| Clone Name | FLbaf3g23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | P83298:FIBC_LUMRU Fibrinolytic enzyme, isozyme C - Lumbricus rub... | 31 | 5.5 | 2 | Q95107:WASL_BOVIN Neural Wiskott-Aldrich syndrome protein - Bos ... | 31 | 7.1 | 3 | A5DK47:DBP6_PICGU ATP-dependent RNA helicase DBP6 - Pichia guill... | 31 | 7.1 | 4 | Q12830:BPTF_HUMAN Nucleosome remodeling factor subunit BPTF - Ho... | 30 | 9.3 |
|---|
>P83298:FIBC_LUMRU Fibrinolytic enzyme, isozyme C - Lumbricus rubellus (Humus| earthworm) Length = 242 Score = 31.2 bits (69), Expect = 5.5 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +2 Query: 236 VVAGSGSGLKDFPYTIGEPHASAWGSWTHHRGASKVLHARALPAS 370 V+ G+ + +FP+ + + S GSW+H GAS + AL AS Sbjct: 1 VIGGTNASPGEFPWQLSQQRQS--GSWSHSCGASLLSSTSALSAS 43
>Q95107:WASL_BOVIN Neural Wiskott-Aldrich syndrome protein - Bos taurus (Bovine)| Length = 505 Score = 30.8 bits (68), Expect = 7.1 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 348 TLAPSPPPASRPGVGRLDP 404 T AP PPP SRPGVG P Sbjct: 319 TAAPPPPPPSRPGVGAPPP 337
>A5DK47:DBP6_PICGU ATP-dependent RNA helicase DBP6 - Pichia guilliermondii (Yeast)| (Candida guilliermondii) Length = 631 Score = 30.8 bits (68), Expect = 7.1 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -2 Query: 760 IIMEDLHKLCNAFQVQPSTNRDYQLSTGSTNST 662 II+ D H+L N P+T ++Y+LS GS S+ Sbjct: 416 IIVNDRHELVNELFTVPATLQEYKLSLGSARSS 448
>Q12830:BPTF_HUMAN Nucleosome remodeling factor subunit BPTF - Homo sapiens (Human)| Length = 2907 Score = 30.4 bits (67), Expect = 9.3 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 5/56 (8%) Frame = -3 Query: 633 TSYSVAKAGISLTRASKLHPALRLLQGTC-----SYTAGPARTRPQSAERPS*NPR 481 T+ S AG R SKL P +++ Q S + GPA+ +PQ+A+ PS P+ Sbjct: 2213 TTVSTTAAGTGEQRQSKLSPQMQVHQDKTLPPAQSSSVGPAKAQPQTAQ-PSARPQ 2267 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 134,850,964 Number of extensions: 2767594 Number of successful extensions: 7899 Number of sequences better than 10.0: 4 Number of HSP's gapped: 7893 Number of HSP's successfully gapped: 4 Length of query: 284 Length of database: 100,686,439 Length adjustment: 112 Effective length of query: 172 Effective length of database: 69,965,399 Effective search space: 12034048628 Effective search space used: 12034048628 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)