| Clone Name | FLbaf20l18 |
|---|---|
| Clone Library Name | barley_pub |
>O13315:GPA1_MAGGR Guanine nucleotide-binding protein subunit alpha - Magnaporthe| grisea (Rice blast fungus) (Pyricularia grisea) Length = 353 Score = 33.5 bits (75), Expect = 0.87 Identities = 23/62 (37%), Positives = 33/62 (53%) Frame = +1 Query: 13 NTRPAYRLIITAASLLLLPVSHTHGEHNIATIFMHQPASVGGVVHVGRREQLGDALCKLR 192 NT + R+I+ A L LP+ E+++ TIFM QPA + G V +AL K R Sbjct: 76 NTVQSMRVILEAMESLELPLEDQRMEYHVQTIFM-QPAQIEGDVLPPEVGNAIEALWKDR 134 Query: 193 GI 198 G+ Sbjct: 135 GV 136
>Q00580:GPA1_CRYPA Guanine nucleotide-binding protein subunit alpha - Cryphonectria| parasitica (Chesnut blight fungus) (Endothia parasitica) Length = 353 Score = 33.5 bits (75), Expect = 0.87 Identities = 23/62 (37%), Positives = 33/62 (53%) Frame = +1 Query: 13 NTRPAYRLIITAASLLLLPVSHTHGEHNIATIFMHQPASVGGVVHVGRREQLGDALCKLR 192 NT + R+I+ A L LP+ E+++ TIFM QPA + G V +AL K R Sbjct: 76 NTVQSMRVILEAMESLELPLEDQRMEYHVQTIFM-QPAQIEGDVLPPEVGSAIEALWKDR 134 Query: 193 GI 198 G+ Sbjct: 135 GV 136
>O42784:GPA1_COLTR Guanine nucleotide-binding protein subunit alpha - Colletotrichum| trifolii Length = 353 Score = 32.3 bits (72), Expect = 1.9 Identities = 22/62 (35%), Positives = 33/62 (53%) Frame = +1 Query: 13 NTRPAYRLIITAASLLLLPVSHTHGEHNIATIFMHQPASVGGVVHVGRREQLGDALCKLR 192 NT + R+I+ A L LP+ E+++ TIFM QPA + G V +A+ K R Sbjct: 76 NTVQSMRVILEAMESLELPLEDQRMEYHVQTIFM-QPAQIEGDVLPPEVGSAIEAVWKDR 134 Query: 193 GI 198 G+ Sbjct: 135 GV 136
>Q9VH70:TOPI_DROME Testis-specific zinc finger protein topi - Drosophila melanogaster| (Fruit fly) Length = 814 Score = 32.0 bits (71), Expect = 2.5 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +3 Query: 231 EEKPLKVISPLASLPHLIPWVMAPTPTPSSRRTS 332 E KP++V P PHL+P V AP P P S+ S Sbjct: 157 EAKPIEVAVPQQEKPHLVPTVSAP-PAPLSKPAS 189
>Q9VYQ5:CP318_DROME Probable cytochrome P450 318a1 - Drosophila melanogaster (Fruit| fly) Length = 536 Score = 32.0 bits (71), Expect = 2.5 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 10/46 (21%) Frame = -3 Query: 305 CRSHHPRNQMRKRSQRRNHFQR----------LLLLDDPSPVCCLL 198 C + HP + + K SQ R HFQR LL +DDP+ + C+L Sbjct: 49 CINLHPNSILEKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMECVL 94
>Q00743:GPA1_EMENI Guanine nucleotide-binding protein subunit alpha - Emericella| nidulans (Aspergillus nidulans) Length = 353 Score = 32.0 bits (71), Expect = 2.5 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +1 Query: 13 NTRPAYRLIITAASLLLLPVSHTHGEHNIATIFMHQPASVGG 138 NT + R+I+ A L LP+ E+++ T+FM QPA + G Sbjct: 76 NTVQSMRVILEAMESLELPLEDARNEYHVQTVFM-QPAQIEG 116
>O74227:GPA1_COCHE Guanine nucleotide-binding protein subunit alpha - Cochliobolus| heterostrophus (Drechslera maydis) Length = 353 Score = 32.0 bits (71), Expect = 2.5 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +1 Query: 13 NTRPAYRLIITAASLLLLPVSHTHGEHNIATIFMHQPASVGG 138 NT + R+I+ A L LP+ E+++ TIFM QPA + G Sbjct: 76 NTVQSMRVILEAMESLELPLDDQRAEYHVQTIFM-QPAQIEG 116
>O74259:GPA1_SPOSC Guanine nucleotide-binding protein subunit alpha - Sporothrix| schenckii Length = 353 Score = 31.6 bits (70), Expect = 3.3 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = +1 Query: 13 NTRPAYRLIITAASLLLLPVSHTHGEHNIATIFMHQPASVGGVV 144 NT + R+I+ A L LP+ E+++ TIFM QPA + G V Sbjct: 76 NTVQSMRVILEAMESLELPLEDQRMEYHVQTIFM-QPAQIEGEV 118
>Q05425:GPA1_NEUCR Guanine nucleotide-binding protein alpha-1 subunit - Neurospora| crassa Length = 353 Score = 31.6 bits (70), Expect = 3.3 Identities = 18/44 (40%), Positives = 27/44 (61%) Frame = +1 Query: 13 NTRPAYRLIITAASLLLLPVSHTHGEHNIATIFMHQPASVGGVV 144 NT + R+I+ A L LP++ E+++ TIFM QPA + G V Sbjct: 76 NTVQSMRVILEAMESLELPLADQRVEYHVQTIFM-QPAQIEGDV 118
>Q8TCG5:CPT1C_HUMAN Carnitine O-palmitoyltransferase I, brain isoform - Homo sapiens| (Human) Length = 803 Score = 30.8 bits (68), Expect = 5.6 Identities = 18/50 (36%), Positives = 23/50 (46%) Frame = -3 Query: 293 HPRNQMRKRSQRRNHFQRLLLLDDPSPVCCLLMPRSLQSASPSCSRRPTW 144 H RN + FQR+L DDPSP C P A+ + + R TW Sbjct: 347 HSRNSLLSPRALEQQFQRIL--DDPSPAC----PHEEHLAALTAAPRGTW 390
>Q86UN3:R4RL2_HUMAN Reticulon-4 receptor-like 2 precursor - Homo sapiens (Human)| Length = 420 Score = 30.4 bits (67), Expect = 7.3 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = -3 Query: 233 LLDDPSPVCCLLMPRSLQSASPSCSRRPT-WTTPPTLA 123 LL P+ C LLM +L A+PSC T +++PPT++ Sbjct: 8 LLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVS 45 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 117,294,382 Number of extensions: 2468174 Number of successful extensions: 6658 Number of sequences better than 10.0: 11 Number of HSP's gapped: 6653 Number of HSP's successfully gapped: 11 Length of query: 244 Length of database: 100,686,439 Length adjustment: 110 Effective length of query: 134 Effective length of database: 70,513,989 Effective search space: 9448874526 Effective search space used: 9448874526 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)