| Clone Name | FLbaf6e17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | O88881:BEGIN_RAT Brain-enriched guanylate kinase-associated prot... | 32 | 3.8 | 2 | P81182:BGBP_PENVA Beta-1,3-glucan-binding protein precursor - Pe... | 32 | 3.9 | 3 | P38318:YB70_YEAST Uncharacterized membrane protein YBR220C - Sac... | 31 | 5.0 | 4 | Q7TPN3:PIGV_MOUSE GPI mannosyltransferase 2 - Mus musculus (Mouse) | 31 | 5.0 |
|---|
>O88881:BEGIN_RAT Brain-enriched guanylate kinase-associated protein - Rattus| norvegicus (Rat) Length = 611 Score = 31.6 bits (70), Expect = 3.8 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = -3 Query: 169 RSGEECPGWMNADGDGNRLGLVAWLG*EATRAQHKEGGRCSRDSLSLSGRDCS 11 RS + PG+ +DGDG+RLG+ + +H SRDSL S + S Sbjct: 524 RSADPLPGYATSDGDGDRLGVQLCGPGSSPEPEHG-----SRDSLEPSSMEAS 571
>P81182:BGBP_PENVA Beta-1,3-glucan-binding protein precursor - Penaeus vannamei (Penoeid| shrimp) (European white shrimp) Length = 1454 Score = 31.6 bits (70), Expect = 3.9 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = +1 Query: 391 YQGKGSLLKWQRQEARWSYQGKGDLLKSKALFSCGIVVRRFGFVRIAAQFPYQ 549 Y+ K + + +QR + + ++ GK ++ SKA F +RIAA + Q Sbjct: 1020 YENKVAQINYQRNDIQMNFNGKANIKSSKASFDISFTPPSGQNIRIAASYDVQ 1072
>P38318:YB70_YEAST Uncharacterized membrane protein YBR220C - Saccharomyces cerevisiae| (Baker's yeast) Length = 560 Score = 31.2 bits (69), Expect = 5.0 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = +1 Query: 502 VRRFGFVRIAAQFPYQCVPCSSSCKLICLWKKLVDLAVTICCLIP 636 VR F+ + ++F +QC +++ KL+ K DLAVT+ +P Sbjct: 296 VRSLAFIHMISKFAFQCNEAATNLKLLEQGFKREDLAVTVLIDLP 340
>Q7TPN3:PIGV_MOUSE GPI mannosyltransferase 2 - Mus musculus (Mouse)| Length = 493 Score = 31.2 bits (69), Expect = 5.0 Identities = 19/64 (29%), Positives = 29/64 (45%) Frame = +1 Query: 472 SKALFSCGIVVRRFGFVRIAAQFPYQCVPCSSSCKLICLWKKLVDLAVTICCLIPLLACC 651 S LF+ VR G V + QC SS ++ WK LV L ++C + +++ Sbjct: 192 SGLLFALAAGVRSNGLVSLGFLLHSQCRGFCSSLAVLSPWKPLVKLMASVCLSVLIVSLP 251 Query: 652 MNLF 663 LF Sbjct: 252 FALF 255 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 122,729,062 Number of extensions: 2435407 Number of successful extensions: 6227 Number of sequences better than 10.0: 4 Number of HSP's gapped: 6212 Number of HSP's successfully gapped: 4 Length of query: 269 Length of database: 100,686,439 Length adjustment: 111 Effective length of query: 158 Effective length of database: 70,239,694 Effective search space: 11097871652 Effective search space used: 11097871652 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)