| Clone Name | FLbaf6f04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q6FTX0:CPD1_CANGA 2',3'-cyclic-nucleotide 3'-phosphodiesterase -... | 34 | 0.99 |
|---|
>Q6FTX0:CPD1_CANGA 2',3'-cyclic-nucleotide 3'-phosphodiesterase - Candida glabrata| (Yeast) (Torulopsis glabrata) Length = 193 Score = 34.3 bits (77), Expect = 0.99 Identities = 23/86 (26%), Positives = 40/86 (46%) Frame = +2 Query: 446 WTHPSQGESHVELGITIDHRRALLLGGTWFNDDQMLVHPLLKDSSSTAAPKVYCSCTGCS 625 W P+ G E+ T+ + LL+ G+ + + V L+ + KV SC+ C Sbjct: 6 WYCPAPGTLDYEVLKTLINSLQLLVPGSPSFEPHLTVVTHLQVQNRGDVSKVLQSCSSCL 65 Query: 626 EWIYEGHHLLANILWSATSQARRKLL 703 + I +GH L+ WS Q +K++ Sbjct: 66 KTIPKGHSLIKYSNWSINKQYFKKIV 91 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 178,980,056 Number of extensions: 3736669 Number of successful extensions: 9852 Number of sequences better than 10.0: 1 Number of HSP's gapped: 9847 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 100,686,439 Length adjustment: 115 Effective length of query: 268 Effective length of database: 69,142,514 Effective search space: 18530193752 Effective search space used: 18530193752 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)