| Clone Name | FLbaf5i09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q9LST7:PSB3_ORYSJ Proteasome subunit beta type 3 - Oryza sativa ... | 46 | 1e-04 | 2 | O65084:PSB3_PICMA Proteasome subunit beta type 3 - Picea mariana... | 46 | 2e-04 | 3 | O81153:PSB3B_ARATH Proteasome subunit beta type 3-B - Arabidopsi... | 40 | 0.013 | 4 | Q9XI05:PSB3A_ARATH Proteasome subunit beta type 3-A - Arabidopsi... | 40 | 0.013 |
|---|
>Q9LST7:PSB3_ORYSJ Proteasome subunit beta type 3 - Oryza sativa subsp. japonica| (Rice) Length = 204 Score = 46.2 bits (108), Expect = 1e-04 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = +2 Query: 203 SPRRLGV*LRTLSVDFERAFKIHDKLHIGL 292 S RRLGV L+T++ DF+R FKIHDKL+IGL Sbjct: 24 SDRRLGVQLQTVATDFQRVFKIHDKLYIGL 53
>O65084:PSB3_PICMA Proteasome subunit beta type 3 - Picea mariana (Black spruce)| Length = 204 Score = 45.8 bits (107), Expect = 2e-04 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = +2 Query: 203 SPRRLGV*LRTLSVDFERAFKIHDKLHIGL 292 S RRLGV L+T++ DF+R FKIHDKL++GL Sbjct: 24 SDRRLGVQLQTIATDFQRIFKIHDKLYVGL 53
>O81153:PSB3B_ARATH Proteasome subunit beta type 3-B - Arabidopsis thaliana (Mouse-ear| cress) Length = 204 Score = 39.7 bits (91), Expect = 0.013 Identities = 19/30 (63%), Positives = 23/30 (76%) Frame = +2 Query: 203 SPRRLGV*LRTLSVDFERAFKIHDKLHIGL 292 S RRLGV L+T++ DF+R KIHD L IGL Sbjct: 24 SDRRLGVQLQTIATDFQRISKIHDHLFIGL 53
>Q9XI05:PSB3A_ARATH Proteasome subunit beta type 3-A - Arabidopsis thaliana (Mouse-ear| cress) Length = 204 Score = 39.7 bits (91), Expect = 0.013 Identities = 18/30 (60%), Positives = 24/30 (80%) Frame = +2 Query: 203 SPRRLGV*LRTLSVDFERAFKIHDKLHIGL 292 S RRLGV L+T++ DF+R KIHD++ IGL Sbjct: 24 SDRRLGVQLQTIATDFQRISKIHDRVFIGL 53 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 128,775,475 Number of extensions: 2739726 Number of successful extensions: 7215 Number of sequences better than 10.0: 4 Number of HSP's gapped: 7213 Number of HSP's successfully gapped: 4 Length of query: 260 Length of database: 100,686,439 Length adjustment: 111 Effective length of query: 149 Effective length of database: 70,239,694 Effective search space: 10465714406 Effective search space used: 10465714406 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)