ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf6f04 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os02g58500:12002.t05505:unspliced-genomic phospholipase A2, putative, expressed| Length = 1511 Score = 65.2 bits (136), Expect = 8e-10 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = +1 / +2 Query: 832 AVGIRYVGFMDVGWSSYD*EEPCDDLEAYCRNHKNCVRK 948 AVGIRY + VGWS D EEPCDDL+A CR+H +CV K Sbjct: 233 AVGIRYGKYCGVGWSGCDGEEPCDDLDACCRDHDHCVDK 349
>LOC_Os03g50030:12003.t04348:unspliced-genomic phospholipase A2, putative, expressed| Length = 1680 Score = 40.9 bits (83), Expect = 0.017 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = +1 / +2 Query: 841 IRYVGFMDVGWSSYD*EEPCDDLEAYCRNHKNCVR 945 +RY + + +S E+PCD+L+A C +H NCV+ Sbjct: 785 LRYGKYCGILYSGCPGEQPCDELDACCMHHDNCVQ 889
>LOC_Os10g26680:12010.t02079:unspliced-genomic pectinesterase-1 precursor, putative, expressed| Length = 2389 Score = 40.0 bits (81), Expect = 0.032 Identities = 19/42 (45%), Positives = 22/42 (52%) Frame = +2 / -1 Query: 131 PSRPCSYPSHRPPPRIISHSLYHPPDGTVRIRAPLPSPRCRR 256 PS PCS P+ RPPP S + PP RAPL +P R Sbjct: 226 PSAPCSPPAPRPPPPAPSRTPPPPPPPAPPPRAPLLAPAAPR 101
>LOC_Os05g35810:12005.t03174:unspliced-genomic conserved hypothetical protein| Length = 1429 Score = 37.3 bits (75), Expect = 0.21 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -2 / +2 Query: 59 SSHLCDDARGHACGRRRLL 3 S HL DD GH CGRRRLL Sbjct: 383 SDHLPDDGAGHRCGRRRLL 439
>LOC_Os02g10880:12002.t00936:unspliced-genomic indole-3-acetate beta-glucosyltransferase, putative, expressed| Length = 1636 Score = 29.0 bits (57), Expect(2) = 0.26 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +2 / +2 Query: 146 SYPSHRPPPRIISHSLYHPPD 208 SYPS RPPPR + + PP+ Sbjct: 758 SYPSARPPPRSTAAAQPPPPE 820 Score = 25.4 bits (49), Expect(2) = 0.26 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +1 / +2 Query: 322 EPPPPSTWRRCEGSDQRGT 378 +PPPP C G+ +R T Sbjct: 803 QPPPPERRTTCTGTTRRAT 859
>LOC_Os08g18970:12008.t01718:unspliced-genomic major pollen allergen Jun a 1 precursor, putative| Length = 7181 Score = 36.8 bits (74), Expect = 0.29 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = -3 / +1 Query: 397 LRTPATPSLSGRFLHSVARWMAAVARATPSRVSSACGAGEPR 272 L P TP+ + H+VAR A+ A A P +S GA +PR Sbjct: 6328 LPPPRTPAFAAAASHAVARLGASRAPAPPRTAASGAGASDPR 6453
>LOC_Os11g41034:12011.t004377:unspliced-genomic expressed protein| Length = 8674 Score = 36.3 bits (73), Expect = 0.40 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +2 / -3 Query: 131 PSRPCSYPSHRPPPRIISHSLYHPPDGTVRIRAPLPSPRCRRLTQK 268 P R C P PPP ++ L PP R+P RCRRL ++ Sbjct: 5315 PRRRCRSPPPPPPPPRLASPLPPPPRSLPPPRSPRRCLRCRRLEER 5178
>LOC_Os04g50800:12004.t04558:unspliced-genomic expressed protein| Length = 1853 Score = 28.6 bits (56), Expect(2) = 0.47 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +1 / +1 Query: 466 RIPCGARDHHRPQACASARGNVVQR*PDARPSPPQGFLIHRGAQG 600 R+P A H RP + G + +R R + L H+G QG Sbjct: 184 RLPHAASRHRRPPPRQAVAGRMPRRAVQERGGSQRRLLPHQGLQG 318 Score = 24.9 bits (48), Expect(2) = 0.47 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 / +3 Query: 325 PPPPSTWRRCEGSDQ 369 PPPP WRR Q Sbjct: 54 PPPPPPWRRRRSKGQ 98
>LOC_Os10g26700:12010.t02081:unspliced-genomic YGL010w-like protein, putative, expressed| Length = 1197 Score = 30.4 bits (60), Expect(2) = 0.48 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +2 / -2 Query: 131 PSRPCSYPSHRPPPRIISHSLYHPPDGTVRIRAPLPSPRC 250 PS+ + PS R PP PP + AP+P+ RC Sbjct: 950 PSKTPTNPSRRSPPASPCSRSPSPPPPSSPAPAPVPAARC 831 Score = 23.1 bits (44), Expect(2) = 0.48 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 / -3 Query: 326 HRRHPPGDAVKEATR 370 HRRHP DA+ E R Sbjct: 829 HRRHPRLDALVEPRR 785
>LOC_Os07g22900:12007.t01992:unspliced-genomic conserved hypothetical protein| Length = 468 Score = 30.9 bits (61), Expect(2) = 0.51 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 / -3 Query: 152 PSHRPPPRIISHSLYHPPDGTVRIRAP 232 P H P PR++ H+ PP G++ AP Sbjct: 343 PPHPPAPRLLPHAGSAPPPGSLGALAP 263 Score = 22.6 bits (43), Expect(2) = 0.51 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 / -1 Query: 325 PPPPSTWRRC 354 PPPP RRC Sbjct: 222 PPPPFALRRC 193
>LOC_Os07g47650:12007.t04399:unspliced-genomic ubiquitin-protein ligase, putative, expressed| Length = 3283 Score = 35.9 bits (72), Expect = 0.55 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +2 / +2 Query: 155 SHRPPPRIISHSLYHPPDGTVRIRAPLPSP 244 + RPPPR+ S S PDG + PLPSP Sbjct: 266 ARRPPPRLSSSSSSRIPDGHRCLSRPLPSP 355
>LOC_Os07g03250:12007.t00215:unspliced-genomic protein AINTEGUMENTA, putative, expressed| Length = 4702 Score = 35.9 bits (72), Expect = 0.55 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = +2 / +2 Query: 140 PCSYPSHRPPPRIISHSLYHPPDGTVRIRAPLPSPRCRRL 259 PCS PS RPP R S P R R+ SPR RRL Sbjct: 4085 PCSSPSRRPPWRRRRSSRRRPSSWRRRCRSAPGSPRRRRL 4204
>LOC_Os06g42220:12006.t03913:unspliced-genomic too many mouths protein precursor, putative, expressed| Length = 1472 Score = 35.4 bits (71), Expect = 0.76 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +2 / +3 Query: 131 PSRPCSYPSHRPPPRIISHSLYHPPDGTVRIRAPLPSPRCRRL 259 P+ P + PSH P PR H P +R + P P P R L Sbjct: 411 PAAPVAAPSHAPGPRARQQPRAHRPPRHLRRQPPAPPPPRRSL 539
>LOC_Os10g40559:12010.t03295:unspliced-genomic xyloglucan galactosyltransferase KATAMARI 1, putative, expressed| Length = 1588 Score = 35.4 bits (71), Expect = 0.76 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 / -3 Query: 567 RRGWTSIWSSLNHVPPSRSARLWSMVIPSST 475 RRGW WS+ + PP+ R WS + T Sbjct: 1067 RRGWRRTWSAASACPPAAGGRTWSAASAACT 975
>LOC_Os06g36920:12006.t03387:unspliced-genomic thromboxane-A synthase, putative, expressed| Length = 2947 Score = 35.4 bits (71), Expect = 0.76 Identities = 17/35 (48%), Positives = 19/35 (54%) Frame = +1 / -1 Query: 484 RDHHRPQACASARGNVVQR*PDARPSPPQGFLIHR 588 R H RPQ ARG V+R DA PP+G L R Sbjct: 1570 RPHARPQPLVGARGPPVRRRRDAAQQPPRGPLQRR 1466
>LOC_Os11g29580:12011.t02562:unspliced-genomic hypothetical protein| Length = 249 Score = 28.6 bits (56), Expect(2) = 0.96 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 / -3 Query: 134 SRPCSYPSHRPPPRIISHSLYHPP 205 S P P H PPPR + ++ PP Sbjct: 178 SSPSPAPRHHPPPRPLPVFVWRPP 107 Score = 24.0 bits (46), Expect(2) = 0.96 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 / -1 Query: 197 HPPDGTVRIRAPLPSPRC 250 HPP R+R PLP C Sbjct: 87 HPPRRQRRLRQPLPPCPC 34
>LOC_Os10g30870:12010.t02418:unspliced-genomic expressed protein| Length = 2214 Score = 28.6 bits (56), Expect(2) = 1.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 / -1 Query: 152 PSHRPPPRIISHSLYHPPDGTVRIRAPLPSPRCR 253 P PPPR S S P RAP P P R Sbjct: 939 PRRPPPPRRPSSSRGRAPPPPAPSRAPCPQPPAR 838 Score = 28.1 bits (55), Expect(2) = 1.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 / -1 Query: 325 PPPPSTWRRCEGSDQRG 375 PPPP WRR G RG Sbjct: 108 PPPPPWWRRGGGGGGRG 58
>LOC_Os04g12140:12004.t01038:unspliced-genomic expressed protein| Length = 9836 Score = 27.2 bits (53), Expect(2) = 1.4 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 / +1 Query: 152 PSHRPPPRIISHSLYHPPDGTVRIRAPLPSPR 247 P+ PPP + P T R R PLP R Sbjct: 4156 PTRLPPPTACRPAPQPPSATTARCRTPLPPSR 4251 Score = 24.4 bits (47), Expect(2) = 1.4 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 / +1 Query: 319 HEPPPPSTWRRCEGSDQR 372 H PPPP + R GS R Sbjct: 4303 HSPPPPPSDREVGGSRSR 4356
>LOC_Os09g14630:12009.t01253:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3700 Score = 27.2 bits (53), Expect(2) = 1.5 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +2 / -3 Query: 140 PCSYPSHRPPPRIISHSLYHPPDGTVRIRAPL 235 P + S RPP R HSL P R+ APL Sbjct: 362 PRACRSGRPPGRRRRHSLPRQPAPVARVVAPL 267 Score = 24.4 bits (47), Expect(2) = 1.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 / -1 Query: 326 HRRHPPGDAVKEATREG 376 HRRH P A +R+G Sbjct: 247 HRRHRPAPATPRTSRQG 197
>LOC_Os09g24730:12009.t02154:unspliced-genomic hypothetical protein| Length = 1933 Score = 27.6 bits (54), Expect(2) = 1.5 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 / -2 Query: 152 PSHRPPPRIISHSLYHPPDGTVRIRAPL 235 PS RPP R H L P R+ APL Sbjct: 348 PSGRPPGRRRRHPLPRQPAPVARVVAPL 265 Score = 24.0 bits (46), Expect(2) = 1.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 / -3 Query: 329 RRHPPGDAVKEATRE 373 RRHPP A A+R+ Sbjct: 242 RRHPPAPATPRASRQ 198
>LOC_Os10g39150:12010.t03158:unspliced-genomic thylakoid membrane phosphoprotein 14 kda, chloroplast precursor,| putative, expressed Length = 1721 Score = 28.1 bits (55), Expect(2) = 1.5 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 / +2 Query: 128 HPSRPCSYPSHRPP 169 HP+ P YPS RPP Sbjct: 53 HPTHPHFYPSRRPP 94 Score = 23.5 bits (45), Expect(2) = 1.5 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 / +3 Query: 158 HRPPPRIISHSLYHPPDGTVRIRAPL 235 HRPP R SHS T R+ P+ Sbjct: 108 HRPPVRRPSHSHLAAAITTSRLTTPI 185
>LOC_Os02g58570:12002.t05427:unspliced-genomic PRLI-interacting factor A, putative, expressed| Length = 1953 Score = 32.7 bits (65), Expect(2) = 1.8 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -2 / +3 Query: 626 LSNQYMNNTPWAPRWMRNP*GGDGRASGHR*TTFPRAEAHA 504 L + + N A RW +N GG G G R FPR +A A Sbjct: 660 LGDLQVQNRAKARRWFKNQSGGGGGGGGPRKHFFPRPKAAA 782 Score = 23.1 bits (44), Expect(2) = 1.8 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -3 / +3 Query: 832 HLTIIEVRVASKGATESQSHGAPATNPNRTIGQ 734 HL+ R S AT Q A + +PN+ +G+ Sbjct: 435 HLSNPSSRSLSPLATSKQREAAASMDPNQMMGR 533
>LOC_Os08g30690:12008.t02821:unspliced-genomic hypothetical protein| Length = 423 Score = 27.2 bits (53), Expect(2) = 2.0 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 / +3 Query: 508 CASARGNVVQR*PDARPSPPQGFL 579 C SAR + R P ARP PP L Sbjct: 297 CHSARPTLPLRQPHARPPPPAAVL 368 Score = 26.3 bits (51), Expect(2) = 2.0 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +2 / +2 Query: 131 PSRPCSYPSHRPPPRIISHSLYHPPDGTVRIRAPLPS 241 PS S H P PR S +HPP +P P+ Sbjct: 107 PSARSSRRRHPPTPRTPSPLPWHPPSPRTPPSSPPPT 217
>LOC_Os07g06940:12007.t00573:unspliced-genomic valyl-tRNA synthetase, putative, expressed| Length = 5316 Score = 34.1 bits (68), Expect = 2.0 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 / +2 Query: 693 ASF*TVFQGCCCRRCPMVRLG 755 AS +F CCCRRCP + +G Sbjct: 4046 ASQANIFISCCCRRCPRLHIG 4108
>LOC_Os04g37770:12004.t03347:unspliced-genomic expressed protein| Length = 584 Score = 34.1 bits (68), Expect = 2.0 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +2 / +2 Query: 131 PSRPCSYPSHRPPPRIISHSLYHPPDGTVRIRAPLPSPRCR 253 P P HRPPPR + LY P P PSPR R Sbjct: 191 PRPPPPRRPHRPPPRRLPTPLYLPAPAPTCRPPPPPSPRPR 313
>LOC_Os06g19900:12006.t01807:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 7240 Score = 34.1 bits (68), Expect = 2.0 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 / -3 Query: 387 RRHRPSLVASFTASPGGWRRW 325 RRHR A+ A GGWRRW Sbjct: 86 RRHRRGAAAARVAMAGGWRRW 24
>LOC_Os03g64080:12003.t05622:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 15359 Score = 34.1 bits (68), Expect = 2.0 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -1 / -3 Query: 618 PVHEQYTLGAAVDEESLRRGWTSIWSSLNHVPPSRSARLWSMV 490 P+H+ Y GAA D + +GWT++ + P R R +V Sbjct: 5943 PIHKTYESGAAQDHQLSWQGWTTVQKQMVRSRPPR*QRNMKLV 5815
>LOC_Os03g57930:12003.t05054:unspliced-genomic expressed protein| Length = 882 Score = 27.6 bits (54), Expect(2) = 2.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 / +3 Query: 319 HEPPPPSTWRRCEGSDQR 372 ++PPPP R+ GSD R Sbjct: 573 NQPPPPPPQRKARGSDTR 626 Score = 26.7 bits (52), Expect(2) = 2.2 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = +1 / +2 Query: 643 ASSSRQHPLVSHIPGTPQASRQSSKDVVVAVVRWCG*GLWLVLHEIGSP 789 ASS P S GTP + R + V+A+ W G +++ SP Sbjct: 722 ASSMAPRPR*STAAGTPNSWRTVASSGVIALRYWHSGGRLIIVSASSSP 868
>LOC_Os02g01730:12002.t00073:unspliced-genomic senescence-induced receptor-like serine/threonine-protein kinase| precursor, putative, expressed Length = 2428 Score = 30.9 bits (61), Expect(2) = 2.2 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 / +2 Query: 167 PPRIISHSLYHPPDGTVRIRAPLPSPRCRR 256 PP + + PP ++ +RAP P P CRR Sbjct: 95 PPPPLLRRHHLPPPPSLPLRAPAPPPCCRR 184 Score = 24.9 bits (48), Expect(2) = 2.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 / +3 Query: 712 SKDVVVAVVRWCG*GLWL 765 S V V V RWCG WL Sbjct: 450 SPPVAVKVHRWCGGERWL 503
>LOC_Os05g32390:12005.t02835:unspliced-genomic dynamin family protein, expressed| Length = 8879 Score = 28.6 bits (56), Expect(2) = 2.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 / +2 Query: 325 PPPPSTWRRC 354 PPPP WRRC Sbjct: 242 PPPPRCWRRC 271 Score = 22.1 bits (42), Expect(2) = 2.5 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = +2 / +2 Query: 131 PSRPCSYPSHRPPPRIISHSLYHPPDGTVRIRAPLP 238 P+ P S PPP H+ + R +P+P Sbjct: 17 PTPPSPLLSSPPPPLSAVHTRPRAREARARSPSPIP 124
>LOC_Os02g17240:12002.t01517:unspliced-genomic pollen-specific kinase partner protein, putative, expressed| Length = 2786 Score = 26.3 bits (51), Expect(2) = 2.7 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 / -3 Query: 131 PSRPCSYPSHRPPPRIISHSLYHPPDGTVRIR 226 P P +P+HR R +HPP R+R Sbjct: 513 PEEPHHHPAHRLELRAQGVGTWHPPFAHRRLR 418 Score = 24.4 bits (47), Expect(2) = 2.7 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 / -2 Query: 325 PPPPSTWRRCEGSDQ 369 PPPP+ + EGS+Q Sbjct: 349 PPPPTNQGKIEGSNQ 305
>LOC_Os09g28880:12009.t02566:unspliced-genomic plant-specific domain TIGR01570 family protein, expressed| Length = 3624 Score = 33.6 bits (67), Expect = 2.7 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +2 / +3 Query: 191 LYHPPDGTVRIRAPLPSPRCRRL 259 L HPP+G +R RAP +P RRL Sbjct: 501 LLHPPEGGLRRRAPRAAPPARRL 569
>LOC_Os09g23380:12009.t02022:unspliced-genomic cleavage and polyadenylation specificity factor, 73 kDa subunit,| putative, expressed Length = 5665 Score = 33.6 bits (67), Expect = 2.7 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +3 / +2 Query: 1056 TRLIVSLVYIL*SCHPLYVCQINK 1127 T +I S YIL* C LYVC +NK Sbjct: 3869 TLVIYSFFYIL*CCKTLYVCLLNK 3940
>LOC_Os05g32820:12005.t02877:unspliced-genomic peptide-N4-asparagine amidase A, putative, expressed| Length = 2220 Score = 33.6 bits (67), Expect = 2.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 / -3 Query: 602 TPWAPRWMRNP*GGDGRASG 543 TPW PRW P G GR SG Sbjct: 190 TPWPPRWHPGPAGRGGRRSG 131
>LOC_Os03g56050:12003.t04865:unspliced-genomic ANT-like protein, putative, expressed| Length = 5190 Score = 33.6 bits (67), Expect = 2.7 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = -3 / -2 Query: 829 LTIIEVRVASKGATESQSHGAPATNPNRTIGQRRQQHPWKTV 704 L + V G ++Q HG +G+RR HPW V Sbjct: 845 LVVTVAAVVEGGVVQAQRHGGARA*EILQLGRRRHHHPWSRV 720
>LOC_Os03g17170:12003.t01497:unspliced-genomic nitric oxide synthase interacting protein, putative, expressed| Length = 2047 Score = 33.6 bits (67), Expect = 2.7 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -3 / +1 Query: 394 RTPATPSLSGRFLHSVARWMAAVARATPSRVSSACGAGEPR 272 RTP++PS S + +A RATPS S++ A PR Sbjct: 220 RTPSSPSTPAASASSRSSTRSAAPRATPSARSASSSASSPR 342
>LOC_Os10g19850:12010.t01485:unspliced-genomic expressed protein| Length = 1460 Score = 33.6 bits (67), Expect = 2.7 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 / +3 Query: 472 PCGARDHHRPQACASARGNVVQR*PDARPSPPQGFLIHRGA 594 PC AR R C SAR R RP PP + GA Sbjct: 237 PCRARTARRGSGCGSARSRPPPRRRRRRPPPPPAATLRGGA 359
>LOC_Os06g11720:12006.t01049:unspliced-genomic cytokinin-O-glucosyltransferase 2, putative, expressed| Length = 2043 Score = 33.6 bits (67), Expect = 2.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 / -2 Query: 325 PPPPSTWRRC 354 PPPPSTWRRC Sbjct: 1583 PPPPSTWRRC 1554
>LOC_Os03g15460:12003.t01332:unspliced-genomic expressed protein| Length = 1861 Score = 33.6 bits (67), Expect = 2.7 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 / +2 Query: 841 IRYVGFMDVGWSSYD*EEPCDDLEAYCRNHKNCV 942 +RY + + +S E PCD L+A C H +CV Sbjct: 695 LRYGKYCGILYSGCPGERPCDALDACCMVHDHCV 796
>LOC_Os07g02180:12007.t00110:unspliced-genomic 3-5 exonuclease family protein, expressed| Length = 1491 Score = 27.6 bits (54), Expect(2) = 2.8 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +2 / +3 Query: 131 PSRPCSYPSHRPPPRIISHSLYHPP 205 P RP P PPR+ S + HPP Sbjct: 195 PRRPVDPPPTPAPPRLPSPATGHPP 269 Score = 23.1 bits (44), Expect(2) = 2.8 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +1 / +1 Query: 325 PPPPSTWRRCEG 360 PPPP+T + C G Sbjct: 247 PPPPATLQLCVG 282
>LOC_Os02g01130:12002.t00013:unspliced-genomic expressed protein| Length = 682 Score = 25.8 bits (50), Expect(2) = 3.0 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -1 / -1 Query: 354 TASPGGWRR 328 TA+PGGWRR Sbjct: 64 TAAPGGWRR 38 Score = 24.9 bits (48), Expect(2) = 3.0 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = -1 / -3 Query: 567 RRGWTSIWSSLNHVPPSRSARLWSMVIPS 481 R G + ++L+H PP+R+AR ++P+ Sbjct: 245 RHGASR*GAALHHGPPNRAARPHGHLLPA 159
>LOC_Os03g60620:12003.t05301:unspliced-genomic heat shock cognate 70 kDa protein 2, putative, expressed| Length = 4622 Score = 25.8 bits (50), Expect(2) = 3.5 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 / +1 Query: 325 PPPPSTWRRCEGSDQRG 375 PP P++ RR G+DQ G Sbjct: 103 PPRPASGRRSHGADQGG 153 Score = 24.4 bits (47), Expect(2) = 3.5 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 / +1 Query: 478 GARDHHRPQACASARGNVVQR 540 GA D HRP+ RG V R Sbjct: 154 GASDRHRPRDDLLVRGGVAAR 216
>LOC_Os02g09610:12002.t00808:unspliced-genomic anther-specific proline-rich protein APG precursor, putative,| expressed Length = 1494 Score = 32.7 bits (65), Expect(2) = 3.5 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +2 / -3 Query: 152 PSHRPPPRIISHSLYHPPDGTVRIRAPLPSPRCRRLTQ 265 PS PP R + PP RAP P PR RR T+ Sbjct: 1066 PSRTPPSRRSTRPSRSPPRTPPGRRAPRPPPRTRRRTR 953 Score = 21.7 bits (41), Expect(2) = 3.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 / -3 Query: 325 PPPPSTWRRCEGS 363 PPPP RR GS Sbjct: 610 PPPPPPRRRLPGS 572
>LOC_Os04g12120:12004.t01036:unspliced-genomic transposon protein, putative, unclassified| Length = 3837 Score = 27.6 bits (54), Expect(2) = 3.5 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 / -2 Query: 152 PSHRPPPRIISHSLYHPPDGTVRIRAPL 235 PS RPP R H L P R+ APL Sbjct: 353 PSGRPPGRRRRHPLPRQPAPVARVVAPL 270 Score = 22.6 bits (43), Expect(2) = 3.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 / -3 Query: 329 RRHPPGDAVKEATREG 376 RRH P A A+R+G Sbjct: 247 RRHRPAPATPRASRQG 200
>LOC_Os12g42284:12012.t03903:unspliced-genomic conserved hypothetical protein| Length = 807 Score = 33.1 bits (66), Expect = 3.7 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -3 / -1 Query: 805 ASKGATESQSHGAPATNPNRTIGQRRQQHPWKTV*KLAACL 683 A+ +Q GAP T P R+I RR HP + A CL Sbjct: 522 ATAAPAPAQPTGAPVTRPPRSIWPRRTAHPAEEGTAAAPCL 400
>LOC_Os06g26170:12006.t02424:unspliced-genomic conserved hypothetical protein| Length = 1845 Score = 33.1 bits (66), Expect = 3.7 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 / +3 Query: 146 SYPSHRPPPRIISHSLYHPPDGTVRIRAPLPSPRC 250 S+P RPP + S + PP T R AP P C Sbjct: 777 SHPCRRPPIGVGSSPAHRPPPATRRQSAPRPPAAC 881
>LOC_Os01g43550:12001.t03870:unspliced-genomic OsWRKY12 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 2015 Score = 33.1 bits (66), Expect = 3.7 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +2 / -3 Query: 128 HPSRPCSYPSHRPPPRIISHSLYHPPDGTVRIRAPLPSPRCR 253 HP P + P+ P P +H + PP R P PSP R Sbjct: 1629 HPWDPRTRPAPAPSPPATTHRRHPPPPPCPLRRHPRPSPTAR 1504
>LOC_Os01g43190:12001.t03835:unspliced-genomic conserved hypothetical protein| Length = 2926 Score = 33.1 bits (66), Expect = 3.7 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -2 / +2 Query: 857 NPTYRIPTASNHHRSQSSIQRCNGEPISWSTSHKP 753 +P+ R PT S RS+S +RC SW T+ P Sbjct: 1562 HPSCRYPTTSLPARSRSPSRRCRSSRRSWLTTSSP 1666
>LOC_Os01g03590:12001.t00250:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2036 Score = 33.1 bits (66), Expect = 3.7 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 / +3 Query: 134 SRPCSYPSHRPPPRIISHSLYHPPDGTVRIRAPLPSP 244 SR S P+H PP+ + SL H P +AP P+P Sbjct: 1179 SRALSPPAHPSPPQDSAPSLPHAPPAPSPPQAPAPTP 1289
>LOC_Os01g24440:12001.t02165:unspliced-genomic expressed protein| Length = 1215 Score = 25.8 bits (50), Expect(2) = 3.8 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +2 / +2 Query: 152 PSHRPPPRIISHSLYHPPDGTVRIRAPLPSP 244 P PPP + PP + RAP P+P Sbjct: 200 PPPPPPPSSAAALPPRPPPPSAAARAPAPAP 292 Score = 24.4 bits (47), Expect(2) = 3.8 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +2 / +2 Query: 128 HPSRPCSYPSHRPPP 172 HP +P P RPPP Sbjct: 80 HPHQPWRSPPPRPPP 124
>LOC_Os09g01210:12009.t00023:unspliced-genomic PE-PGRS family protein, putative| Length = 768 Score = 25.8 bits (50), Expect(2) = 3.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 / -3 Query: 215 VRIRAPLPSPRC 250 +R+R PLP PRC Sbjct: 349 LRLRPPLPRPRC 314 Score = 24.4 bits (47), Expect(2) = 3.9 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +2 / -3 Query: 131 PSRPCSYPSHRPPPRIISHSLYHPP 205 P+ +P RPPP S HPP Sbjct: 544 PAVALLFPPCRPPPAAPPASPVHPP 470
>LOC_Os09g01180:12009.t00020:unspliced-genomic ligA, putative| Length = 669 Score = 25.8 bits (50), Expect(2) = 4.0 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 / -2 Query: 215 VRIRAPLPSPRC 250 +R+R PLP PRC Sbjct: 350 LRLRPPLPRPRC 315 Score = 24.4 bits (47), Expect(2) = 4.0 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +2 / -2 Query: 131 PSRPCSYPSHRPPPRIISHSLYHPP 205 P+ +P RPPP S HPP Sbjct: 545 PAVALLFPPCRPPPAAPPASPVHPP 471
>LOC_Os05g23630:12005.t02020:unspliced-genomic hypothetical protein| Length = 933 Score = 24.9 bits (48), Expect(3) = 4.3 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +2 / -3 Query: 158 HRPPPRIISHSLYHPPDGTVRIRAPLPSP 244 H PPR+ PPD + P PSP Sbjct: 241 HPSPPRLHRPRRSPPPDPPLHHDRPSPSP 155 Score = 23.5 bits (45), Expect(3) = 4.3 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 / -2 Query: 128 HPSRPCSYPSHRPPP 172 HPS P P PPP Sbjct: 593 HPSPPWDPPRRSPPP 549 Score = 22.6 bits (43), Expect(3) = 4.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 / -1 Query: 319 HEPPPPSTWR 348 H PPPP+T R Sbjct: 159 HHPPPPATPR 130
>LOC_Os06g43210:12006.t04851:unspliced-genomic protein binding protein, putative, expressed| Length = 6785 Score = 27.2 bits (53), Expect(2) = 4.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 / +2 Query: 134 SRPCSYPSHRPPPRIISHSLYHPP 205 S P PS PPPR SH+ PP Sbjct: 20 SAPTRSPSPPPPPRDRSHARPPPP 91 Score = 22.6 bits (43), Expect(2) = 4.5 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +1 / +3 Query: 325 PPPPSTWRRCEGSDQRGT 378 P PP WRR ++GT Sbjct: 162 PHPPRRWRRRTRRRRKGT 215
>LOC_Os09g29890:12009.t02667:unspliced-genomic phosphatidylinositol 3- and 4-kinase family protein, expressed| Length = 4402 Score = 30.9 bits (61), Expect(2) = 4.9 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 / +2 Query: 203 PDGTVRIRAPLPSPRCRRLTQK 268 P R RAP P PRCRR T++ Sbjct: 146 PSDLRRRRAPPPDPRCRRWTRR 211 Score = 24.4 bits (47), Expect(2) = 4.9 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +3 / +2 Query: 987 WKKRITGSVNSGRPEQTIRFCTRTRLIVSLVYI 1085 ++ + GSV+ G+ E T + RTR ++ L + Sbjct: 3686 YQHHLRGSVSLGKLEPTTKVFPRTR*LLKLTIV 3784
>LOC_Os10g34810:12010.t02778:unspliced-genomic expressed protein| Length = 2705 Score = 32.7 bits (65), Expect = 5.1 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +2 / +3 Query: 131 PSRPCSYPSHRPPPRIISHSLYHPPDGTVRIRAPLP 238 P R + P RPP R + P G +R+R PLP Sbjct: 198 PPRRAAPPPRRPPRRAVPVPPRAAPGGRLRLRLPLP 305
>LOC_Os04g37480:12004.t03318:unspliced-genomic NAD(P)H-dependent oxidoreductase, putative, expressed| Length = 2365 Score = 32.7 bits (65), Expect = 5.1 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -2 / +1 Query: 374 PLWSLPSQRRQVDGGGGS 321 PL SLPS RRQ GGGGS Sbjct: 91 PLHSLPSGRRQGHGGGGS 144
>LOC_Os11g34440:12011.t02997:unspliced-genomic phospholipase A2, putative, expressed| Length = 1508 Score = 32.7 bits (65), Expect = 5.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 / +2 Query: 841 IRYVGFMDVGWSSYD*EEPCDDLEAYCRNHKNCVR 945 +RY + V ++ E PCD L+A C H CV+ Sbjct: 449 MRYGKYCGVSYTGCPGEAPCDALDACCMLHDACVQ 553
>LOC_Os07g08760:12007.t00751:unspliced-genomic membrane related protein-like, putative, expressed| Length = 4417 Score = 32.7 bits (65), Expect = 5.1 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 / -3 Query: 619 LLRMDLRGASSSRQHPLVSHIPGTPQASRQSSKDVVVAVVRWC 747 L D R ++S H + P +P+AS SS A +RWC Sbjct: 626 LTHSDNR*SNSRGSHLPSTQSPASPEASAASSSSAKAASLRWC 498
>LOC_Os02g44710:12002.t04061:unspliced-genomic expressed protein| Length = 957 Score = 27.6 bits (54), Expect(2) = 5.2 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = +2 / -2 Query: 125 IHPSRPCSYPSHRPPPRIISHSLYHPPDGTVRIRAPLPSPRCR 253 +HP R P H PP+ + L G R +P PR R Sbjct: 497 LHPPRRLRRPPHAAPPQRLQPLLGAWAAGAARRALTVPLPRGR 369 Score = 22.1 bits (42), Expect(2) = 5.2 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 / -1 Query: 325 PPPPSTWRRC 354 PPPP RRC Sbjct: 357 PPPPPRRRRC 328
>LOC_Os12g21820:12012.t01921:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 4918 Score = 28.6 bits (56), Expect(2) = 5.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 / -1 Query: 466 RIPCGARDHHRPQACAS 516 R+PC AR HR +AC S Sbjct: 1327 RLPCPARAGHRARACVS 1277 Score = 26.7 bits (52), Expect(2) = 5.5 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 / -3 Query: 128 HPSRPCSYPSHRPPPRIISHSLYHPP 205 HP P P PPP ++S L PP Sbjct: 2171 HPQPPRISPPLPPPPPLLSPLLRSPP 2094
>LOC_Os04g18420:12004.t01584:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2561 Score = 30.4 bits (60), Expect(2) = 5.6 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = +2 / -3 Query: 131 PSRPCSYPSHRPPPRIISHSLYHPPDGTVRIRAPLPSPRCR 253 P R P PPP ++ P G R + P PR R Sbjct: 2349 PLRAAGTPLRSPPPAVLGQRQRQAPPGRRRASSLAPPPRSR 2227 Score = 24.0 bits (46), Expect(2) = 5.6 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +2 / -3 Query: 998 DYWIGQLRPP*TNHTLLYPHKTY 1066 D ++ LR P +H+L+ PH+ + Sbjct: 795 DQYLEVLRSPVPSHSLVGPHEVF 727
>LOC_Os07g32170:12007.t02901:unspliced-genomic SBP domain containing protein, expressed| Length = 3620 Score = 27.6 bits (54), Expect(2) = 5.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 / +2 Query: 125 IHPSRPCSYPSHRPP 169 + P RPCSYP PP Sbjct: 647 MQPVRPCSYPKLLPP 691 Score = 27.2 bits (53), Expect(2) = 5.6 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 / +3 Query: 680 SQARRKLLDSLPRMLLSPLSDGAVRVCGWC 769 S + R+LLD +P + + A+ VC WC Sbjct: 1338 SASPRQLLDLVPILAANKQIFAAIYVCVWC 1427
>LOC_Os06g43120:12006.t04002:unspliced-genomic zinc finger C-x8-C-x5-C-x3-H type family protein, expressed| Length = 7923 Score = 25.8 bits (50), Expect(2) = 5.9 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +2 / +1 Query: 128 HPSRPCSYPSHRPPPRIISHSLYHPP 205 H P P PPP + H L PP Sbjct: 247 HQQLPAPTPPPPPPPPLPQHRLEPPP 324 Score = 23.5 bits (45), Expect(2) = 5.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 / +3 Query: 230 PLPSPRCRRL 259 PLPSPR RRL Sbjct: 402 PLPSPRGRRL 431
>LOC_Os05g44740:12005.t03962:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 5973 Score = 27.6 bits (54), Expect(2) = 6.4 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +2 / -3 Query: 125 IHPSRPCSYPSHRPPPRIISHSLYHPP 205 IHP P S HR P ++H PP Sbjct: 5920 IHPVHPSSVEVHRRSPHPLAHG*APPP 5840 Score = 27.6 bits (54), Expect(2) = 6.4 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 / -2 Query: 325 PPPPSTWRRCEGSDQRGTV 381 PPP +TW EGS +G V Sbjct: 608 PPPDTTWPSPEGSQAQGGV 552
>LOC_Os06g12530:12006.t01129:unspliced-genomic nuclear migration protein nudC, putative, expressed| Length = 2848 Score = 26.3 bits (51), Expect(2) = 6.5 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 / -2 Query: 466 RIPCGARDHHRPQACASARGNVVQR*PDARPSP 564 R+P G R RP A A RG + P P P Sbjct: 261 RLPPGGRGSRRPSAPAPPRGPRRRSPPPPPPKP 163 Score = 23.1 bits (44), Expect(2) = 6.5 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +1 / -2 Query: 325 PPPPSTW 345 PPPPS+W Sbjct: 399 PPPPSSW 379
>LOC_Os04g24190:12004.t02133:unspliced-genomic growth-regulating factor 1, putative| Length = 2605 Score = 26.3 bits (51), Expect(2) = 6.5 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 / +2 Query: 164 PPPRIISHSLYHPPDGTVRIRAPLPSPRCRRL 259 PPP + + PP APLP PR RL Sbjct: 1364 PPPAHAAAAPGTPPPRRAPRPAPLPPPRFHRL 1459 Score = 23.1 bits (44), Expect(2) = 6.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 / +1 Query: 325 PPPPSTWRRCEGSDQRGT 378 PPPPST R S +R T Sbjct: 1507 PPPPSTGRPRSPSRRRRT 1560
>LOC_Os09g08254:12009.t00620:unspliced-genomic hypothetical protein| Length = 2368 Score = 32.2 bits (64), Expect = 7.0 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -3 / +3 Query: 826 TIIEVRVASKGATESQSHGAPATNPNRTIGQRRQQH 719 T V AS G S G A+ R GQRR+QH Sbjct: 345 TAARVAAASSGGASGNSEGGRASYGARQQGQRREQH 452
>LOC_Os06g51500:12006.t04833:unspliced-genomic expressed protein| Length = 2774 Score = 32.2 bits (64), Expect = 7.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 152 PSHRPPPRIISHSLYHPPDGTVRIRAPLPSPRC 250 PS PP R + + H + + PLPSPRC Sbjct: 311 PSPPPPRRRLLRRIRHQAPRPLSLSHPLPSPRC 409
>LOC_Os06g01304:12006.t00031:unspliced-genomic spotted leaf protein 11, putative, expressed| Length = 5761 Score = 32.2 bits (64), Expect = 7.0 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = +2 / +1 Query: 131 PSRPCSYPSHRPPPRIISHSLYHPPDGTVRIRAPLPSPRCRR 256 P RP P+ RPPPR++ L + P R RA P RR Sbjct: 193 PPRPPPRPAARPPPRLLLLLLEYSPRRRPRGRARPPPQDPRR 318
>LOC_Os05g49100:12005.t04343:unspliced-genomic OsWRKY49 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 3297 Score = 32.2 bits (64), Expect = 7.0 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = +3 / -2 Query: 720 CCCRRCPMVRLGFV 761 CCCRRC M++LG++ Sbjct: 3149 CCCRRCCMLQLGYL 3108
>LOC_Os04g12980:12004.t01119:unspliced-genomic indole-3-acetate beta-glucosyltransferase, putative, expressed| Length = 2659 Score = 32.2 bits (64), Expect = 7.0 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = +2 / +3 Query: 140 PCSYPSHRPPPRIISHSLYHPPDGTVRIRAPLPSPRCRRL 259 P P R PR+ H+ +HPP R P PR R L Sbjct: 174 PAVRPPPRGAPRLPPHARHHPPRSLHRPAPSRPLPRRRHL 293
>LOC_Os03g42230:12003.t03630:unspliced-genomic B3 DNA binding domain containing protein, expressed| Length = 4330 Score = 32.2 bits (64), Expect = 7.0 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 / -2 Query: 158 HRPPPRIISHSLYHPPDGTVRIRAPLPSPRCRR 256 +RPPP + ++L PP TV R + RCRR Sbjct: 375 YRPPPPPVYYTLPSPPHTTVCRRRTEATTRCRR 277
>LOC_Os03g19059:12003.t005766:unspliced-genomic anaphase-promoting complex subunit 11, putative, expressed| Length = 1476 Score = 32.2 bits (64), Expect = 7.0 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 / +3 Query: 140 PCSYPSHRPPPRIISHSLYHPPDGTVRIRAPLPSPRCRR 256 P + PS PP ++SHSL P G+ + P CRR Sbjct: 162 PGTIPSAVAPPFLLSHSLLAPTLGSPALPNPSSPRSCRR 278
>LOC_Os02g26440:12002.t02338:unspliced-genomic prefoldin subunit 1, putative, expressed| Length = 4046 Score = 32.2 bits (64), Expect = 7.0 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = -2 / +1 Query: 380 TVPLWSLPSQRRQVDGGGGSCYS*PRILRLRRWRTATASGSDD 252 +VPL+ PS R+ G GG + LRR A+GSDD Sbjct: 259 SVPLFEFPSGFRRARGSGGGLLTPVCFAALRRAGFRGAAGSDD 387
>LOC_Os02g14110:12002.t01207:unspliced-genomic aspartate aminotransferase, mitochondrial precursor, putative,| expressed Length = 4980 Score = 32.2 bits (64), Expect = 7.0 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +2 / +1 Query: 152 PSHRPPPRIISHSLYHPPDGTVRIRAPLPSPRCR 253 PS R PP H+ P +++P P PRCR Sbjct: 31 PSSRKPPNQNPHTHSFSPPHCFALQSPPPPPRCR 132
>LOC_Os01g44170:12001.t03928:unspliced-genomic conserved hypothetical protein| Length = 6386 Score = 32.2 bits (64), Expect = 7.0 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -2 / -3 Query: 368 WSLPSQRRQVDGGGGSCYS*PRILRL 291 W + QR + G G C *PRILRL Sbjct: 3765 WGIDRQRARESGTGALCRG*PRILRL 3688
>LOC_Os10g12240:12010.t01009:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3454 Score = 32.2 bits (64), Expect = 7.0 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 / -2 Query: 325 PPPPSTWRRCEGSDQRGTV 381 PP P+ WRRC G D R V Sbjct: 1128 PPRPTGWRRCRGGDGRQIV 1072
>LOC_Os09g26370:12009.t02316:unspliced-genomic expressed protein| Length = 1140 Score = 32.2 bits (64), Expect = 7.0 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -1 / -3 Query: 564 RGWTSIWSSLNHVPPSRSARLWSMVIPSSTWDSP 463 R W +W+ P +R W ++IP S W SP Sbjct: 319 RWWCLVWARTICSPTTRRRCWWILMIP*SPWPSP 218
>LOC_Os05g46330:12005.t04121:unspliced-genomic DNA methyltransferase 1-associated protein 1, putative, expressed| Length = 7231 Score = 32.2 bits (64), Expect = 7.0 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = -1 / +1 Query: 573 SLRRGWTSIWSSLNHVPPSRSARLWSMVIPSSTWDSP 463 S+RR WT SS + PPSR +R S P S SP Sbjct: 163 SVRRQWTRRTSSASPRPPSRPSRRRSPARPRSRSGSP 273
>LOC_Os04g38680:12004.t03438:unspliced-genomic amino acid/polyamine transporter II, putative, expressed| Length = 2532 Score = 32.2 bits (64), Expect = 7.0 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -1 / +3 Query: 546 WSSLNHVPPSRSARLWSMVIPSSTWDSPCDGC 451 W+S + P S SA W S+W SP C Sbjct: 693 WTSCSRAPASPSAGSWCPGSSCSSWSSPSSSC 788
>LOC_Os01g33090:12001.t02879:unspliced-genomic ATP binding protein, putative, expressed| Length = 3045 Score = 32.2 bits (64), Expect = 7.0 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -1 / -1 Query: 555 TSIWSSLNHVPPSRSARLWSMVIPSS 478 TS+W+SLN P +RL ++V PSS Sbjct: 1401 TSVWNSLNLCSPPSPSRLTAIVSPSS 1324
>LOC_Os01g22490:12001.t01982:unspliced-genomic 40S ribosomal protein S27a, putative, expressed| Length = 895 Score = 27.6 bits (54), Expect(2) = 7.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 / -3 Query: 371 LWSLPSQRRQVDGGGGSCYS 312 LW LP +R DGGGG ++ Sbjct: 71 LWFLPRRRGGGDGGGGGVWT 12 Score = 24.9 bits (48), Expect(2) = 7.1 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 / -1 Query: 522 PSRSARLWSMVIPSSTW 472 P++ +R WS IPS +W Sbjct: 250 PAKMSRCWSGGIPSLSW 200
>LOC_Os08g16150:12008.t01489:unspliced-genomic hypothetical protein| Length = 383 Score = 27.6 bits (54), Expect(2) = 7.8 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 / -1 Query: 134 SRPCSYPSHRPPP 172 SRP +P HRPPP Sbjct: 185 SRPTLWPFHRPPP 147 Score = 23.5 bits (45), Expect(2) = 7.8 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +1 / -1 Query: 319 HEPPPPSTWRRC 354 H PPPP +RC Sbjct: 161 HRPPPPPRPQRC 126
>LOC_Os03g39160:12003.t03354:unspliced-genomic expressed protein| Length = 3093 Score = 25.8 bits (50), Expect(3) = 7.9 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 / +3 Query: 499 PQACASARGNVVQR*PDARPSPPQG 573 P++CASAR ++ PSP G Sbjct: 216 PRSCASARPSIASSPAPPSPSPSAG 290 Score = 24.0 bits (46), Expect(3) = 7.9 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = +2 / +2 Query: 131 PSRPCSYPSHRPPPRIISHSLYHPPDGTVRIRAPLPSP 244 PS+ H PP ++S S P + PLP P Sbjct: 47 PSQVAR*SPHPPPAMVVSDSPKPQPTPSPPAPPPLPVP 160 Score = 23.5 bits (45), Expect(3) = 7.9 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +1 / +1 Query: 640 GASSSRQHPLVSHIPGTPQA 699 G R HP + H PG +A Sbjct: 1270 GVRRGRNHPFLWHSPGRQEA 1329
>LOC_Os03g64190:12003.t05630:unspliced-genomic la domain containing protein, expressed| Length = 5967 Score = 26.7 bits (52), Expect(2) = 8.2 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 / +1 Query: 422 ATPPCLLPWTHPSQG 466 A PP PW HPS G Sbjct: 112 ADPPRRSPWRHPSNG 156 Score = 22.1 bits (42), Expect(2) = 8.2 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +1 / +3 Query: 484 RDHHRPQACASARGNVVQR*PDARPSPPQGFLIHR 588 R +PQ R N + R R PPQ +HR Sbjct: 153 RGQPQPQRRRRHRHN*LARALRGRQEPPQASSLHR 257
>LOC_Os03g42780:12003.t03679:unspliced-genomic ubiquitin-protein ligase/ zinc ion binding protein, putative| Length = 5135 Score = 25.4 bits (49), Expect(2) = 8.3 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 / -1 Query: 460 TGRIPCGARDHHRPQACAS 516 T R CGA HHR A +S Sbjct: 3548 TARPQCGALGHHRAAALSS 3492 Score = 23.5 bits (45), Expect(2) = 8.3 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 / -1 Query: 319 HEPPPPST 342 H PPPPST Sbjct: 3575 HRPPPPST 3552
>LOC_Os02g54624:12002.t05041:unspliced-genomic protein binding protein, putative, expressed| Length = 4592 Score = 26.7 bits (52), Expect(2) = 8.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 / +3 Query: 466 RIPCGARDHHRPQACASARGNVV 534 R+PCG R P+A A AR ++ Sbjct: 138 RLPCGRRSRVAPRARARARATLL 206 Score = 22.1 bits (42), Expect(2) = 8.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 / +1 Query: 325 PPPPSTWRRCEGSDQR 372 PPPPS RR + S R Sbjct: 76 PPPPSPPRRRQRSSAR 123
>LOC_Os12g43564:12012.t04025:unspliced-genomic conserved hypothetical protein| Length = 2281 Score = 30.9 bits (61), Expect(2) = 9.1 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 / -3 Query: 419 LATPPCLLPWTHPSQGESHVELGITIDHRR 508 +A PPCL+ P+Q ES ++L ++ +R Sbjct: 974 IAYPPCLISV*IPAQAESRLKLSFALEEKR 885 Score = 22.6 bits (43), Expect(2) = 9.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 / -3 Query: 322 EPPPPSTWRRC 354 +PPPPS R C Sbjct: 1394 QPPPPSAARPC 1362
>LOC_Os12g41860:12012.t03862:unspliced-genomic class III HD-Zip protein 4, putative, expressed| Length = 6715 Score = 31.8 bits (63), Expect = 9.6 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -2 / +1 Query: 353 QRRQVDGGGGSCYS*PRILRLRRWRTATASGS 258 QRR+ GG C PR R RRW + SG+ Sbjct: 280 QRRRWGEGGRGCRPPPRRRRRRRWTPGSTSGT 375
>LOC_Os11g36670:12011.t03213:unspliced-genomic hypothetical protein| Length = 1322 Score = 31.8 bits (63), Expect = 9.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 / +2 Query: 681 PRHAASF*TVFQGCCCRRCP 740 PRHA + + +GCCCRR P Sbjct: 446 PRHAITPCRLVRGCCCRRRP 505
>LOC_Os10g17770:12010.t01333:unspliced-genomic chromdomain-containing protein CRD101, putative, expressed| Length = 4810 Score = 31.8 bits (63), Expect = 9.6 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +2 / -3 Query: 131 PSRPCSYPSHRPPPRIISHSLYHPPDGTVRIRAPLPSP 244 P+ S+P PPPR +PP R+PLP P Sbjct: 404 PASAGSHPPQAPPPRPPPPPAANPPPPPPPARSPLPPP 291
>LOC_Os05g10450:12005.t00880:unspliced-genomic conserved hypothetical protein| Length = 528 Score = 31.8 bits (63), Expect = 9.6 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +2 / -3 Query: 131 PSRPCSYPSHRPPPRIISHSLYHPPDGTVRIRAPLPSP 244 PS P S PS RPPP + + PP R P P P Sbjct: 445 PSPPLSPPSPRPPPPSLLCPPFGPPPPPHR*PPPPPPP 332
>LOC_Os04g55640:12004.t05036:unspliced-genomic plant-specific domain TIGR01627 family protein, expressed| Length = 1387 Score = 31.8 bits (63), Expect = 9.6 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 / +1 Query: 152 PSHRPPPRIISHSLYHPPDGTVRIRAPLPSPRCR 253 P PPPR + P AP PSPRCR Sbjct: 361 PPTSPPPRARARRRTPPVAAQAPAPAPAPSPRCR 462
>LOC_Os03g44900:12003.t03874:unspliced-genomic CCR4-NOT transcription complex subunit 3, putative, expressed| Length = 10708 Score = 31.8 bits (63), Expect = 9.6 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 / -1 Query: 563 LLKDSSSTAAPKVYCSCTGCSEWIYEG 643 +L +SS+ + YCSC G + W Y G Sbjct: 5842 VLWSTSSSDRSRKYCSCCGRNNWAYRG 5762
>LOC_Os09g35550:12009.t03033:unspliced-genomic hypothetical protein| Length = 1474 Score = 31.8 bits (63), Expect = 9.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -1 / -3 Query: 537 LNHVPPSRSARLWSMVIPSSTWDS 466 L+H PP R+ R WS + SS+W S Sbjct: 299 LHHPPPYRARRSWS*IRSSSSWAS 228
>LOC_Os04g02900:12004.t00184:unspliced-genomic pyruvate dehydrogenase E1 component alpha subunit, putative,| expressed Length = 4061 Score = 31.8 bits (63), Expect = 9.6 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +1 / +2 Query: 325 PPPPSTWRRC 354 PPPPS+WRRC Sbjct: 299 PPPPSSWRRC 328
>LOC_Os04g01470:12004.t00045:unspliced-genomic caffeic acid 3-O-methyltransferase, putative, expressed| Length = 2607 Score = 31.8 bits (63), Expect = 9.6 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 / -1 Query: 325 PPPPSTWRRCEGSDQRG 375 PPPP+T RC GS +RG Sbjct: 420 PPPPATDSRCSGSRRRG 370
>LOC_Os05g16560:12005.t01426:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2116 Score = 25.8 bits (50), Expect(3) = 9.7 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +3 / -1 Query: 462 RENPMWSSGSPSTTGVRFCSGE 527 R P W +PS G+ FC E Sbjct: 757 RPRPAWPQFAPSLEGLFFCGDE 692 Score = 24.0 bits (46), Expect(3) = 9.7 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +2 / -1 Query: 191 LYHPPDGTVRIRAPLPSPRC 250 LYH DG + + P PRC Sbjct: 2002 LYHKLDGILLSYSSTPLPRC 1943 Score = 22.1 bits (42), Expect(3) = 9.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 / -3 Query: 1005 GSVNSGRPEQTIRFCTRTRLIVSLV 1079 GS+ S P +I CTR +V LV Sbjct: 152 GSITSHMP*SSIIACTRITQLV*LV 78
>LOC_Os01g12990:12001.t01164:unspliced-genomic hypothetical protein| Length = 627 Score = 26.7 bits (52), Expect(2) = 9.8 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +1 / +2 Query: 325 PPPPSTWRRCEGSDQRGT 378 PPPP W C G + T Sbjct: 218 PPPPQCWDTCHGGRKGNT 271 Score = 22.1 bits (42), Expect(2) = 9.8 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +2 / +2 Query: 134 SRPCSYPSHRPPPRIISHSLYHPP 205 S P S P R PP + +H P Sbjct: 107 SSPPSPPPQRTPPHARRRAYHHHP 178 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 433,370,929 Number of extensions: 7500989 Number of successful extensions: 48031 Number of sequences better than 10.0: 100 Length of query: 383 Length of database: 55,613,886 Length adjustment: 50 Effective length of query: 333 Effective length of database: 52,799,986 Effective search space: 17582395338 Effective search space used: 17582395338 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
