ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf6l12 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os05g49230:12005.t04356:unspliced-genomic adoMet-dependent rRNA methyltransferase spb1, putative, expressed| Length = 4549 Score = 58.8 bits (122), Expect = 3e-08 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +2 / +3 Query: 8 QRPKKEYVVAKKGVQVRTGKGKVLVDPRM 94 ++P+KEYVVAKKGVQVR GKGK+LVD RM Sbjct: 4161 KKPQKEYVVAKKGVQVRAGKGKILVDKRM 4247 Score = 54.7 bits (113), Expect = 5e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = -3 / -1 Query: 105 LSFFIRGSTSTLPLPVLTWTPFLATTYSFLG 13 LSFFIR STS PLP LT TPF ATTYSF G Sbjct: 4258 LSFFIRLSTSIFPLPALT*TPFFATTYSFWG 4166 Score = 34.1 bits (68), Expect = 0.76 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = +3 / +1 Query: 15 PRRSMWWPRRVSRSGPARARCWWTRG*RRT 104 PRRS RR R G A+ R WW *RRT Sbjct: 4168 PRRSTLSQRRAFR*GLAKGRYWWISV*RRT 4257 Score = 30.4 bits (60), Expect = 9.7 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 / -3 Query: 109 PLVLLHPRVHQHLALAGP 56 PLVLLH +HQ+L A P Sbjct: 4262 PLVLLHTLIHQYLPFASP 4209
>LOC_Os01g05420:12001.t00427:unspliced-genomic IWS1 C-terminus family protein, expressed| Length = 4488 Score = 29.5 bits (58), Expect(3) = 0.055 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 / +3 Query: 366 SKIASCFCYAIYTLLLLELFSAC 434 ++I++C CYAI+ L L L S C Sbjct: 1461 ARISNC*CYAIFNLSLRFLISEC 1529 Score = 26.7 bits (52), Expect(3) = 0.055 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 / +3 Query: 3 RRSGPRRSMWWPRRVSR 53 RR G R +MW PRR+ R Sbjct: 486 RRRGWRMTMWTPRRMPR 536 Score = 22.1 bits (42), Expect(3) = 0.055 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +1 / +1 Query: 28 CGGQEGCPGQDRQGQGAGGPAD 93 CG + GC ++ GA GP + Sbjct: 511 CGPRGGCREEEEGVVGAQGPRE 576
>LOC_Os06g29700:12006.t02674:unspliced-genomic ribosomal RNA apurinic site specific lyase, putative, expressed| Length = 2182 Score = 37.3 bits (75), Expect = 0.083 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +3 / -2 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCW 80 RR G RR W P SR GP+ A CW Sbjct: 201 RRGGRRRRSWSPSSWSRRGPSDAACW 124
>LOC_Os08g40919:12008.t04356:unspliced-genomic expressed protein| Length = 2887 Score = 26.7 bits (52), Expect(2) = 0.19 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +3 / -1 Query: 3 RRSGPRRSMWW 35 RRS PRR+ WW Sbjct: 904 RRSSPRRAPWW 872 Score = 26.7 bits (52), Expect(2) = 0.19 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 / -1 Query: 60 PARARCWW 83 PAR RCWW Sbjct: 817 PARGRCWW 794
>LOC_Os01g14250:12001.t01283:unspliced-genomic hypothetical protein| Length = 1532 Score = 35.9 bits (72), Expect = 0.21 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +3 / -3 Query: 15 PRRSMWWPRRVSRSGPARA 71 PRR +WWPRR+S GP A Sbjct: 1239 PRRRIWWPRRLSA*GPGAA 1183
>LOC_Os02g47210:12002.t04306:unspliced-genomic cationic amino acid transporter, putative, expressed| Length = 3326 Score = 35.4 bits (71), Expect = 0.29 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +3 / +3 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTRG*RRTS 107 RR R S WW + S P R C WT G +T+ Sbjct: 2193 RRCSTRSSSWWSPTCTLSSPGREPCRWTGGSGQTA 2297
>LOC_Os02g08320:12002.t00728:unspliced-genomic ADIPOR-like receptor CG5315, putative, expressed| Length = 1080 Score = 31.3 bits (62), Expect(2) = 0.33 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +1 / +2 Query: 7 AAAQEGVCGGQEGCPGQDRQGQGAGGP 87 A A +GV GG+ PG R G AG P Sbjct: 266 AVAADGVPGGRHDVPGDQRDGAPAGVP 346 Score = 23.5 bits (45), Expect(2) = 0.33 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = +3 / +3 Query: 297 GHVACWIAISL 329 GH AC++A+SL Sbjct: 630 GHAACYLALSL 662
>LOC_Os11g35590:12011.t03106:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 7671 Score = 35.0 bits (70), Expect = 0.40 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 / +2 Query: 303 VACWIAISLLPKVLPVWLARKSKIASCFCYA 395 V C++ +S P+ LPV A K + CFC+A Sbjct: 5447 VICYLRLSFNPEKLPVNAAPKYSVLLCFCFA 5539 Score = 34.1 bits (68), Expect = 0.76 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 / +2 Query: 303 VACWIAISLLPKVLPVWLARKSKIASCFCYA 395 V C++ +S P+ LPV A K + CFC+A Sbjct: 689 VICYLRLSSNPEKLPVNAAPKYSVLLCFCFA 781
>LOC_Os05g07060:12005.t00595:unspliced-genomic fasciclin-like arabinogalactan protein 7 precursor, putative,| expressed Length = 1130 Score = 31.3 bits (62), Expect(2) = 0.46 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 / +1 Query: 384 FCYAIYTLLLLELFSACQKSFVSCYPCNE 470 F ++ + LLE F+ C SF CY CN+ Sbjct: 991 FVLSVSYVDLLEFFTVCCMSFRGCYICNK 1077 Score = 23.1 bits (44), Expect(2) = 0.46 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 / +2 Query: 6 RSGPRRSMWWPRRVSRSGPARARCWWTRG*RR 101 R P S W RR P R R W R RR Sbjct: 692 RRRPAPSAWPTRRRPTRLPGRRRRRWRRRRRR 787
>LOC_Os05g37300:12005.t03273:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3308 Score = 32.2 bits (64), Expect(2) = 0.50 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 / +1 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 RVSR G AR R WW R R T+ Sbjct: 2035 RVSRRGGARWRLWWKRAARHTA 2100 Score = 23.5 bits (45), Expect(2) = 0.50 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 / +2 Query: 3 RRSGPRRSMWWPRRVSRSGPAR 68 RRSGP+RS +++G AR Sbjct: 899 RRSGPQRSRLLRATTAQAGAAR 964
>LOC_Os11g01410:12011.t00041:unspliced-genomic ammonium transporter 2, putative| Length = 981 Score = 34.5 bits (69), Expect = 0.56 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 / -3 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTRG*RR 101 R RR WW R + P +RCW RG RR Sbjct: 832 RSKPKRRCWWWRRCAC*APPPTSRCWRRRGRRR 734 Score = 31.3 bits (62), Expect = 5.1 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 / -3 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTRG*RR 101 RRS P+R WW RR + P W R RR Sbjct: 835 RRSKPKRRCWWWRRCAC*APPPTSRCWRRRGRR 737
>LOC_Os07g02180:12007.t00110:unspliced-genomic 3-5 exonuclease family protein, expressed| Length = 1491 Score = 34.5 bits (69), Expect = 0.56 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +3 / -2 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTR 89 R SG RR + W R +R P R R WW++ Sbjct: 236 RWSGRRRGVHWTPRPTRRRPERRRRWWSQ 150
>LOC_Os06g50890:12006.t04773:unspliced-genomic transformer-2 protein, putative, expressed| Length = 4804 Score = 34.5 bits (69), Expect = 0.56 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 / -2 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCW 80 RR R S WW RR G RAR W Sbjct: 117 RRRRRRSSRWWRRRARAGGEGRARVW 40
>LOC_Os04g12820:12004.t01105:unspliced-genomic expressed protein| Length = 1721 Score = 34.5 bits (69), Expect = 0.56 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 / -2 Query: 9 SGPRRSMWWPRRVSRSGPARARCWWTR 89 + P R MWWPRR R G RC R Sbjct: 1312 AAPARGMWWPRRAPR*GS*YRRCGGAR 1232
>LOC_Os03g64130:12003.t05625:unspliced-genomic expressed protein| Length = 1758 Score = 34.5 bits (69), Expect = 0.56 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 / +3 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTR 89 RR G RRS W R R G R R WW R Sbjct: 1254 RRCGGRRSEAWSSRGRRRGRWRLRRWWCR 1340
>LOC_Os02g10500:12002.t00898:unspliced-genomic expressed protein| Length = 649 Score = 34.5 bits (69), Expect = 0.56 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 / +1 Query: 12 GPRRSMWWPRRVSRSGPARARCWW 83 G ++ WWP R S P AR WW Sbjct: 31 GEQKRAWWPWRAWCSSPTAARRWW 102
>LOC_Os10g07460:12010.t00604:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 7845 Score = 34.1 bits (68), Expect = 0.76 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 / +3 Query: 303 VACWIAISLLPKVLPVWLARKSKIASCFCYA 395 V C++ +S P+ LPV A K + CFC+A Sbjct: 3339 VICYLRLSSNPEKLPVNAAPKYSVLLCFCFA 3431
>LOC_Os02g32590:12002.t02902:unspliced-genomic heat shock factor protein 2, putative, expressed| Length = 3464 Score = 34.1 bits (68), Expect = 0.76 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 / -1 Query: 15 PRRSMWWPRRVSRSGPARARCWWTRG 92 PRR WW GP R WW RG Sbjct: 326 PRRPPWWSEEGRCCGPLWRRRWWWRG 249
>LOC_Os12g06600:12012.t00545:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 1989 Score = 33.6 bits (67), Expect = 1.0 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 / +1 Query: 33 WPRRVSRSGPARARCWW 83 WPR + R PAR R WW Sbjct: 103 WPRALGRGRPARKRLWW 153
>LOC_Os07g32080:12007.t02893:unspliced-genomic transcription initiation factor IIB, putative| Length = 1065 Score = 33.6 bits (67), Expect = 1.0 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 / -3 Query: 3 RRSGPRRSMWWPRRVSRSGPARARC 77 R+ R +WWP+R R G R RC Sbjct: 190 RQERRHRRVWWPQRRRRGGAGRCRC 116
>LOC_Os06g20160:12006.t01833:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3224 Score = 33.6 bits (67), Expect = 1.0 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = +3 / +1 Query: 18 RRSMWWPRRVSRSGPARARCWWTRG*RRTS 107 RRS R SR G AR R WW R RRT+ Sbjct: 1918 RRSSTRRGRASRRGGARWRPWWRRAARRTA 2007
>LOC_Os05g47480:12005.t04184:unspliced-genomic transcription initiation factor IIB, putative, expressed| Length = 1493 Score = 33.6 bits (67), Expect = 1.0 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +3 / -3 Query: 30 WWPRRVSRSGPARARCWWTRG 92 W PRR S + P R R WW RG Sbjct: 561 WAPRRAS*TPPWRGRGWWRRG 499
>LOC_Os03g53710:12003.t04690:unspliced-genomic aldose 1-epimerase family protein, expressed| Length = 1793 Score = 33.6 bits (67), Expect = 1.0 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 / -1 Query: 3 RRSGPRRSMWWPRRVSRSGP 62 RR GPRR+ WWP S P Sbjct: 992 RRRGPRRTPWWPSAARASSP 933
>LOC_Os09g14680:12009.t01258:unspliced-genomic expressed protein| Length = 6744 Score = 33.1 bits (66), Expect = 1.4 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +3 / -3 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWW 83 RR+ R WWPRR G R R +W Sbjct: 199 RRATSARWWWWPRRAMGRGGERRRSFW 119
>LOC_Os07g36400:12007.t03310:unspliced-genomic expressed protein| Length = 3449 Score = 33.1 bits (66), Expect = 1.4 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +3 / -2 Query: 57 GPARARCWWTR 89 GPARARCWW R Sbjct: 289 GPARARCWWRR 257
>LOC_Os06g37000:12006.t03395:unspliced-genomic heterogeneous nuclear ribonucleoprotein A3, putative, expressed| Length = 4840 Score = 33.1 bits (66), Expect = 1.4 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 / -2 Query: 18 RRSMWWPRRVSRSGPARARCWWTRG 92 RR WW R + PA AR W RG Sbjct: 108 RRRKWWRREQTLGSPAAARVWTGRG 34
>LOC_Os06g03590:12006.t00251:unspliced-genomic conserved hypothetical protein| Length = 525 Score = 33.1 bits (66), Expect = 1.4 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 / +3 Query: 6 RSGPRRSMWWPRRVSRSGPARARCWWTRG*RRT 104 RS R WWPRR R R R WW RR+ Sbjct: 63 RSRWPRRPWWPRRR*RRRRGRGRWWWRWRWRRS 161
>LOC_Os01g53210:12001.t04743:unspliced-genomic metal transporter Nramp3, putative| Length = 2153 Score = 33.1 bits (66), Expect = 1.4 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 / +1 Query: 15 PRRSMWWPRRVSRSGPARARCWWTRG 92 P R+ PRRV+R P A CW+ RG Sbjct: 49 PTRATPRPRRVARPVPIAAACWFLRG 126
>LOC_Os01g08690:12001.t00747:unspliced-genomic holocarboxylase synthetase, putative, expressed| Length = 2286 Score = 33.1 bits (66), Expect = 1.4 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 / +1 Query: 33 WPRRVSRSGPARARCWWTRG*R 98 WPRR SRS PA A W+ G R Sbjct: 220 WPRRRSRSAPASAAPWYVLGLR 285
>LOC_Os03g10770:12003.t00878:unspliced-genomic DNA binding protein, putative| Length = 1368 Score = 26.3 bits (51), Expect(2) = 1.6 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 / +2 Query: 9 SGPRRSMWWPRRVS 50 S RRS WWP R S Sbjct: 218 SSCRRSSWWPTRAS 259 Score = 24.0 bits (46), Expect(2) = 1.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 / +3 Query: 57 GPARARCW 80 GPAR RCW Sbjct: 285 GPARRRCW 308
>LOC_Os03g25280:12003.t02219:unspliced-genomic peroxidase 1 precursor, putative, expressed| Length = 1343 Score = 29.0 bits (57), Expect(2) = 1.8 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +3 / -3 Query: 306 ACWIAISLLPKVLPVWLARKSKIASCFC 389 A W + L +LP W R + +CFC Sbjct: 84 ASWPMLPLSSLLLPCWKRRDDRWTACFC 1 Score = 23.5 bits (45), Expect(2) = 1.8 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 / -1 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTRG*R 98 RR G RR R R P+R R W R R Sbjct: 569 RRRGRRRRRCRRTRPRRGRPSRRRPWRRRSPR 474
>LOC_Os01g61350:12001.t05514:unspliced-genomic electron transporter, putative, expressed| Length = 1012 Score = 30.4 bits (60), Expect(2) = 1.8 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +3 / +1 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTRG*RR 101 RR+GPR P R+ P RARC G RR Sbjct: 424 RRAGPRHGPPLPPGARRAPPPRARCHPPSGLRR 522 Score = 21.7 bits (41), Expect(2) = 1.8 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 / +2 Query: 381 CFCYAIYTLLL 413 C CY+ Y LLL Sbjct: 866 CSCYSYYLLLL 898
>LOC_Os08g02750:12008.t00169:unspliced-genomic expressed protein| Length = 1371 Score = 32.7 bits (65), Expect = 2.0 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 / -1 Query: 33 WPRRVSRSGPARARCW 80 WP RSGPAR RCW Sbjct: 867 WPSG*RRSGPARRRCW 820
>LOC_Os06g50950:12006.t04779:unspliced-genomic anther-specific proline-rich protein APG precursor, putative,| expressed Length = 1964 Score = 32.7 bits (65), Expect = 2.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 / -3 Query: 3 RRSGPRRSMWWPRRVSRSGPARARC 77 RR PRR WWP GP R C Sbjct: 1557 RRGRPRR*AWWPSARGGRGPRRPTC 1483
>LOC_Os06g47270:12006.t04413:unspliced-genomic zinc finger, C3HC4 type family protein, expressed| Length = 1451 Score = 32.7 bits (65), Expect = 2.0 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 / +3 Query: 21 RSMWWPRRVSRSGPARARCWWTRG*RRTS 107 RS WW RR G A RC TR RR S Sbjct: 942 RSRWWRRRRRARGTAARRCSTTRQRRRRS 1028
>LOC_Os04g51172:12004.t04594:unspliced-genomic major intrinsic protein, putative, expressed| Length = 7744 Score = 32.7 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +3 / -3 Query: 36 PRRVSRSGPARARCWWTRG*RR 101 P R +RS P R+RC WTR RR Sbjct: 7127 PARSTRSPPCRSRC*WTRRPRR 7062
>LOC_Os04g12960:12004.t01117:unspliced-genomic indole-3-acetate beta-glucosyltransferase, putative, expressed| Length = 2250 Score = 32.7 bits (65), Expect = 2.0 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 / +3 Query: 33 WPRRVSRSGPARARCWWTRG 92 W R +R GPA RC WT G Sbjct: 465 WTRSTARCGPAAFRCRWTTG 524
>LOC_Os01g10590:12001.t00933:unspliced-genomic OsFTL8 - Rice FT-Like8 homogous to Arabidopsis Flowering Locus T| gene, expressed Length = 2760 Score = 32.7 bits (65), Expect = 2.0 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 / +2 Query: 366 SKIASCFCYAIYTLLLLELFSACQKSFVS 452 SK SC Y + L L+LF +C+ SF+S Sbjct: 962 SKFLSCMFYPLLNCL*LQLFLSCKLSFIS 1048
>LOC_Os05g37280:12005.t03271:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3191 Score = 29.9 bits (59), Expect(2) = 2.1 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 / +1 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 RVSR G AR + WW R R T+ Sbjct: 1918 RVSRRGGARWKPWWKRAARHTA 1983 Score = 23.5 bits (45), Expect(2) = 2.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 / +2 Query: 3 RRSGPRRSMWWPRRVSRSGPAR 68 RRSGP+RS +++G AR Sbjct: 899 RRSGPQRSRLLRATTAQAGAAR 964
>LOC_Os06g29130:12006.t02617:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3314 Score = 29.9 bits (59), Expect(2) = 2.2 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 / +1 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 RVSR G R R WW R R T+ Sbjct: 2041 RVSRKGGTRWRPWWKRAARHTA 2106 Score = 23.5 bits (45), Expect(2) = 2.2 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 / +2 Query: 3 RRSGPRRSMWWPRRVSRSGPAR 68 RRSGP+RS +++G AR Sbjct: 899 RRSGPQRSRLLRATTAQAGAAR 964
>LOC_Os07g07220:12007.t00600:unspliced-genomic small nuclear ribonucleoprotein-associated protein B, putative,| expressed Length = 2382 Score = 29.5 bits (58), Expect(2) = 2.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 / +2 Query: 6 RSGPRRSMWWPRRVSRSGPARAR 74 R GPRR PR GPARAR Sbjct: 428 RGGPRRRPRRPRGADAPGPARAR 496 Score = 23.5 bits (45), Expect(2) = 2.2 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 / +2 Query: 387 CYAIYTLLLLELFSACQKSFVSC 455 C+AIYT + L L K ++ C Sbjct: 1475 CFAIYTPMSLTLCCTAAKCYL*C 1543
>LOC_Os03g08970:12003.t00752:unspliced-genomic expressed protein| Length = 1238 Score = 29.5 bits (58), Expect(2) = 2.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 / -3 Query: 3 RRSGPRRSMWWPRRVSRSG 59 RR R S WWPRR R G Sbjct: 351 RRRRRRASWWWPRRRRRGG 295 Score = 22.6 bits (43), Expect(2) = 2.2 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +3 / -3 Query: 69 ARCWWTRG*R 98 +RCWW G R Sbjct: 75 SRCWWQHGSR 46
>LOC_Os10g01880:12010.t00084:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2410 Score = 25.8 bits (50), Expect(3) = 2.3 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 / +2 Query: 34 GQEGCPGQDRQGQGAG 81 G G PG++R G+GAG Sbjct: 1043 GGRGRPGRERGGEGAG 1090 Score = 23.1 bits (44), Expect(3) = 2.3 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +3 / +1 Query: 3 RRSGPRRSMWWPRR 44 RRSG R+M WP R Sbjct: 256 RRSGEIRAMPWPGR 297 Score = 21.7 bits (41), Expect(3) = 2.3 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 / +1 Query: 278 QEAYGCWACRL 310 Q YGC CRL Sbjct: 2110 QHLYGCEGCRL 2142
>LOC_Os07g39900:12007.t03651:unspliced-genomic interferon-related developmental regulator family protein,| expressed Length = 5331 Score = 27.6 bits (54), Expect(2) = 2.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 / +3 Query: 532 FFFFWYCQDLTTITN 488 FFFFW C D I++ Sbjct: 564 FFFFWLCDDFLVISS 608 Score = 26.3 bits (51), Expect(2) = 2.5 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -1 / +2 Query: 359 G*PDRQNFRQQRDSYPTGDMPSIHM 285 G PDRQ R+QR G + SIH+ Sbjct: 644 GRPDRQQRRRQRGLVVDGAVGSIHV 718
>LOC_Os12g38810:12012.t03561:unspliced-genomic expressed protein| Length = 1490 Score = 32.2 bits (64), Expect = 2.7 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 / -2 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTRG*RR 101 R P W PRR +R+ P R R W G RR Sbjct: 844 RSPRPPSRRWRPRRTARASPRRGRWW*GPGGRR 746
>LOC_Os11g37340:12011.t03276:unspliced-genomic F-box domain containing protein| Length = 1197 Score = 32.2 bits (64), Expect = 2.7 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 / -3 Query: 30 WWPRRVSRSGPARARCWWTRG 92 W PRR +R+ P RAR W RG Sbjct: 424 WGPRRRARAPPRRARAWC*RG 362
>LOC_Os11g29400:12011.t02545:unspliced-genomic 6-phosphogluconate dehydrogenase, decarboxylating, putative,| expressed Length = 1892 Score = 32.2 bits (64), Expect = 2.7 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 / -3 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTRG 92 RR R WW RR +R G A RC RG Sbjct: 411 RRGRGRARRWWRRRRARPGRAARRCGAWRG 322
>LOC_Os11g08460:12011.t00737:unspliced-genomic heat shock cognate 70 kDa protein, putative, expressed| Length = 3055 Score = 32.2 bits (64), Expect = 2.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 / +2 Query: 28 CGGQEGCPGQDRQGQGAGGPA 90 CG PG +QG G GGPA Sbjct: 32 CGEMASAPGDGKQGGGGGGPA 94
>LOC_Os08g06420:12008.t00532:unspliced-genomic esterase/lipase/thioesterase, putative, expressed| Length = 5345 Score = 32.2 bits (64), Expect = 2.7 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 / +3 Query: 33 WPRRVSRSGPARARCWWTRG 92 W RR SR P CWWT G Sbjct: 840 WWRRASRGTPPWTCCWWTPG 899
>LOC_Os06g23130:12006.t02125:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2721 Score = 32.2 bits (64), Expect = 2.7 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 / -1 Query: 87 GSTSTLPLPVLTWTPFLATTY 25 GS LPLP TW PFLA Y Sbjct: 951 GSPPLLPLPPSTWFPFLAPHY 889
>LOC_Os05g10260:12005.t00861:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3249 Score = 32.2 bits (64), Expect = 2.7 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +3 / +2 Query: 21 RSMWWPRRVSRSGPARARCWWTRG*RRTS 107 RS RR SR G AR R WW R R T+ Sbjct: 1946 RSSTRRRRASRRGGARWRPWWRRAARHTA 2032
>LOC_Os04g51260:12004.t04603:unspliced-genomic conserved hypothetical protein| Length = 2508 Score = 32.2 bits (64), Expect = 2.7 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +3 / +2 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCW 80 RRS PRR W PR + SG A W Sbjct: 854 RRSCPRRRTWLPRYAAASGRAPENSW 931
>LOC_Os04g29540:12004.t02644:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1366 Score = 32.2 bits (64), Expect = 2.7 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 / +1 Query: 42 RVSRSGPARARCWWTRG 92 R R G A+ RCWW RG Sbjct: 1147 RGDRGGSAKCRCWWRRG 1197
>LOC_Os04g12710:12004.t01095:unspliced-genomic indole-3-acetate beta-glucosyltransferase, putative| Length = 618 Score = 32.2 bits (64), Expect = 2.7 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 / +2 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTRG 92 RR R W R +R GPA RC W G Sbjct: 401 RRRSCRSRARWTRSTARCGPAAFRCRWRTG 490
>LOC_Os03g51220:12003.t04452:unspliced-genomic SWI/SNF-related matrix-associated actin-dependent regulator of| chromatin subfamily C member, putative, expressed Length = 6005 Score = 32.2 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 / +1 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWT 86 RR PRR +WW R S PA W+ Sbjct: 409 RRRPPRRRLWWTRCSRPSDPAAPASMWS 492
>LOC_Os02g43290:12002.t03914:unspliced-genomic protein kinase APK1A, chloroplast precursor, putative, expressed| Length = 1506 Score = 32.2 bits (64), Expect = 2.7 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 / -3 Query: 3 RRSGPRRSMWWPRRVSRSGPAR 68 RRS RRS WWPRR S R Sbjct: 961 RRSCTRRSSWWPRRSGGSAGPR 896
>LOC_Os02g33700:12002.t03011:unspliced-genomic hypothetical protein| Length = 1695 Score = 32.2 bits (64), Expect = 2.7 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 / +3 Query: 33 WPRRVSRSGPARARCWWTR 89 WPRR S G AR RC W R Sbjct: 216 WPRRWSGGGHARPRCSWWR 272
>LOC_Os01g10100:12001.t00885:unspliced-genomic membrane protein, putative, expressed| Length = 2681 Score = 32.2 bits (64), Expect = 2.7 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 / +2 Query: 9 SGPRRSMWWPRRVSRSGP 62 S PRR WWPRR S + P Sbjct: 134 SSPRRCSWWPRRGSATPP 187
>LOC_Os01g70540:12001.t06353:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 5814 Score = 29.0 bits (57), Expect(2) = 3.5 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 / +2 Query: 303 VACWIAISLLPKVLPVWLARKSKIASCFCYA 395 V C++ +S P+ LPV A K + CF +A Sbjct: 1301 VICYLRLSSNPEKLPVNAAPKYSVLLCFYFA 1393 Score = 24.4 bits (47), Expect(2) = 3.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 / +2 Query: 30 WWPRRVSRS 56 WWPRR RS Sbjct: 371 WWPRRAPRS 397
>LOC_Os12g32430:12012.t02941:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2428 Score = 31.8 bits (63), Expect = 3.7 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 / +2 Query: 15 PRRSMWWPRRVSRSGPARAR 74 P R + WPRR+SRS P AR Sbjct: 1427 PARLLLWPRRMSRSCPGAAR 1486
>LOC_Os11g17300:12011.t01508:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 4569 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 / +3 Query: 378 SCFCYAIYTLLLLELFSACQKSFVSCY 458 S FCY I T+LLL F+ F +CY Sbjct: 741 SPFCYCISTVLLLHFFNYFTVCFPACY 821
>LOC_Os09g24760:12009.t02157:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3243 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 / +2 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 R SR G AR R WW R RRT+ Sbjct: 1961 RASRRGGARWRPWWRRAARRTA 2026
>LOC_Os08g31970:12008.t02942:unspliced-genomic expressed protein| Length = 2901 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 / +3 Query: 3 RRSGPRRSMWWPRRVSRSGPARAR 74 RR+ PR W PRRV R G R R Sbjct: 357 RRADPRGRWWRPRRVRRRGAPRRR 428
>LOC_Os08g29520:12008.t02707:unspliced-genomic cytochrome b561, putative, expressed| Length = 4145 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 / +1 Query: 30 WWPRRVSRSGPARARCWWTRG*RRTS 107 W PRR S SGP+ + W RRTS Sbjct: 133 WRPRRPSSSGPSTSAAGWRSPPRRTS 210
>LOC_Os07g39010:12007.t03564:unspliced-genomic expressed protein| Length = 7538 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 / -1 Query: 7 AAAQEGVCGGQEGCPGQDRQGQGAGGPA 90 A+A VCGG EG + R+ GAG P+ Sbjct: 5645 ASAAAAVCGGGEGVWRRGRRSPGAGAPS 5562
>LOC_Os07g28540:12007.t02544:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3396 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 / +2 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 R SR G AR R WW R RRT+ Sbjct: 2114 RASRRGGARWRPWWRRAARRTA 2179
>LOC_Os07g09230:12007.t00798:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3243 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 / +2 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 R SR G AR R WW R RRT+ Sbjct: 1961 RASRRGGARWRPWWRRAARRTA 2026
>LOC_Os06g08460:12006.t00725:unspliced-genomic exo70 exocyst complex subunit family protein, expressed| Length = 1547 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 / +1 Query: 3 RRSGPRRSMWWPRRVSRSGPARARC 77 R P R WPR RSGP R RC Sbjct: 631 RPRAPARC*GWPRPSRRSGPRRRRC 705
>LOC_Os06g05380:12006.t00427:unspliced-genomic OsWRKY73 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 4106 Score = 31.8 bits (63), Expect = 3.7 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +1 / -1 Query: 7 AAAQEGVCGGQEGCPGQDRQGQGAGG 84 AAA EG GG C G+ R G G GG Sbjct: 3395 AAADEGRLGGGVECEGRRRGGGGVGG 3318
>LOC_Os05g50960:12005.t04526:unspliced-genomic polygalacturonase, putative, expressed| Length = 2005 Score = 31.8 bits (63), Expect = 3.7 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +1 / +3 Query: 10 AAQEGVCGGQEGCPGQD 60 AA G+CGG E CP QD Sbjct: 870 AACGGICGGSEHCPSQD 920
>LOC_Os05g42040:12005.t03741:unspliced-genomic cytokinin-O-glucosyltransferase 1, putative, expressed| Length = 2211 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 / -1 Query: 3 RRSGPRRSMWWPRRVSRSGPARARC 77 RR RR WPRR R G R RC Sbjct: 615 RREWARRHPVWPRRGGRRGRCRGRC 541
>LOC_Os05g41730:12005.t03710:unspliced-genomic expressed protein| Length = 585 Score = 31.8 bits (63), Expect = 3.7 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = +3 / +2 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTRG 92 RR PRRS RR R PARAR W+ G Sbjct: 482 RRPRPRRSPSLRRRRPRRPPARARRSWSTG 571
>LOC_Os05g21110:12005.t01872:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3227 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 / +3 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 R SR G AR R WW R RRT+ Sbjct: 1956 RASRRGGARWRPWWRRAARRTA 2021
>LOC_Os05g05500:12005.t00440:unspliced-genomic F-box domain containing protein, expressed| Length = 1800 Score = 31.8 bits (63), Expect = 3.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 / -3 Query: 9 SGPRRSMWWPRRVSRSGPARAR 74 +G RS WW R+ RSGP R R Sbjct: 292 TGAGRSAWWRRQPRRSGPWRRR 227
>LOC_Os05g04290:12005.t00325:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3227 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 / +3 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 R SR G AR R WW R RRT+ Sbjct: 1947 RASRRGGARWRPWWRRAARRTA 2012
>LOC_Os04g46860:12004.t04215:unspliced-genomic scarecrow-like 6, putative, expressed| Length = 2659 Score = 31.8 bits (63), Expect = 3.7 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +3 / +3 Query: 6 RSGPRRSMWWPRRVSRSGPARARCWWTRG 92 R RR R + +G A RCWW+RG Sbjct: 255 RGA*RRCFGRRTRAAAAGAAGGRCWWSRG 341
>LOC_Os04g40470:12004.t03610:unspliced-genomic cytochrome P450 71A9, putative, expressed| Length = 2073 Score = 31.8 bits (63), Expect = 3.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 / -1 Query: 3 RRSGPRRSMWWPRRVSRSGPARARC 77 R S RR WWPR + AR RC Sbjct: 426 RCSSGRRRAWWPRTAPGAPTARGRC 352
>LOC_Os03g36320:12003.t03103:unspliced-genomic hypothetical protein| Length = 414 Score = 31.8 bits (63), Expect = 3.7 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 / +3 Query: 21 RSMWWPRRVSRSGPARARCWWTRG*RR 101 RS W R + + A ARC WTRG RR Sbjct: 111 RSWW*RRH*AEAIEAMARCGWTRGRRR 191
>LOC_Os03g16950:12003.t01476:unspliced-genomic serine/threonine kinase-like protein, putative, expressed| Length = 1237 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 / -2 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTR 89 RR G S WW RR + R RCW +R Sbjct: 384 RRRGRPGSRWWRRRRGIARDRR*RCWLSR 298
>LOC_Os03g06630:12003.t00530:unspliced-genomic heat shock factor protein 1, putative, expressed| Length = 2295 Score = 31.8 bits (63), Expect = 3.7 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 3 RRSGPRRSMWWPRR 44 RRS PRRS WWP R Sbjct: 184 RRS*PRRSTWWPTR 225
>LOC_Os02g52070:12002.t04788:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3137 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 / +1 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 R SR G AR R WW R RRT+ Sbjct: 1966 RASRRGGARWRPWWRRAARRTA 2031
>LOC_Os02g48410:12002.t04425:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3241 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 / +3 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 R SR G AR R WW R RRT+ Sbjct: 1959 RASRRGGARWRPWWRRAARRTA 2024
>LOC_Os02g34270:12002.t03066:unspliced-genomic DNA binding protein, putative, expressed| Length = 1000 Score = 31.8 bits (63), Expect = 3.7 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 / +1 Query: 3 RRSGPRRSMWWPRRVSRSGPA 65 R++ PRR WW RR R+G A Sbjct: 319 RQAWPRRGWWWRRRRQRAGTA 381
>LOC_Os01g56540:12001.t05063:unspliced-genomic histone-lysine N-methyltransferase SUVR3, putative, expressed| Length = 2906 Score = 31.8 bits (63), Expect = 3.7 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 / +1 Query: 10 AAQEGVCGGQEGCPGQDRQGQGAG 81 A +G CGG GCP D + + G Sbjct: 364 ACAQGACGGARGCPCADPEAEAVG 435
>LOC_Os01g27800:12001.t02481:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3543 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 / +2 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 R SR G AR R WW R RRT+ Sbjct: 1961 RASRRGGARWRPWWRRAARRTT 2026
>LOC_Os05g51740:12005.t04599:unspliced-genomic receptor protein kinase CLAVATA1 precursor, putative, expressed| Length = 4758 Score = 24.9 bits (48), Expect(2) = 4.7 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +1 / -1 Query: 49 PGQDRQGQGAGGP 87 PG R+G+G+GGP Sbjct: 861 PGSWRRGRGSGGP 823 Score = 23.5 bits (45), Expect(2) = 4.7 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 / -1 Query: 3 RRSGPRRSMWW 35 RR GPR WW Sbjct: 990 RRPGPRGCSWW 958
>LOC_Os12g42690:12012.t03943:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3552 Score = 31.3 bits (62), Expect = 5.1 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 / +2 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 R SR G AR+R WW R R T+ Sbjct: 1958 RASRRGGARSRPWWRRAARHTA 2023
>LOC_Os12g17490:12012.t01601:unspliced-genomic stripe rust resistance protein Yr10, putative, expressed| Length = 4669 Score = 31.3 bits (62), Expect = 5.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 / +3 Query: 22 GVCGGQEGCPGQDRQGQGAG 81 G CGG+ GC G+ + QG G Sbjct: 165 GQCGGEHGCAGEGLEEQGPG 224
>LOC_Os11g28390:12011.t02452:unspliced-genomic hypothetical protein| Length = 927 Score = 31.3 bits (62), Expect = 5.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 / +2 Query: 33 WPRRVSRSGPARARCWWTR 89 WPR +R P AR WW R Sbjct: 77 WPRTRARRAPPAARRWWAR 133
>LOC_Os11g01890:12011.t00086:unspliced-genomic expressed protein| Length = 2904 Score = 31.3 bits (62), Expect = 5.1 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 / -3 Query: 4 DAAAQEGVCGGQEGCPGQDRQGQGAGG 84 D A QEG GG G G + +G+G GG Sbjct: 190 DIAPQEGQWGGAAGEGGGEEKGRGGGG 110
>LOC_Os10g07998:12010.t00619:unspliced-genomic nodulin protein, N21, putative, expressed| Length = 4135 Score = 31.3 bits (62), Expect = 5.1 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 / +1 Query: 18 RRSMWWPRRVSRSGPARARCWWTRG* 95 RRS WP R ++ A ARCW R * Sbjct: 91 RRSPPWPERSFQTAAAAARCWRRRA* 168
>LOC_Os09g32080:12009.t02825:unspliced-genomic endochitinase A2 precursor, putative, expressed| Length = 1993 Score = 31.3 bits (62), Expect = 5.1 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 / -1 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTRG*RRT 104 RRSG RR+ W RR R WW RT Sbjct: 1300 RRSGRRRARSWWRRTRGGAWRACRSWWASSCPRT 1199
>LOC_Os08g40890:12008.t03819:unspliced-genomic expressed protein| Length = 3193 Score = 31.3 bits (62), Expect = 5.1 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 / -3 Query: 31 GGQEGCPGQDRQGQGAGG 84 GG+ GC G R+G GAGG Sbjct: 575 GGRGGCTGSGRRGGGAGG 522
>LOC_Os07g33250:12007.t03005:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3272 Score = 31.3 bits (62), Expect = 5.1 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 / +1 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 RVSR G AR R WW R R T+ Sbjct: 1999 RVSRRGGARWRPWWKRAARHTA 2064
>LOC_Os07g14120:12007.t01276:unspliced-genomic agmatine coumaroyltransferase, putative| Length = 1433 Score = 31.3 bits (62), Expect = 5.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 / +2 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTRG 92 R G R WWPRR A WTRG Sbjct: 836 RTCGRRSPAWWPRRACPRSGAAWGGGWTRG 925
>LOC_Os06g32800:12006.t02977:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2621 Score = 31.3 bits (62), Expect = 5.1 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 / +1 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 RVSR G AR R WW R R T+ Sbjct: 1348 RVSRRGGARWRPWWKRAARHTA 1413
>LOC_Os06g31760:12006.t02875:unspliced-genomic ligA, putative| Length = 600 Score = 31.3 bits (62), Expect = 5.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 / +1 Query: 4 DAAAQEGVCGGQEGCPGQDRQGQGAGGPAD 93 DAA +EG G +G P + R +G G D Sbjct: 25 DAAEEEGEAGAGDGVPAKPRSSRGGGRRCD 114
>LOC_Os06g31740:12006.t02873:unspliced-genomic ligA, putative| Length = 600 Score = 31.3 bits (62), Expect = 5.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 / +1 Query: 4 DAAAQEGVCGGQEGCPGQDRQGQGAGGPAD 93 DAA +EG G +G P + R +G G D Sbjct: 25 DAAEEEGEAGAGDGVPAKPRSSRGGGRRCD 114
>LOC_Os05g50990:12005.t04529:unspliced-genomic protein binding protein, putative, expressed| Length = 4397 Score = 31.3 bits (62), Expect = 5.1 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 / -3 Query: 369 KIASCFCYAIYTLLLLELFSACQKSFVS 452 ++ SCFCY +Y ++ + S C F+S Sbjct: 4152 QLVSCFCYMVYVHVMKKTNSVCSLLFLS 4069
>LOC_Os05g40860:12005.t03625:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3057 Score = 31.3 bits (62), Expect = 5.1 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 / +3 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 RVSR G AR R WW R R T+ Sbjct: 1776 RVSRRGGARWRPWWRRAARHTA 1841
>LOC_Os05g18970:12005.t01664:unspliced-genomic hypothetical protein| Length = 2576 Score = 31.3 bits (62), Expect = 5.1 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 / +3 Query: 9 SGPRRSMWWPRRVSRSGPARARCWW 83 S R WW R + +G A AR WW Sbjct: 375 SAQRSQWWWWRGAATTGAAVARGWW 449
>LOC_Os04g44780:12004.t04016:unspliced-genomic rare lipoprotein A like double-psi beta-barrel containing protein,| expressed Length = 4610 Score = 31.3 bits (62), Expect = 5.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 / -3 Query: 9 SGPRRSMWWPRRVSRSGPARARCW 80 SGP S PRR ++GPAR W Sbjct: 3936 SGPTASSTSPRRARQAGPARGTTW 3865
>LOC_Os03g15510:12003.t01337:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3254 Score = 31.3 bits (62), Expect = 5.1 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 / +1 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 RVSR G AR R WW R R T+ Sbjct: 1981 RVSRRGGARWRPWWKRAARHTA 2046
>LOC_Os03g01360:12003.t00034:unspliced-genomic expressed protein| Length = 7348 Score = 31.3 bits (62), Expect = 5.1 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 10 AAQEGVCGGQEGCPGQDRQGQGAGGPA 90 A Q G CGGQ C G D + GG A Sbjct: 2699 AGQRGACGGQWRCGGADLGEKSYGGAA 2779
>LOC_Os02g58720:12002.t05442:unspliced-genomic peroxidase 64 precursor, putative, expressed| Length = 1837 Score = 31.3 bits (62), Expect = 5.1 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 / +2 Query: 6 RSGPRRSMWWPRRVSRSGPARARC 77 R+ PRR W RR SR P ARC Sbjct: 629 RAAPRRRRRWRRR*SRPWPKTARC 700
>LOC_Os02g53200:12002.t04899:unspliced-genomic glucan endo-1,3-beta-glucosidase 7 precursor, putative, expressed| Length = 3132 Score = 31.3 bits (62), Expect = 5.1 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 / +2 Query: 3 RRSGPRRSMWWPRRVSRSGPARAR 74 RR PRR + W RR R G RAR Sbjct: 1211 RRVRPRRQLRWRRRQQRQGQRRAR 1282
>LOC_Os02g05860:12002.t00484:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2233 Score = 31.3 bits (62), Expect = 5.1 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 / +3 Query: 18 RRSMWWPRRVSRSGPARARCWWTRG*RRTS 107 RRS R SR G AR R WW R R T+ Sbjct: 1293 RRSSTRRGRASRRGGARWRPWWRRAARHTA 1382
>LOC_Os01g29330:12001.t02623:unspliced-genomic expressed protein| Length = 985 Score = 31.3 bits (62), Expect = 5.1 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 / +1 Query: 30 WWPRRVSRSGPARARCWWTRG*RRTS 107 W RR RS R RCW TR RR S Sbjct: 238 WQARRTWRSCCRRGRCWLTRRCRRPS 315
>LOC_Os01g18800:12001.t01671:unspliced-genomic CBL-interacting serine/threonine-protein kinase 1, putative,| expressed Length = 4730 Score = 31.3 bits (62), Expect = 5.1 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -3 / -2 Query: 78 STLPLPVLTWTPFLATTYSFL 16 STL LP+ TW P TT+S L Sbjct: 3934 STLLLPLWTWNPISVTTFSIL 3872
>LOC_Os01g11210:12001.t00993:unspliced-genomic expressed protein| Length = 1346 Score = 31.3 bits (62), Expect = 5.1 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 / -2 Query: 3 RRSGPRRSMWWPRR 44 RR+ PR S WWPRR Sbjct: 466 RRARPRSSSWWPRR 425
>LOC_Os04g07100:12004.t00585:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3293 Score = 29.0 bits (57), Expect(2) = 5.2 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 / +1 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 RVSR G AR R WW R T+ Sbjct: 2020 RVSRRGDARLRPWWRWAARHTA 2085 Score = 23.1 bits (44), Expect(2) = 5.2 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 / +2 Query: 3 RRSGPRRSMWWPRRVSRSGPAR 68 RRSG RRS ++R+G AR Sbjct: 899 RRSGRRRSGLLEATMARAGAAR 964
>LOC_Os05g11010:12005.t00934:unspliced-genomic NDR1/HIN1-Like protein 2, putative, expressed| Length = 1273 Score = 25.4 bits (49), Expect(2) = 5.5 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +3 / +2 Query: 6 RSGPRRSMWWPRRVSRSGPARARCWWTR 89 RS PRR W P R W TR Sbjct: 86 RSRPRRRQWPTASTRPRSPTHRRQWRTR 169 Score = 25.4 bits (49), Expect(2) = 5.5 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +3 / +1 Query: 381 CFCYAIYTLLLLELFSA 431 CFC+A+ ++LL L +A Sbjct: 298 CFCWALLVVILLALVAA 348
>LOC_Os11g25860:12011.t02202:unspliced-genomic ATP binding protein, putative, expressed| Length = 2889 Score = 28.6 bits (56), Expect(2) = 6.3 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 / -3 Query: 3 RRSGPRRSMWWPRR 44 RRS RR WWPRR Sbjct: 2407 RRSCRRRPWWWPRR 2366 Score = 23.1 bits (44), Expect(2) = 6.3 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +3 / -2 Query: 57 GPARARCWW 83 G R RCWW Sbjct: 41 GGERGRCWW 15
>LOC_Os12g42560:12012.t03930:unspliced-genomic hypothetical protein| Length = 2164 Score = 30.9 bits (61), Expect = 7.0 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +3 / -1 Query: 51 RSGPARARCWWTRG*RR 101 R GP RAR WTRG RR Sbjct: 529 RHGPRRARAGWTRGLRR 479
>LOC_Os12g39080:12012.t03588:unspliced-genomic cationic amino acid transporter, putative, expressed| Length = 1965 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 / +3 Query: 3 RRSGPRRSMWWPRRVSRSGPARARC 77 RR R W R SRS P RARC Sbjct: 843 RRCSARWGSSWARTSSRSSPGRARC 917
>LOC_Os12g01420:12012.t00041:unspliced-genomic ammonium transporter 2, putative| Length = 1377 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 / -3 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTRG*RR 101 R R WW R + P +RCW RG RR Sbjct: 826 RSKPKRGCWWWCRCAC*APPPTSRCWRRRGRRR 728
>LOC_Os11g47870:12011.t04279:unspliced-genomic chitin-inducible gibberellin-responsive protein 2, putative,| expressed Length = 2449 Score = 30.9 bits (61), Expect = 7.0 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 / -3 Query: 3 RRSGPRRSMWWPRRVSRSGPAR 68 RR RRS WW RR+ R G R Sbjct: 335 RRRSRRRSWWWCRRMGRRGFGR 270
>LOC_Os10g39010:12010.t03143:unspliced-genomic ATP binding protein, putative, expressed| Length = 4865 Score = 30.9 bits (61), Expect = 7.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 / -3 Query: 12 GPRRSMWWPRRVSRSGPARARC 77 GP + WW RR R+ ARA C Sbjct: 273 GPAATSWWERRWMRTKGARAMC 208
>LOC_Os10g30600:12010.t02392:unspliced-genomic protein kinase APK1A, chloroplast precursor, putative, expressed| Length = 2869 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 / -1 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 R RSG AR RC W RG R S Sbjct: 1114 RPRRSGEARGRCGWCRGRRSRS 1049
>LOC_Os10g30590:12010.t02391:unspliced-genomic tetratricopeptide-like helical, putative| Length = 5110 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 / +1 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 R RSG AR RC W RG R S Sbjct: 4642 RPRRSGEARGRCGWCRGRRSRS 4707
>LOC_Os09g36560:12009.t03132:unspliced-genomic thaumatin-like protein 1 precursor, putative| Length = 1737 Score = 30.9 bits (61), Expect = 7.0 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = +3 / -1 Query: 6 RSGPRRSMWWPRRVSRSGPARARCWWTRG*RR 101 R+ PRR PRR +RS P R R TR RR Sbjct: 426 RAAPRRRRRTPRRPTRSRPWRTRTCRTRPGRR 331
>LOC_Os09g29670:12009.t02645:unspliced-genomic ATP-binding cassette sub-family G member 2, putative, expressed| Length = 6276 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 / +1 Query: 7 AAAQEGVCGGQEGCPGQDRQGQGAGG 84 AAA+ GG+ G G D G GAGG Sbjct: 1177 AAAERDERGGEAGAGGGDAAGDGAGG 1254
>LOC_Os09g29660:12009.t02644:unspliced-genomic ATP-binding cassette sub-family G member 2, putative, expressed| Length = 5113 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 / +1 Query: 7 AAAQEGVCGGQEGCPGQDRQGQGAGG 84 AAA+ GG+ G G D G GAGG Sbjct: 1036 AAAERDERGGEAGAGGGDAAGDGAGG 1113
>LOC_Os08g27720:12008.t02533:unspliced-genomic pirin-like protein, putative, expressed| Length = 4065 Score = 30.9 bits (61), Expect = 7.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 / +3 Query: 42 RVSRSGPARARCWWTRG 92 R RS P R CWW RG Sbjct: 3591 RGRRSAPRRGSCWWRRG 3641
>LOC_Os07g39590:12007.t03620:unspliced-genomic spotted leaf protein 11, putative, expressed| Length = 3024 Score = 30.9 bits (61), Expect = 7.0 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +3 / +2 Query: 9 SGPRRSMWWPRRVSRSGPARARCWW 83 +G RR WW SR+ A WW Sbjct: 1187 AGRRRRQWWSSPASRASSRAATPWW 1261
>LOC_Os07g30220:12007.t02712:unspliced-genomic expressed protein| Length = 3303 Score = 30.9 bits (61), Expect = 7.0 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 / +1 Query: 7 AAAQEGVCGGQEGCPGQDRQGQGAGGPA 90 A++ VCGG EG + R+ GAG P+ Sbjct: 115 ASSSAAVCGGGEGVWRRGRRSPGAGAPS 198
>LOC_Os05g17110:12005.t01480:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5197 Score = 30.9 bits (61), Expect = 7.0 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +1 / +3 Query: 10 AAQEGVCGGQEGCPGQDRQGQGAG 81 A +EG GG++G PG+ G+GAG Sbjct: 987 AGREGRGGGKKGSPGERGGGKGAG 1058
>LOC_Os05g06600:12005.t00550:unspliced-genomic hypothetical protein| Length = 2405 Score = 30.9 bits (61), Expect = 7.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -3 / -2 Query: 492 QIIVCKSSHYKGSNLQNFSD 433 Q ++CK S KGSN +NFS+ Sbjct: 946 QRLICKKSFCKGSNCENFSN 887
>LOC_Os04g52190:12004.t04695:unspliced-genomic vacuolar sorting receptor 7 precursor, putative, expressed| Length = 4250 Score = 30.9 bits (61), Expect = 7.0 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +3 / +1 Query: 39 RRVSRSGPARARCWW 83 RR +RS PAR CWW Sbjct: 385 RRGTRSSPARRPCWW 429
>LOC_Os04g33680:12004.t03044:unspliced-genomic electron transporter, putative, expressed| Length = 1749 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 / +3 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTRG 92 RR P S W RR + R R WW RG Sbjct: 969 RRKAPTSSGWSGRRSPSTRRRRHRRWWPRG 1058
>LOC_Os04g04740:12004.t00358:unspliced-genomic hypothetical protein| Length = 372 Score = 30.9 bits (61), Expect = 7.0 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 / +2 Query: 9 SGPRRSMWWPRRVSRSGPARARCWWTRG*R 98 S RS W R ++ + A RC W+RG R Sbjct: 134 SSALRSRW*QRHIAEATEAMTRCGWSRGRR 223
>LOC_Os03g45420:12003.t03919:unspliced-genomic ubiquitin-protein ligase, putative, expressed| Length = 3543 Score = 30.9 bits (61), Expect = 7.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 / +2 Query: 22 GVCGGQEGCPGQDRQGQGAGGPAD 93 G GG G PG++ G GAGG D Sbjct: 2423 GAAGGVPGPPGREGGGGGAGGAVD 2494
>LOC_Os03g39240:12003.t03363:unspliced-genomic expressed protein| Length = 998 Score = 30.9 bits (61), Expect = 7.0 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 / +2 Query: 15 PRRSMWWPRRVSRSGPARARCWW 83 PRRS W R+V S P+R R W Sbjct: 164 PRRSRWTGRKVQ*SPPSRRRITW 232
>LOC_Os02g34390:12002.t03078:unspliced-genomic conserved hypothetical protein| Length = 1782 Score = 30.9 bits (61), Expect = 7.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 / +2 Query: 30 WWPRRVSRSGPARARCWW 83 W RR SR PAR CWW Sbjct: 611 WVLRRGSRRRPARRCCWW 664
>LOC_Os01g51170:12001.t04551:unspliced-genomic glycylpeptide N-tetradecanoyltransferase 1, putative, expressed| Length = 1777 Score = 30.9 bits (61), Expect = 7.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 / -2 Query: 33 WPRRVSRSGPARARCWW 83 WPR V RS A A WW Sbjct: 1239 WPRSVHRSSAAAAESWW 1189
>LOC_Os01g34470:12001.t03005:unspliced-genomic hypothetical protein| Length = 1566 Score = 30.9 bits (61), Expect = 7.0 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +3 / -3 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTRG*RRT 104 RRS PRR RR R AR R W TR RT Sbjct: 715 RRSRPRRPRPSRRRPLRRAAARIRAWRTRRWSRT 614
>LOC_Os01g12810:12001.t01147:unspliced-genomic leaf protein, putative, expressed| Length = 3316 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 / -1 Query: 9 SGPRRSMWWPRRVSRSGPARARC 77 SG RR W RR SR P R RC Sbjct: 2530 SGARRRRAWRRRPSRRCPCRRRC 2462
>LOC_Os08g34720:12008.t03212:unspliced-genomic D-3-phosphoglycerate dehydrogenase, chloroplast precursor,| putative, expressed Length = 5115 Score = 26.3 bits (51), Expect(2) = 7.6 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 / +2 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTRG*RR 101 RRS R W R + RCWW R * R Sbjct: 242 RRSRRRGG*RWARGRTGRCGRSRRCWWRRS*AR 340 Score = 25.8 bits (50), Expect(2) = 7.6 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +2 / +1 Query: 374 C*LFLLCYIYVATIRAVFGLSEKFCKLL 457 C + ++ T +FGLS ++CKL+ Sbjct: 892 CSILMVGVANEVTDTTIFGLSHRYCKLI 975
>LOC_Os10g05810:12010.t00455:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 3848 Score = 28.1 bits (55), Expect(2) = 8.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 / +3 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTRG*RR 101 RR RR WW RR R R R W R RR Sbjct: 726 RRQRLRRRRWWRRRGLRRLRWRLRRRWRRRLRR 824 Score = 23.5 bits (45), Expect(2) = 8.0 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +3 / +3 Query: 399 YTLLLLELFSACQKSFVSCYPCNETI 476 +T+ L+ +C+K VS PCN + Sbjct: 3174 HTVHLINQTCSCRKRQVSGKPCNHAL 3251
>LOC_Os07g44800:12007.t04120:unspliced-genomic SWI/SNF-related matrix-associated actin-dependent regulator of| chromatin subfamily A member 3-like 1, putative, expressed Length = 3876 Score = 26.3 bits (51), Expect(3) = 8.8 Identities = 9/37 (24%), Positives = 17/37 (45%) Frame = +3 / +2 Query: 300 HVACWIAISLLPKVLPVWLARKSKIASCFCYAIYTLL 410 HV W+ + + + W ++ FC +YT+L Sbjct: 3716 HVFLWLTVVNMHGMYVQWCIASGILSFSFCLFLYTIL 3826 Score = 21.7 bits (41), Expect(3) = 8.8 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = +3 / +2 Query: 18 RRSMWWPRRVSRSGPARARCWWT 86 RR MWW S + R W T Sbjct: 548 RRGMWWCPNCSSTRRRRWGGWCT 616 Score = 21.7 bits (41), Expect(3) = 8.8 Identities = 5/6 (83%), Positives = 6/6 (100%) Frame = +2 / +2 Query: 290 GCWACR 307 GCW+CR Sbjct: 3470 GCWSCR 3487
>LOC_Os12g42900:12012.t03963:unspliced-genomic anther-specific proline-rich protein APG, putative, expressed| Length = 1658 Score = 30.4 bits (60), Expect = 9.7 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 / +2 Query: 33 WPRRVSRSGPARARCWW 83 W RR S PAR+R WW Sbjct: 212 WSRRWSGDRPARSRTWW 262
>LOC_Os11g46920:12011.t04167:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3148 Score = 30.4 bits (60), Expect = 9.7 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 / +3 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 RVSR G AR R WW R R T+ Sbjct: 1875 RVSRRGGARWRPWWKRAARLTA 1940
>LOC_Os11g37930:12011.t03334:unspliced-genomic wound-induced protein WIN1 precursor, putative| Length = 1403 Score = 30.4 bits (60), Expect = 9.7 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +1 / +2 Query: 10 AAQEGVCGGQEGCPGQDRQGQGAG 81 AA+ GVC G E G +R G+G G Sbjct: 1208 AARVGVCAGDEHGDGGERGGEGGG 1279
>LOC_Os11g10430:12011.t00933:unspliced-genomic conserved hypothetical protein| Length = 3716 Score = 30.4 bits (60), Expect = 9.7 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 / +2 Query: 3 RRSGPRRSMWWPRRVSRSGPARARC 77 R SG RR W RR R G AR RC Sbjct: 548 R*SGCRRRWAWRRRRGRCGSARRRC 622
>LOC_Os10g34660:12010.t02760:unspliced-genomic expressed protein| Length = 3466 Score = 30.4 bits (60), Expect = 9.7 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 / -1 Query: 28 CGGQEGCPGQDRQGQGAGGP 87 C Q+GC G R GA GP Sbjct: 184 CANQDGCGGSSRTNDGAPGP 125
>LOC_Os10g08910:12010.t00710:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3370 Score = 30.4 bits (60), Expect = 9.7 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +3 / +2 Query: 21 RSMWWPRRVSRSGPARARCWWTRG*RRTS 107 RS RVS+ G AR R WW R R T+ Sbjct: 1925 RSSTRRERVSKRGNARWRPWWRRAARHTA 2011
>LOC_Os10g01984:12010.t00094:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 15035 Score = 30.4 bits (60), Expect = 9.7 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 / -1 Query: 3 RRSGPRRSMWWPRRVSRSGPARAR 74 RR GPR S W RR + G A AR Sbjct: 4445 RRWGPRGSQGWHRREAEEGSASAR 4374
>LOC_Os09g37012:12009.t03177:unspliced-genomic aspartic-type endopeptidase/ pepsin A, putative, expressed| Length = 3672 Score = 30.4 bits (60), Expect = 9.7 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 / +3 Query: 12 GPRRSMWWPRRVSRSGPARARCWWTRG*RRT 104 G +++ WW RVSR G A W R RRT Sbjct: 378 GLKKAKWWLLRVSRVGCAVCITRWWRWGRRT 470
>LOC_Os09g28740:12009.t02552:unspliced-genomic gibberellin receptor GID1L2, putative, expressed| Length = 2514 Score = 30.4 bits (60), Expect = 9.7 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 / -3 Query: 15 PRRSMWWPRRVSRSGPARARCWWTRG*RR 101 PRR PR R+ P ARCW R RR Sbjct: 1123 PRRPQAAPRPSRRASPCCARCWRRRCRRR 1037
>LOC_Os07g43760:12007.t04020:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2880 Score = 30.4 bits (60), Expect = 9.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 / +3 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 RVS+ G AR R WW R R T+ Sbjct: 1695 RVSKRGDARWRPWWRRAARHTA 1760
>LOC_Os07g35410:12007.t03216:unspliced-genomic protein kinase, putative, expressed| Length = 3512 Score = 30.4 bits (60), Expect = 9.7 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +3 / -3 Query: 3 RRSGPRRSMWWPRRVSRSGPARAR 74 RR+ PRR+ PRR R G ARAR Sbjct: 597 RRTPPRRTRRRPRRSRRRGRARAR 526
>LOC_Os06g42990:12006.t03989:unspliced-genomic AP2 domain containing protein| Length = 1179 Score = 30.4 bits (60), Expect = 9.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 / +2 Query: 18 RRSMWWPRRVSRSGPARARCWWTR 89 RRS WW RR S G R R TR Sbjct: 278 RRSFWWRRRGSTGGRGRGRGGSTR 349
>LOC_Os06g16240:12006.t01497:unspliced-genomic expressed protein| Length = 1800 Score = 30.4 bits (60), Expect = 9.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 / -3 Query: 4 DAAAQEGVCGGQEGCPGQDRQGQG 75 D A E CGG+ G +RQGQG Sbjct: 1204 DHRAVEHACGGERAQRGAERQGQG 1133
>LOC_Os06g09640:12006.t00842:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2965 Score = 30.4 bits (60), Expect = 9.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 / +3 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 RVS+ G AR R WW R R T+ Sbjct: 1944 RVSKRGDARWRPWWRRAARHTA 2009
>LOC_Os05g42070:12005.t03743:unspliced-genomic UDP-glucose flavonoid-O-glucosyltransferase, putative, expressed| Length = 1466 Score = 30.4 bits (60), Expect = 9.7 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 / -1 Query: 6 RSGPRRSMWWPRRVSRSGPARARCWWTR 89 R PRR PRR R RARC W R Sbjct: 194 RGWPRRRPAMPRRGGRRSR*RARCGWWR 111
>LOC_Os05g03710:12005.t00268:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2911 Score = 30.4 bits (60), Expect = 9.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 / +3 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 RVS+ G AR R WW R R T+ Sbjct: 1950 RVSKRGDARWRPWWRRAARHTA 2015
>LOC_Os04g49510:12004.t04465:unspliced-genomic calcium-dependent protein kinase, isoform AK1, putative, expressed| Length = 5268 Score = 30.4 bits (60), Expect = 9.7 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +3 / -3 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTRG 92 RRS P+ + R R+ PARA C W RG Sbjct: 733 RRSPPQWTARCRGRWCRTAPARASCPWRRG 644
>LOC_Os04g45550:12004.t04089:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2755 Score = 30.4 bits (60), Expect = 9.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 / +3 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 RVS+ G AR R WW R R T+ Sbjct: 1761 RVSKRGDARWRPWWRRAARHTA 1826
>LOC_Os04g42399:12004.t03791:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 6537 Score = 30.4 bits (60), Expect = 9.7 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 / +3 Query: 7 AAAQEGVCGGQEGCPGQDRQGQGAGGP 87 A++ VCGG EG + R+ GAG P Sbjct: 6393 ASSAAAVCGGGEGVWQRGRRSSGAGAP 6473
>LOC_Os04g35470:12004.t03217:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1595 Score = 30.4 bits (60), Expect = 9.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 / +1 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 RVS+ G AR R WW R R T+ Sbjct: 1012 RVSKRGDARWRPWWRRAARHTA 1077
>LOC_Os04g20950:12004.t01829:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2988 Score = 30.4 bits (60), Expect = 9.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 / +2 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 RVS+ G AR R WW R R T+ Sbjct: 1769 RVSKRGDARWRPWWRRAARHTA 1834
>LOC_Os04g20340:12004.t01772:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2491 Score = 30.4 bits (60), Expect = 9.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 / +3 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 RVS+ G AR R WW R R T+ Sbjct: 1305 RVSKRGDARWRPWWRRAARHTA 1370
>LOC_Os03g54950:12003.t04758:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2700 Score = 30.4 bits (60), Expect = 9.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 / +2 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 RVS+ G AR R WW R R T+ Sbjct: 1481 RVSKRGDARWRPWWRRAARHTA 1546
>LOC_Os02g51620:12002.t04744:unspliced-genomic beta-D-xylosidase, putative, expressed| Length = 4559 Score = 30.4 bits (60), Expect = 9.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 / -3 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTRG 92 RR G WW R R G R R W RG Sbjct: 417 RR*G*PAGSWWRRGAGRRGGCRGRRWRRRG 328
>LOC_Os02g49510:12002.t04535:unspliced-genomic amino acid transporter-like protein, putative, expressed| Length = 4075 Score = 30.4 bits (60), Expect = 9.7 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 / -1 Query: 3 RRSGPRRSMWWPRRVSRSGPARA 71 RR G RRS WW R SR+ A Sbjct: 1444 RRGGSRRSWWWCTRPSRAAATPA 1376
>LOC_Os02g38040:12002.t03442:unspliced-genomic protein binding protein, putative, expressed| Length = 2742 Score = 30.4 bits (60), Expect = 9.7 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 / +3 Query: 30 WWPRRVSRSGPARARCWWTR 89 WWPRR + +G R W TR Sbjct: 609 WWPRRTAVAGRRRPGWWTTR 668
>LOC_Os02g26930:12002.t02387:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3132 Score = 30.4 bits (60), Expect = 9.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 / +2 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 RVS+ G AR R WW R R T+ Sbjct: 1859 RVSKRGDARWRPWWRRAARHTA 1924
>LOC_Os02g11870:12002.t00985:unspliced-genomic expressed protein| Length = 1033 Score = 30.4 bits (60), Expect = 9.7 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +3 / -2 Query: 3 RRSGPRRSMWWPRRVSRSGPA 65 RR RR WWPRR S S P+ Sbjct: 360 RRRRRRRWWWWPRRPSPSEPS 298
>LOC_Os02g09560:12002.t00803:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2934 Score = 30.4 bits (60), Expect = 9.7 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 / +3 Query: 42 RVSRSGPARARCWWTRG*RRTS 107 RVS+ G AR R WW R R T+ Sbjct: 1761 RVSKRGDARWRPWWRRAARHTA 1826
>LOC_Os02g02530:12002.t00152:unspliced-genomic minor histocompatibility antigen H13, putative, expressed| Length = 5101 Score = 30.4 bits (60), Expect = 9.7 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = +3 / -2 Query: 33 WPRRVSRSGPARAR 74 WPR++SR+G ARAR Sbjct: 474 WPRQISRTGAARAR 433
>LOC_Os01g45400:12001.t03996:unspliced-genomic RUB1, putative| Length = 465 Score = 30.4 bits (60), Expect = 9.7 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = +3 / +2 Query: 18 RRSMWWPRRVSRSGPARARCWWTRG*RRTS 107 R S W R +RS +R RC RG RRTS Sbjct: 32 RPSRWRWRAATRSRTSRRRCRTRRGSRRTS 121
>LOC_Os01g44230:12001.t06769:unspliced-genomic transcription factor X1, putative, expressed| Length = 4074 Score = 30.4 bits (60), Expect = 9.7 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = +3 / -2 Query: 294 AGHVACWIAISLLPKVLPVWLARKSKIASCFCYAIYTLLLLEL 422 A + CW + L L + RKS + C C + L L L Sbjct: 3281 ASRMVCWFFVQELLAFLAIGKMRKSYVCVCVCVCVSLSLSLSL 3153
>LOC_Os01g42294:12001.t03748:unspliced-genomic atypical receptor-like kinase MARK, putative, expressed| Length = 5955 Score = 30.4 bits (60), Expect = 9.7 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 / +1 Query: 3 RRSGPRRSMWWPRRVSRSGPARARCWWTRG*RRT 104 R S RS RR R WWTRG RRT Sbjct: 5032 RTSASTRSSRRRRRARAPAGTARRRWWTRGGRRT 5133
>LOC_Os01g41870:12001.t03707:unspliced-genomic ATP binding protein, putative, expressed| Length = 5317 Score = 30.4 bits (60), Expect = 9.7 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 / +2 Query: 21 RSMWWPRRVSRSGPARARCWWTR 89 R W RR +R G R R WW R Sbjct: 1319 RGRLWRRRAARRGRRRRRRWWWR 1387
>LOC_Os01g40120:12001.t03538:unspliced-genomic expressed protein| Length = 4420 Score = 30.4 bits (60), Expect = 9.7 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 / -2 Query: 7 AAAQEGVCGGQEGCPGQDRQGQGAGGPA 90 A++ VCGG EG + R+ GAG P+ Sbjct: 3213 ASSAAAVCGGGEGVWRRGRRSPGAGAPS 3130 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 166,364,203 Number of extensions: 2319180 Number of successful extensions: 19198 Number of sequences better than 10.0: 175 Length of query: 177 Length of database: 55,613,886 Length adjustment: 48 Effective length of query: 129 Effective length of database: 52,912,542 Effective search space: 6825717918 Effective search space used: 6825717918 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
