| Clone Name | FLbaf15c01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q6CG48:NUDF_YARLI Nuclear distribution protein PAC1 - Yarrowia l... | 31 | 2.3 | 2 | Q91502:SC6A8_TORMA Creatine transporter - Torpedo marmorata (Mar... | 30 | 6.6 | 3 | Q0C9E6:SET9_ASPTN Histone-lysine N-methyltransferase set9 - Aspe... | 29 | 8.7 |
|---|
>Q6CG48:NUDF_YARLI Nuclear distribution protein PAC1 - Yarrowia lipolytica (Candida| lipolytica) Length = 437 Score = 31.2 bits (69), Expect = 2.3 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 6/78 (7%) Frame = +3 Query: 3 ELEKLNKMDKVSAALQEFVVTIESKADPLLPV------TTGVAYQSWDRWFEGPQDLRRC 164 +L+K + VS + + + S+ DPLL + GV R+ D + Sbjct: 325 KLDKTSSYFVVSWSRDKTIRVWSSRGDPLLILRGHDNWVRGVVLHPAGRYLVSVSDDKTM 384 Query: 165 KCWFL*QNGKKVRVTPKH 218 +CW L Q G+ +RV H Sbjct: 385 RCWDLEQGGRCIRVVDAH 402
>Q91502:SC6A8_TORMA Creatine transporter - Torpedo marmorata (Marbled electric ray)| Length = 611 Score = 29.6 bits (65), Expect = 6.6 Identities = 10/37 (27%), Positives = 28/37 (75%) Frame = -2 Query: 233 SSLLLVFWCHSYFLAILSQKPAFASTQILRTFKPPIP 123 +S+++VF+C++Y++ +L+ ++S ++++F P+P Sbjct: 120 ASMVIVFFCNTYYILVLT----WSSFYLVQSFSSPLP 152
>Q0C9E6:SET9_ASPTN Histone-lysine N-methyltransferase set9 - Aspergillus terreus| (strain NIH 2624) Length = 629 Score = 29.3 bits (64), Expect = 8.7 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +3 Query: 99 TTGVAYQSWDRWFEGPQDLRRCKCWFL*QNGKKVR 203 T+ + QS+DRW E R CK WFL N R Sbjct: 499 TSKLLAQSYDRWVE----CRTCKTWFLQHNSYLTR 529 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 83,727,980 Number of extensions: 1634992 Number of successful extensions: 3789 Number of sequences better than 10.0: 3 Number of HSP's gapped: 3788 Number of HSP's successfully gapped: 3 Length of query: 177 Length of database: 100,686,439 Length adjustment: 106 Effective length of query: 71 Effective length of database: 71,611,169 Effective search space: 5084392999 Effective search space used: 5084392999 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)