| Clone Name | FLbaf3e02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | O74442:UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolas... | 31 | 7.2 | 2 | Q5XG87:POLS_HUMAN DNA polymerase sigma - Homo sapiens (Human) | 31 | 7.3 | 3 | Q3B8K3:RT24B_XENLA 28S ribosomal protein S24-B, mitochondrial pr... | 31 | 9.4 | 4 | Q6NTS3:RT24A_XENLA 28S ribosomal protein S24-A, mitochondrial pr... | 31 | 9.4 |
|---|
>O74442:UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 -| Schizosaccharomyces pombe (Fission yeast) Length = 457 Score = 31.2 bits (69), Expect = 7.2 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +3 Query: 93 YHGDPHVMCYIQNVGAMHPSGFSATTGHMY-FCISSS 200 Y DP+ C+ + +G + +G S +GH Y FC SS+ Sbjct: 361 YMSDPNCSCWYELIGVLVHAGGSTRSGHYYSFCKSSN 397
>Q5XG87:POLS_HUMAN DNA polymerase sigma - Homo sapiens (Human)| Length = 542 Score = 31.2 bits (69), Expect = 7.3 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 3/66 (4%) Frame = +1 Query: 229 KSWGTSCTVPP---MRIRGTTRIAAVGSDSGELREEKSPLPNKAAAISSDPG*LPGKSSA 399 + WG+ P RI+ RIA + + RE +SP + S P L SSA Sbjct: 300 EKWGSKAHPSPGMDSRIKIKERIATCNGEQTQNREPESPYGQRLTLSLSSPQLLSSGSSA 359 Query: 400 SNKSSL 417 S+ SSL Sbjct: 360 SSVSSL 365
>Q3B8K3:RT24B_XENLA 28S ribosomal protein S24-B, mitochondrial precursor - Xenopus| laevis (African clawed frog) Length = 170 Score = 30.8 bits (68), Expect = 9.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 879 AHCLLVSTFYVRKYGRHKHSFYYGYTETCMKSSYIC 986 A+ L++ ++RK K F GYTET + Y C Sbjct: 117 ANLLIICAIFIRKMPTQKFYFLIGYTETLLSFLYKC 152
>Q6NTS3:RT24A_XENLA 28S ribosomal protein S24-A, mitochondrial precursor - Xenopus| laevis (African clawed frog) Length = 170 Score = 30.8 bits (68), Expect = 9.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 879 AHCLLVSTFYVRKYGRHKHSFYYGYTETCMKSSYIC 986 A+ L++ ++RK K F GYTET + Y C Sbjct: 117 ANLLIICAIFIRKMPTQKFYFLIGYTETLLSFLYKC 152 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 178,688,589 Number of extensions: 3996131 Number of successful extensions: 9464 Number of sequences better than 10.0: 4 Number of HSP's gapped: 9459 Number of HSP's successfully gapped: 4 Length of query: 344 Length of database: 100,686,439 Length adjustment: 114 Effective length of query: 230 Effective length of database: 69,416,809 Effective search space: 15965866070 Effective search space used: 15965866070 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)