| Clone Name | FLbaf3e13 |
|---|---|
| Clone Library Name | barley_pub |
>P25623:SYP1_YEAST Suppressor of yeast profilin deletion - Saccharomyces cerevisiae| (Baker's yeast) Length = 870 Score = 31.6 bits (70), Expect = 3.4 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 4/85 (4%) Frame = +3 Query: 138 PSSASPTRSVRAYAKADEEEGEKKVP----KQSLFGNITEALDFSQVRSEKDAELLYEAR 305 P+SA+ R V A E EKK P ++S FGNI L + + + E Sbjct: 265 PASATGARPVSVSNGAANTEREKKSPQKDKRKSAFGNIGHRLASASSSLTHNDLMNNEFS 324 Query: 306 DSIKDEGRMTREQYAALRRKIGGTY 380 DS + +++ LR K+G + Sbjct: 325 DSTNNSSLKSKKSSHTLRSKVGSIF 349
>Q811L6:MAST4_MOUSE Microtubule-associated serine/threonine-protein kinase 4 - Mus| musculus (Mouse) Length = 2618 Score = 31.6 bits (70), Expect = 3.5 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 309 NPWPRTAAPRPSPTGPARSPAP 244 +P RT +P P PT P RSP+P Sbjct: 1375 SPLARTPSPTPQPTSPQRSPSP 1396
>O15021:MAST4_HUMAN Microtubule-associated serine/threonine-protein kinase 4 - Homo| sapiens (Human) Length = 2444 Score = 31.6 bits (70), Expect = 3.5 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 309 NPWPRTAAPRPSPTGPARSPAP 244 +P RT +P P PT P RSP+P Sbjct: 1198 SPLARTPSPTPQPTSPQRSPSP 1219
>Q4KM92:TRUA_RAT tRNA pseudouridine synthase A - Rattus norvegicus (Rat)| Length = 393 Score = 31.2 bits (69), Expect = 4.5 Identities = 33/117 (28%), Positives = 51/117 (43%), Gaps = 7/117 (5%) Frame = +3 Query: 18 PTVKENQEPALIKAMAMRALALSPTQSSSFGLHQSTPCFKPSSASPTRSVRAYAKADEEE 197 P V+E E A+IK + SF +HQ + V+ YA E Sbjct: 237 PFVREGLEFAVIKV-----------KGQSFMMHQ----IRKMVGLVVAIVKGYAPESVLE 281 Query: 198 ---GEKKV--PKQSLFGNITEALDFSQVRSEKDAELLYEARDSIKDEGRMT--REQY 347 GE+KV PK G + E + F + ++ L+E D ++EG++T +EQY Sbjct: 282 RSWGEEKVDVPKAPGLGLVLERVHFEKYNQRFGSDGLHEPLDWAQEEGKVTAFKEQY 338
>Q6AX33:MAST3_XENLA Microtubule-associated serine/threonine-protein kinase 3 - Xenopus| laevis (African clawed frog) Length = 1482 Score = 31.2 bits (69), Expect = 4.5 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Frame = +3 Query: 27 KENQEP--ALIKAMAMRALALSPTQSSSFGLHQSTPCFKPSSASPTRSV 167 +ENQ+ +L K ++ ++ L ++S S GLHQS + ASPT S+ Sbjct: 1086 RENQDRKRSLFKKISKQSTVLQTSRSFSSGLHQSLSSSESLPASPTHSL 1134
>Q9WU56:TRUA_MOUSE tRNA pseudouridine synthase A - Mus musculus (Mouse)| Length = 423 Score = 30.8 bits (68), Expect = 5.9 Identities = 33/117 (28%), Positives = 50/117 (42%), Gaps = 7/117 (5%) Frame = +3 Query: 18 PTVKENQEPALIKAMAMRALALSPTQSSSFGLHQSTPCFKPSSASPTRSVRAYAKADEEE 197 P V+E E A+IK + SF +HQ + V+ YA E Sbjct: 267 PFVREGLEFAVIKV-----------KGQSFMMHQ----IRKMVGLVVAIVKGYAPESVLE 311 Query: 198 ---GEKKV--PKQSLFGNITEALDFSQVRSEKDAELLYEARDSIKDEGRMT--REQY 347 GE+KV PK G + E + F + + L+E D ++EG++T +EQY Sbjct: 312 RSWGEEKVDVPKAPGLGLVLERVHFEKYNQRFGGDGLHEPLDWTQEEGKVTAFKEQY 368
>Q07800:PSR1_YEAST Phosphatase PSR1 - Saccharomyces cerevisiae (Baker's yeast)| Length = 427 Score = 30.4 bits (67), Expect = 7.7 Identities = 18/73 (24%), Positives = 35/73 (47%), Gaps = 3/73 (4%) Frame = +3 Query: 135 KPSSASPTRSVRAYAKADEEEGEKKVPKQSLFGNITEALDFSQVRSE---KDAELLYEAR 305 K +SPT +V A + + EK++ K L+ E + ++ E + ++ E Sbjct: 84 KKKPSSPTAAVTATTTNNMTKVEKRISKDDLYEEKYEVDEDEEIDDEDNRRSRGIVQEKG 143 Query: 306 DSIKDEGRMTREQ 344 D++KD R ++Q Sbjct: 144 DAVKDTSRQKKQQ 156 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 127,615,645 Number of extensions: 2773877 Number of successful extensions: 9512 Number of sequences better than 10.0: 7 Number of HSP's gapped: 9482 Number of HSP's successfully gapped: 7 Length of query: 253 Length of database: 100,686,439 Length adjustment: 111 Effective length of query: 142 Effective length of database: 70,239,694 Effective search space: 9974036548 Effective search space used: 9974036548 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)