGQAVCQEGHRDDEGNCLEK 1161
>LOC_Os01g13030:12001.t01168:unspliced-genomic OsIAA3 - Auxin-responsive Aux/IAA gene family member, expressed| Length = 4869 Score = 25.4 bits (49), Expect(2) = 4.4 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +3 / -3 Query: 789 SQHKIKPKLSTYHHHNHNRSQPQM 860 S H + + S +HHH+H+ + M Sbjct: 637 SNHTDQQQGSIHHHHHHHHQEHDM 566 Score = 24.4 bits (47), Expect(2) = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 / -2 Query: 911 PQPTLCPVPSCPLPSR 958 PQP P PS P PSR Sbjct: 464 PQPPPPPPPSPPCPSR 417
>LOC_Os02g11130:12002.t00961:unspliced-genomic cytokinin-O-glucosyltransferase 3, putative, expressed| Length = 1640 Score = 31.8 bits (63), Expect(2) = 4.6 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +3 / +1 Query: 888 SQHSRDPYLSRRSVPSRPVHCRPVSSLSPFAIPCSQETR 1004 S SR P+ + R P R S PF+ PC+ TR Sbjct: 253 SSRSRRPWQACRRTARTPTSSRRTRSSRPFSSPCAPSTR 369 Score = 22.1 bits (42), Expect(2) = 4.6 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +3 / +1 Query: 666 GCAMDRTSP*DMSTPCLAPCHVHQRPW 746 GCA T P S P + +RPW Sbjct: 196 GCAASLTRPRARSCPSRSWSSRSRRPW 276
>LOC_Os12g31540:12012.t02858:unspliced-genomic expressed protein| Length = 3100 Score = 32.7 bits (65), Expect = 4.8 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +2 / -2 Query: 413 SLACVTICLWRWLPSGACLVHG 478 ++ CV++C WRW + A ++HG Sbjct: 693 TIICVSVCTWRWDRAPAYVLHG 628
>LOC_Os11g30000:12011.t02604:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 9144 Score = 32.7 bits (65), Expect = 4.8 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 / -3 Query: 741 PWPDDASHPTHVGLTPSQHKIKPKLSTYHHHNHN 842 P P HP H+G P Q + +P+L HN N Sbjct: 667 PGPPTVGHPGHIGPAPPQAQPEPQL*VLGLHNPN 566
>LOC_Os06g23880:12006.t02200:unspliced-genomic hypothetical protein| Length = 2335 Score = 32.7 bits (65), Expect = 4.8 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 / -1 Query: 741 PWPDDASHPTHVGLTPSQHKIKPKLSTYHHHN 836 P P HP+H+G P Q + +P+L HN Sbjct: 745 PSPQTVGHPSHIGPAPRQAQPEPQL*VLSLHN 650
>LOC_Os06g21590:12006.t01976:unspliced-genomic chlorophyll a-b binding protein 6A, chloroplast precursor,| putative, expressed Length = 1530 Score = 32.7 bits (65), Expect = 4.8 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 / -1 Query: 911 PQPTLCPVPSCPLPSRVVPLP 973 P PT P PSCP P+ P P Sbjct: 663 PPPTPAPAPSCPAPAPPAPTP 601
>LOC_Os04g40930:12004.t03654:unspliced-genomic DNA-binding protein, putative, expressed| Length = 4762 Score = 32.7 bits (65), Expect = 4.8 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 / +1 Query: 908 LPQPTLCPVPSCPLPSRVVPLPFRHPVFAG 997 LP P P PS PSR VPLP P G Sbjct: 13 LPPPLRSPPPSPASPSRTVPLPEPRPARRG 102
>LOC_Os04g11920:12004.t01016:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 2873 Score = 32.7 bits (65), Expect = 4.8 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 / -3 Query: 497 VCVTYLVHARGTLHWAAISTGIL 429 +CVTYLVH RG +W ++ + Sbjct: 1179 LCVTYLVHLRGVENWRLVNANFI 1111
>LOC_Os03g07180:12003.t00584:unspliced-genomic embryonic protein DC-8, putative, expressed| Length = 2105 Score = 32.7 bits (65), Expect = 4.8 Identities = 17/62 (27%), Positives = 27/62 (43%) Frame = +2 / -1 Query: 911 PQPTLCPVPSCPLPSRVVPLPFRHPVFAGDSIAAVGQAEDYRDEQGTHTNTQTNSCIQNK 1090 P P+ P+P+ P +R P P P S ++ R THT+T T+ I + Sbjct: 611 PPPSSSPLPAQPCSTRPTPSPPPPPSRPRPSCSSASLPLHSRAHTHTHTHTHTHMLISSN 432 Query: 1091 KK 1096 + Sbjct: 431 TR 426
>LOC_Os01g60080:12001.t05392:unspliced-genomic L-ascorbate oxidase homolog precursor, putative, expressed| Length = 2663 Score = 32.7 bits (65), Expect = 4.8 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -3 / -1 Query: 973 GERDDTGRQWTGRDGTERRLR*GSREC*ESCTQPP 869 G R +GR+ GR T R R SR C C PP Sbjct: 1127 GSRRASGRR*RGRRRTGRHARPASRSCSARCASPP 1023
>LOC_Os07g23480:12007.t02046:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 10385 Score = 32.7 bits (65), Expect = 4.9 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -1 / -3 Query: 681 CPWHNRAISIDSHFAAH*QQRLTLTTRHIIP 589 C W +R IS+ S + H Q L T HIIP Sbjct: 1932 CNWSSRVISLGSQGSRHIQTDRPLPTLHIIP 1840
>LOC_Os03g36700:12003.t03138:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3505 Score = 32.7 bits (65), Expect = 4.9 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +1 / +3 Query: 670 VPWTEPPRETCLHRVWRRVMSTNALGRMTLPIQRMW 777 V W T R+WRRV +T R T P R W Sbjct: 3342 VGWQWRRMRTTTRRLWRRVRTTTRRRRRTAPRSRSW 3449
>LOC_Os03g06580:12003.t00525:unspliced-genomic neurogenic locus notch protein homolog precursor, putative,| expressed Length = 2648 Score = 32.7 bits (65), Expect = 4.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 / +2 Query: 981 WRKGRGTTRDGSGQDGTGQSVG*GRDHANVENRALS 874 WR GRGT R G GTG S G R S Sbjct: 416 WRAGRGTARRRRGSRGTGASASLGGSRCTSATRPAS 523
>LOC_Os02g16420:12002.t01435:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4030 Score = 32.7 bits (65), Expect = 4.9 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 / +1 Query: 996 PANTGWRKGRGTTRDGSGQDGT 931 P N WR+GRG D G DGT Sbjct: 574 PTNRRWRRGRGGGCDAGGGDGT 639
>LOC_Os02g16360:12002.t01429:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3900 Score = 32.7 bits (65), Expect = 4.9 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 / +1 Query: 996 PANTGWRKGRGTTRDGSGQDGT 931 P N WR+GRG D G DGT Sbjct: 634 PTNRRWRRGRGGGCDAGGGDGT 699
>LOC_Os01g52000:12001.t04628:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4302 Score = 32.7 bits (65), Expect = 4.9 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 / +3 Query: 676 WTEPPRETCLHRVWRRVMSTNALGRMTLPIQRMWG*HQAN 795 W P R R WRR +A GR+ + R W * +++ Sbjct: 738 WARPGRSRSRQRPWRRRTRWDAAGRLRCRLWRRWP*QESH 857
>LOC_Os07g12510:12007.t01122:unspliced-genomic membrane protein, putative, expressed| Length = 1207 Score = 26.3 bits (51), Expect(2) = 4.9 Identities = 7/21 (33%), Positives = 14/21 (66%) Frame = +3 / +2 Query: 789 SQHKIKPKLSTYHHHNHNRSQ 851 ++ + + + S YHHH+H S+ Sbjct: 515 TRRRCRRRRSRYHHHHHRHSR 577 Score = 23.5 bits (45), Expect(2) = 4.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 / +1 Query: 908 LPQPTLCPVPSCPLPSRVVPLPFRHPVFA 994 LP+ P+P LP + PLP P A Sbjct: 580 LPEKENTPLPPLLLPPKKKPLPPPSPTAA 666
>LOC_Os03g30290:12003.t02641:unspliced-genomic expressed protein| Length = 2893 Score = 28.6 bits (56), Expect(2) = 5.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 / +2 Query: 971 PFRHPVFAGDSIAAVGQAE 1027 PFRHPV G VG+A+ Sbjct: 2597 PFRHPVLQGPVAGVVGEAD 2653 Score = 25.8 bits (50), Expect(2) = 5.6 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 / +1 Query: 711 CLAPCHVHQRPWPDDAS 761 C APC +R WP A+ Sbjct: 1990 CCAPCSPRRRSWPRPAT 2040
>LOC_Os08g09110:12008.t00797:unspliced-genomic NB-ARC domain containing protein, expressed| Length = 4652 Score = 24.9 bits (48), Expect(2) = 5.9 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 / +1 Query: 661 GTVVPWTEPPRET 699 G V PW PP ET Sbjct: 3883 GRVAPWNPPPPET 3921 Score = 24.4 bits (47), Expect(2) = 5.9 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +3 / +1 Query: 807 PKLSTYHHHNHNRSQPQM 860 P L +HHH+H+ P + Sbjct: 3943 PPLQGHHHHHHHYLLPNL 3996
>LOC_Os05g18970:12005.t01664:unspliced-genomic hypothetical protein| Length = 2576 Score = 25.4 bits (49), Expect(2) = 6.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 / -3 Query: 897 SRDPYLSRRSVPSRPVHCR 953 SR P S PSR +HCR Sbjct: 369 SRPPLRSSNPPPSRHLHCR 313 Score = 24.0 bits (46), Expect(2) = 6.2 Identities = 9/31 (29%), Positives = 13/31 (41%) Frame = +3 / -2 Query: 747 PDDASHPTHVGLTPSQHKIKPKLSTYHHHNH 839 P A P H G + P ++ HH+H Sbjct: 484 PRKAKPPPHAGAHQPRATAAPVVAAPRHHHH 392
>LOC_Os08g24946:12008.t02265:unspliced-genomic expressed protein| Length = 5803 Score = 32.2 bits (64), Expect = 6.6 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 / -1 Query: 768 THVGLTPSQHKIKPKLSTYHHHN 836 TH GL P +HK P+L H+ N Sbjct: 1096 THFGLNPMEHKNSPELQVAHNKN 1028
>LOC_Os07g15490:12007.t01412:unspliced-genomic TD and POZ domain-containing protein 1, putative, expressed| Length = 3729 Score = 32.2 bits (64), Expect = 6.6 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 / +3 Query: 911 PQPTLCPVPSCPLPSRVVPLPFRHP 985 P P P P P P R++PLP R P Sbjct: 231 PLPPPLPPPPFPFPRRLLPLPLRPP 305
>LOC_Os05g41450:12005.t03683:unspliced-genomic dr1-associated corepressor, putative, expressed| Length = 4893 Score = 32.2 bits (64), Expect = 6.6 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 / -1 Query: 647 LSMLMARLCHGQNLPVRHVYTVFGAVSCPPTP 742 L +L+ G NLP+RH T + PPTP Sbjct: 3864 LMVLLKFFVSGNNLPLRHTPTTSASSPTPPTP 3769
>LOC_Os05g33700:12005.t02965:unspliced-genomic 4F5 protein family protein| Length = 4343 Score = 32.2 bits (64), Expect = 6.6 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 / +2 Query: 738 RPWPDDASHPTHVGLTPSQHKIKPKLSTYHHHN 836 +P P HP H+G P Q + +P+L HN Sbjct: 2558 QPGPSTMGHPGHIGPAPPQAQPEPQL*VLRLHN 2656
>LOC_Os05g27080:12005.t02360:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 10053 Score = 32.2 bits (64), Expect = 6.6 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +2 / -2 Query: 407 VVSLACVTICLWRWLPSGACLV 472 V+S+ +TI +W W GACL+ Sbjct: 1049 VISICIITIRIWLWARKGACLL 984
>LOC_Os03g40720:12003.t03495:unspliced-genomic UDP-glucose 6-dehydrogenase, putative, expressed| Length = 15801 Score = 32.2 bits (64), Expect = 6.6 Identities = 17/58 (29%), Positives = 23/58 (39%) Frame = +3 / +3 Query: 639 RSDCRC*WHGCAMDRTSP*DMSTPCLAPCHVHQRPWPDDASHPTHVGLTPSQHKIKPK 812 RS R W G A T+ + P H H RPWP + P+ H +P+ Sbjct: 6516 RSA*RQIWGGPAASATAEAHLDATRPQPGHPHHRPWPSRDAVVPKDSARPAPHHRRPR 6689
>LOC_Os02g42180:12002.t03805:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4826 Score = 32.2 bits (64), Expect = 6.6 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -2 / +1 Query: 164 NCGLICVLTSINCCNSWHISG*GSMSAVTQLW 69 +CG +C+L N N W + G TQLW Sbjct: 4000 SCGALCMLALRNGLNGWLLRNFGITPLCTQLW 4095
>LOC_Os02g21260:12002.t01916:unspliced-genomic ubiquitin-protein ligase, putative, expressed| Length = 4736 Score = 32.2 bits (64), Expect = 6.6 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 / -1 Query: 756 ASHPTHVGLTPSQHKIKPKLSTYHHHNHNRSQ 851 A THVG P + + ++ +HHHN +++ Sbjct: 4601 ARRTTHVGWKPVRGSLSADINIFHHHNRTQTK 4506
>LOC_Os07g03530:12007.t00243:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3275 Score = 32.2 bits (64), Expect = 6.7 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -1 / -3 Query: 975 KGRGTTRDGSGQDGTGQSVG*GRDHA 898 +GRGT DG+G DG G G G D A Sbjct: 1746 RGRGTGGDGAGGDGAGGDGGAGGDGA 1669
>LOC_Os06g46250:12006.t04311:unspliced-genomic expressed protein| Length = 2354 Score = 32.2 bits (64), Expect = 6.7 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 / +2 Query: 616 QSLLLMSREVTVDANGTVVPWTEPPRETCL 705 + +LL+ +TVDA +PW P R TCL Sbjct: 665 RDILLLVALLTVDALSRRLPWPPPSRVTCL 754
>LOC_Os11g41260:12011.t03663:unspliced-genomic snRNP protein, putative| Length = 3127 Score = 26.7 bits (52), Expect(2) = 8.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 / +1 Query: 983 DGERGEGRHGTAVDRTGRDRASAE 912 DG HG AVDR GR S E Sbjct: 1726 DGLARRASHGAAVDRGGRQIPSGE 1797 Score = 22.1 bits (42), Expect(2) = 8.2 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -1 / +1 Query: 1017 PTAAIESPANTGWRKGR 967 P A ++ A WR+GR Sbjct: 1591 PVAGVQGRALWSWRRGR 1641
>LOC_Os09g04850:12009.t00381:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2693 Score = 25.8 bits (50), Expect(2) = 8.3 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 / -2 Query: 903 DPYLSRRSVPSRPVHCRPVSSLSPFAIPC 989 +P+LSRR + P R S SP + PC Sbjct: 436 NPHLSRRG*LNNPAVSRDRVSASPPSAPC 350 Score = 23.1 bits (44), Expect(2) = 8.3 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = +3 / -2 Query: 825 HHHNHNRSQPQ 857 HHH H + PQ Sbjct: 598 HHHRHTHTPPQ 566
>LOC_Os10g39680:12010.t03209:unspliced-genomic acidic endochitinase Q precursor, putative, expressed| Length = 1912 Score = 26.7 bits (52), Expect(2) = 8.5 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = +3 / +1 Query: 762 HPTHVGLTPSQHKIKPKLSTYHHHNHNR 845 HP V H+ +P+ + HH H++ Sbjct: 1429 HPRPVDAVGGGHRRRPRPRVWRHHQHHQ 1512 Score = 22.1 bits (42), Expect(2) = 8.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 / +3 Query: 728 CPPTPLAG*RFPSNA 772 CPPTP + R PS + Sbjct: 1344 CPPTPWSPSRRPSGS 1388
>LOC_Os05g08460:12005.t00725:unspliced-genomic F-box domain containing protein, expressed| Length = 1485 Score = 26.3 bits (51), Expect(2) = 8.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 / +1 Query: 670 VPWTEPPRETCLHRVWRRVMS 732 VP+ R C+ R WRRV+S Sbjct: 97 VPYKSLCRSKCVSRRWRRVIS 159 Score = 22.6 bits (43), Expect(2) = 8.7 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +3 / +1 Query: 738 RPWPDDASHPTHVGLTPSQH 797 R W SHP H L P H Sbjct: 136 RRWRRVISHPDHRHLLPRYH 195
>LOC_Os05g05930:12005.t00483:unspliced-genomic peripheral-type benzodiazepine receptor, putative, expressed| Length = 829 Score = 24.9 bits (48), Expect(2) = 9.1 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 / +3 Query: 1000 VSCEHGMAKGERDDTGRQWTGRDGTERRLR*GSREC 893 + EH + G R R+ GRD + RR R R C Sbjct: 63 IGSEHSSSHGLRRRRRRRRAGRDHSPRRERGWRRCC 170 Score = 24.0 bits (46), Expect(2) = 9.1 Identities = 6/12 (50%), Positives = 6/12 (50%) Frame = -3 / +3 Query: 766 GWEASSGQGRWW 731 GW G G WW Sbjct: 153 GWRRCCGDGGWW 188
>LOC_Os02g30490:12002.t02742:unspliced-genomic retrotransposon, putative, centromere-specific| Length = 819 Score = 25.8 bits (50), Expect(2) = 9.1 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +3 / -1 Query: 759 SHPTHVGLTPSQHKIKPKLSTYHHHNHNRSQPQ 857 +HP H ++P + T H+H R QP+ Sbjct: 648 AHPVHRSISPPHIRNAAATFTISLHHHCRLQPR 550 Score = 23.1 bits (44), Expect(2) = 9.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 / -3 Query: 911 PQPTLCPVPSC 943 P P+L P PSC Sbjct: 517 PSPSLAPQPSC 485
>LOC_Os11g17360:12011.t01514:unspliced-genomic hypothetical protein| Length = 1131 Score = 31.8 bits (63), Expect = 9.1 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -2 / +1 Query: 773 MRWMGSVIRPRALVDMTRRQTRCRHVSRGGSVHGTTVPLASTVTSRLI 630 +RW+ + RP +L + + RQ R RH + TV T RL+ Sbjct: 418 LRWLMTTSRPSSLPESSSRQRRWRHARQPHLFDDETVIYVCPATVRLL 561
>LOC_Os10g14980:12010.t01166:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1970 Score = 31.8 bits (63), Expect = 9.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 / -3 Query: 660 WHGCAMDRTSP*DMSTPCLAPC 725 WH C T * TPCL PC Sbjct: 1926 WHQCRFSDTRI*SSPTPCLLPC 1861
>LOC_Os09g09890:12009.t00781:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 1113 Score = 31.8 bits (63), Expect = 9.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 / -3 Query: 923 LCPVPSCPLPSRVVPLPFRH 982 +C +P P P +PLP+RH Sbjct: 583 VCTIPPLPHPHAAIPLPYRH 524
>LOC_Os07g43240:12007.t03971:unspliced-genomic SKP1-like protein 1B, putative, expressed| Length = 948 Score = 31.8 bits (63), Expect = 9.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 / -2 Query: 911 PQPTLCPVPSCPLPSRVVPLPFRHP 985 P P PSCPLP P P R P Sbjct: 281 PSSPAPPAPSCPLPPSPPPRPLRSP 207
>LOC_Os07g06950:12007.t00574:unspliced-genomic ubiquitin carboxyl-terminal hydrolase 7, putative, expressed| Length = 12788 Score = 31.8 bits (63), Expect = 9.1 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 / +2 Query: 425 VTICLWRWLPSGACLVHGQDM 487 + +C+W WL +CL+ G DM Sbjct: 2405 ICLCIWMWLIQQSCLMGGLDM 2467
>LOC_Os03g29380:12003.t02561:unspliced-genomic conserved hypothetical protein| Length = 1351 Score = 31.8 bits (63), Expect = 9.1 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -3 / -1 Query: 526 CPCPCPCDGSC 494 C CPCPC G C Sbjct: 379 CTCPCPCPGGC 347
>LOC_Os03g10050:12003.t00808:unspliced-genomic serine acetyltransferase 1, putative, expressed| Length = 1384 Score = 31.8 bits (63), Expect = 9.1 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 / -3 Query: 911 PQPTLCPVPSCPLPSRVVPLPFRHP 985 P P P P C LPS + P P P Sbjct: 887 PAPIFAPSPMCTLPSTLAPAPISTP 813
>LOC_Os01g38870:12001.t03420:unspliced-genomic hypothetical protein| Length = 2028 Score = 31.8 bits (63), Expect = 9.1 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 / -2 Query: 869 RRLSARFSTFA*SLPQPTLCPVPSCPLPSRVV 964 RR S + A S T+CP +CPLP RV+ Sbjct: 554 RRASWSSAPTATSTRSTTVCPTAACPLPRRVL 459
>LOC_Os07g05430:12007.t00426:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4302 Score = 31.8 bits (63), Expect = 9.2 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 / +3 Query: 676 WTEPPRETCLHRVWRRVMSTNALGRMTLPIQRMWG*HQAN 795 W P R R WRR +A GR+ + R W * +++ Sbjct: 738 WAWPGRSRSRQRPWRRRTRRDAAGRLRCRLWRRWP*QESH 857
>LOC_Os05g21090:12005.t01870:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2690 Score = 31.8 bits (63), Expect = 9.2 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -1 / -1 Query: 1017 PTAAIESPANTGWRKGRGTTRDGSGQDGTGQSVG 916 PTAA +P + GWR DG G G G + G Sbjct: 539 PTAAPRAPFDGGWRHPNLCREDGGGGAGEGANDG 438
>LOC_Os03g56990:12003.t04968:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4122 Score = 31.8 bits (63), Expect = 9.2 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -1 / +1 Query: 975 KGRGTTRDGSGQDGTGQSVG*GRDHANVENR 883 +GRGT R G G G G G G +NR Sbjct: 718 RGRGTGRGGGGSGGRGGGHGRGNGRGGTDNR 810
>LOC_Os06g29450:12006.t02649:unspliced-genomic expressed protein| Length = 1362 Score = 30.9 bits (61), Expect(2) = 9.5 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -3 / +2 Query: 529 VCPCPCPC 506 VCPCPCPC Sbjct: 527 VCPCPCPC 550 Score = 21.7 bits (41), Expect(2) = 9.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 / +1 Query: 473 ARGTLHWAAISTGIL 429 ARGT+ W + GIL Sbjct: 643 ARGTIGWVDLWRGIL 687 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 413,325,977 Number of extensions: 6036357 Number of successful extensions: 38351 Number of sequences better than 10.0: 79 Length of query: 367 Length of database: 55,613,886 Length adjustment: 50 Effective length of query: 317 Effective length of database: 52,799,986 Effective search space: 16737595562 Effective search space used: 16737595562 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
