ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf5d15 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os05g03610:12005.t00258:unspliced-genomic phospholipase C, putative, expressed| Length = 5864 Score = 38.6 bits (78), Expect = 0.022 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = -2 / -1 Query: 118 PSTAAQPRREGGSRQRQPWPLSVCGSSEFVIPITCIL 8 P A P R G+R R P P S C SS P +C+L Sbjct: 5357 PGAAPAPARSTGTRTRDPMPESTCPSSPSSAPSSCLL 5247
>LOC_Os01g36970:12001.t03246:unspliced-genomic expressed protein| Length = 3245 Score = 38.2 bits (77), Expect = 0.031 Identities = 17/50 (34%), Positives = 22/50 (44%) Frame = +2 / -3 Query: 185 PAFSIPCPLSVSPTQVLLPFALSHVLPTLDCTPCCICNIACKYVCDWGLS 334 P S+ P+S LP A S + LDC C +A Y C W +S Sbjct: 2727 PTTSMNLPMSTPSLPPPLPAARSRLGAILDCISSSFCPVATMYRCSWNVS 2578
>LOC_Os02g26190:12002.t02313:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class, expressed| Length = 15644 Score = 29.9 bits (59), Expect(2) = 0.13 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 / -1 Query: 25 G*RTQRSHRQTEAMAGAGGSLPPSEVAPRCWAC 123 G + +R ++ A AG G+ PP +AP AC Sbjct: 13232 GCQRERREQRAAASAGEEGAAPPLSLAPTATAC 13134 Score = 29.0 bits (57), Expect(2) = 0.13 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +2 / -2 Query: 149 SSSIPRMATCPPPAFSIPCPLSVSPTQVLLP 241 SSS P PPP P P S +P ++LP Sbjct: 12220 SSSPPSQTPPPPPHSPAPAPDSRAPDTLMLP 12128
>LOC_Os03g36684:12003.t03137:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5964 Score = 27.6 bits (54), Expect(2) = 0.13 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 / +2 Query: 205 PPFCIAYSSAATFCVVSCVAYPGLHTLLHM 294 PP C+A V C+A GL LLH+ Sbjct: 2639 PPSCVAAWGGCCVSVACCLAS*GLCCLLHV 2728 Score = 25.8 bits (50), Expect(2) = 0.13 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 / +2 Query: 57 RGHGWRWRLPPS 92 RG G RWR PPS Sbjct: 2612 RGGGGRWRRPPS 2647
>LOC_Os09g15520:12009.t01340:unspliced-genomic oleosin 16 kDa, putative, expressed| Length = 770 Score = 29.5 bits (58), Expect(2) = 0.17 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 / +3 Query: 79 GSLPPSEVAPRCWAC 123 GS PP+ APR WAC Sbjct: 333 GSRPPARSAPRRWAC 377 Score = 24.9 bits (48), Expect(2) = 0.17 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +2 / +1 Query: 281 PCCICNIACKY 313 P C+CN+ C Y Sbjct: 601 PSCLCNVPCVY 633
>LOC_Os09g04280:12009.t00324:unspliced-genomic transposon protein, putative, unclassified| Length = 3129 Score = 29.0 bits (57), Expect(2) = 0.18 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 / +3 Query: 149 SSSIPRMATCPPPAFSIPCPLSVSPTQVLLPFAL 250 S++ P ++ PPP+ + P P+ SPT LP L Sbjct: 390 STAPPPTSSPPPPSAAPPPPIRRSPTPSRLPSTL 491 Score = 24.0 bits (46), Expect(2) = 0.18 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 / +3 Query: 48 QTDRGHGWRWRLPPSLRG 101 QT+ GHG R PP + G Sbjct: 219 QTEAGHGAAPRAPPYISG 272 Score = 28.1 bits (55), Expect(2) = 2.0 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -2 / -3 Query: 88 GGSRQRQPWPLSVC 47 GG+R PWP SVC Sbjct: 259 GGARGAAPWPASVC 218 Score = 24.4 bits (47), Expect(2) = 2.0 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 / -3 Query: 214 RKGAWNTKSGRWTSCHSR 161 RK T G+WTSC R Sbjct: 595 RKATQATMHGQWTSCAPR 542
>LOC_Os12g05920:12012.t00478:unspliced-genomic expressed protein| Length = 2301 Score = 28.6 bits (56), Expect(2) = 0.33 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +2 / +3 Query: 230 VLLPFALSHVLPTLDCTPCCICNIACKYV 316 ++LPF VLP C C + C Y+ Sbjct: 2145 LMLPFYHVDVLPCCHVDFTCFCGVRCSYI 2231 Score = 23.5 bits (45), Expect(2) = 0.33 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +1 / +3 Query: 76 GGSLPPSEVAPRCWACNW 129 G S P+ + P CW C W Sbjct: 1974 GFSWLPNFLLPGCW*CFW 2027
>LOC_Os02g26320:12002.t02326:unspliced-genomic fasciclin-like arabinogalactan protein 10 precursor, putative,| expressed Length = 1158 Score = 34.1 bits (68), Expect = 0.54 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 / +1 Query: 97 RREGGSRQRQPWPLSVCGS 41 RR+GG +QR+PW CGS Sbjct: 865 RRQGGGQQRRPWRRCTCGS 921
>LOC_Os01g14980:12001.t01352:unspliced-genomic pollen-specific protein like, putative, expressed| Length = 2123 Score = 34.1 bits (68), Expect = 0.54 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 / -2 Query: 57 RGHGWRWRLPPSLRG 101 RG WRWR+P SLRG Sbjct: 172 RGKSWRWRVPASLRG 128
>LOC_Os12g42070:12012.t03882:unspliced-genomic OsWAK129a - OsWAK receptor-like protein kinase, expressed| Length = 4075 Score = 33.6 bits (67), Expect = 0.74 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 / -3 Query: 205 PPFCIAYSSAATFCVVSCVAYPGLH 279 PPFC+ YSS + C+ C+ H Sbjct: 2828 PPFCLKYSSLSFLCLFLCICMANTH 2754
>LOC_Os12g42064:12012.t004207:unspliced-genomic OsWAK129c - OsWAK receptor-like protein kinase, expressed| Length = 4674 Score = 33.6 bits (67), Expect = 0.74 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 / +2 Query: 205 PPFCIAYSSAATFCVVSCVAYPGLH 279 PPFC+ YSS + C+ C+ H Sbjct: 1466 PPFCLKYSSLSFLCLFLCICMANTH 1540
>LOC_Os02g10490:12002.t00897:unspliced-genomic expressed protein| Length = 6486 Score = 33.6 bits (67), Expect = 0.74 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = -1 / -2 Query: 416 FFFFFCEKQPTHHFFFKRFQSYPWNQSERGPNH 318 FF +C +P H +FF+ S W++++ ++ Sbjct: 1682 FFPSYCNSRPYHRYFFRHLDSCAWDEAKNSVSY 1584
>LOC_Os04g56790:12004.t05147:unspliced-genomic TLD family protein, expressed| Length = 3828 Score = 28.6 bits (56), Expect(2) = 0.96 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 / +1 Query: 161 PRMATCPPPAFSIPCPLSVSPT 226 PR +T PA + P PLS SPT Sbjct: 361 PRASTTSSPASAPPSPLSSSPT 426 Score = 25.4 bits (49), Expect(2) = 0.96 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +2 / +1 Query: 236 LPFALSHVLPTLDCTPCCICNIACK 310 LPF+ S +D CIC + C+ Sbjct: 3691 LPFSCSPCFMGIDSKQICICIVNCR 3765
>LOC_Os06g41120:12006.t04874:unspliced-genomic expressed protein| Length = 690 Score = 33.1 bits (66), Expect = 1.0 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 / +3 Query: 45 PQTDRGHGWRWRLPPSL 95 P +RG WRWR PPSL Sbjct: 420 PYEERGGRWRWRKPPSL 470
>LOC_Os03g22540:12003.t02004:unspliced-genomic jmjC domain containing protein, expressed| Length = 7077 Score = 33.1 bits (66), Expect = 1.0 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +1 / -2 Query: 196 YSMPPFCIAYSSAATFCVVSCVAYPGLHTLLHM*YS 303 Y P F + YSS A F + YP H+ H+ YS Sbjct: 5912 YENPAFFVFYSSFAQFLTAIEIVYPNRHSHQHILYS 5805
>LOC_Os10g27310:12010.t02137:unspliced-genomic expressed protein| Length = 2158 Score = 27.2 bits (53), Expect(2) = 1.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 / +1 Query: 124 CKPSTAAQPRREGGSRQRQPW 62 C+ T Q +GG+ RQPW Sbjct: 1405 CRGPTCRQSLSDGGASVRQPW 1467 Score = 25.8 bits (50), Expect(2) = 1.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 / +1 Query: 223 RRYRKGAWNTKSGRW 179 RR R+ AW + GRW Sbjct: 1198 RRRRRTAWRERRGRW 1242
>LOC_Os11g36420:12011.t03189:unspliced-genomic sialyltransferase like protein, putative, expressed| Length = 4023 Score = 32.7 bits (65), Expect = 1.4 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = +2 / +3 Query: 149 SSSIPRMATCPPPAFSIPCPLSVSPTQVLLPFALSHVLPTL 271 S+S P MA PPP S+P P +LL AL+ L L Sbjct: 48 SASDPAMARAPPPLSSLPPPPRRPTVVLLLGLALAFCLAVL 170
>LOC_Os02g47280:12002.t04313:unspliced-genomic growth-regulating factor, putative, expressed| Length = 3824 Score = 32.7 bits (65), Expect = 1.4 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 / +2 Query: 33 NSEEPQTDRGHGWRWRLPPSLR 98 + E + +RG GWR R+PP LR Sbjct: 53 SEREIERERGKGWRCRMPPCLR 118
>LOC_Os01g63290:12001.t05698:unspliced-genomic sialin, putative, expressed| Length = 8085 Score = 32.7 bits (65), Expect = 1.4 Identities = 18/67 (26%), Positives = 29/67 (43%) Frame = +2 / +1 Query: 164 RMATCPPPAFSIPCPLSVSPTQVLLPFALSHVLPTLDCTPCCICNIACKYVCDWGLSRFG 343 R+ PPP +S P + S L+ +L +P + + +YV WG +R Sbjct: 4426 RLRPPPPPPYSGPRQGATSAYMAAARPPLAGASTSLCASPASVQAASSRYVASWGFARRR 4605 Query: 344 SRDRIGI 364 SR G+ Sbjct: 4606 SRGPGGV 4626
>LOC_Os09g25890:12009.t02268:unspliced-genomic trehalose-6-phosphate synthase, putative, expressed| Length = 3238 Score = 29.0 bits (57), Expect(2) = 1.5 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -2 / +3 Query: 100 PRREGGSRQRQPWP 59 P+R+GG R+ PWP Sbjct: 2730 PQRQGGGRRHAPWP 2771 Score = 24.0 bits (46), Expect(2) = 1.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -2 / +3 Query: 232 HLSRRYRKGAWNTKSGRWTSCHSR 161 H RR R+GA + G+ T H R Sbjct: 1134 HALRRPRRGARPRRDGQDTGAHQR 1205
>LOC_Os05g43700:12005.t03859:unspliced-genomic conserved hypothetical protein| Length = 2058 Score = 27.2 bits (53), Expect(2) = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 / +2 Query: 248 LSHVLPTLDCTPCCICNI 301 ++H L TL C PC + NI Sbjct: 875 IAHSLLTLSCQPCSLSNI 928 Score = 24.9 bits (48), Expect(2) = 1.8 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 / +2 Query: 182 PPAFSIPCPLSVSPTQVL 235 PPA +P PL SPT L Sbjct: 341 PPAAGLPGPLPRSPTAAL 394
>LOC_Os12g42040:12012.t03879:unspliced-genomic OsWAK126 - OsWAK receptor-like protein kinase, expressed| Length = 2845 Score = 32.2 bits (64), Expect = 1.9 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 / -2 Query: 205 PPFCIAYSSAATFCVVSCVAYPGLH 279 PPFC+ YSS + C+ C H Sbjct: 1782 PPFCLKYSSLSFLCLFLCTCMANTH 1708
>LOC_Os12g18690:12012.t01717:unspliced-genomic hypothetical protein| Length = 2528 Score = 32.2 bits (64), Expect = 1.9 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -1 / -3 Query: 101 TSEGGREPPAPAMASVCLWL 42 T G REPPAPA S C +L Sbjct: 255 TKPGNREPPAPAAGSPCYYL 196
>LOC_Os11g32630:12011.t02859:unspliced-genomic conserved hypothetical protein| Length = 1870 Score = 32.2 bits (64), Expect = 1.9 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -2 / +3 Query: 127 SCKPSTAAQPRREGGSRQRQPWPLSVCGSSE 35 + K + A+ RREG QRQ W +CGS + Sbjct: 1764 TAKVAGGARERREGAG*QRQRWGHPLCGSGD 1856
>LOC_Os08g40190:12008.t03750:unspliced-genomic expressed protein| Length = 1935 Score = 32.2 bits (64), Expect = 1.9 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 / -3 Query: 161 PRMATCPPPAFSIPCPLSVSPTQVLLP 241 PR +C PP+ S P P + SP+ L P Sbjct: 142 PRTTSCSPPSGSTPSPPAPSPSSSLAP 62
>LOC_Os03g45230:12003.t03901:unspliced-genomic expressed protein| Length = 1282 Score = 32.2 bits (64), Expect = 1.9 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -2 / -1 Query: 184 RWTSCHSRDXXXXXXXXXASCKPSTAAQPRREGGSRQRQPW 62 RW H R A P +PRR G RQ PW Sbjct: 403 RWIGAHRRRARHRGPGAAAPAPPPRPRRPRRRGALRQAPPW 281
>LOC_Os05g31740:12005.t02771:unspliced-genomic cytochrome P450 86A2, putative, expressed| Length = 1941 Score = 25.4 bits (49), Expect(2) = 2.0 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -2 / -3 Query: 124 CKPSTAAQPRREGGSRQRQPW 62 C+P+ +++PRR G W Sbjct: 1066 CRPARSSRPRRAGAGASPPAW 1004 Score = 24.0 bits (46), Expect(2) = 2.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 / -3 Query: 214 RKGAWNTKSGRWTSCHSR 161 R+GA SGR TSC R Sbjct: 1114 RRGARRATSGRTTSCPCR 1061
>LOC_Os09g31462:12009.t02793:unspliced-genomic hypothetical protein| Length = 402 Score = 26.7 bits (52), Expect(2) = 2.2 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 / +2 Query: 69 WRWRLPPSLRG 101 WRWR PP RG Sbjct: 86 WRWRRPPPRRG 118 Score = 21.7 bits (41), Expect(2) = 2.2 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 / +2 Query: 39 EEPQTDRGHGWRWR 80 EE T R WRWR Sbjct: 50 EEEGTARRWRWRWR 91
>LOC_Os07g08660:12007.t00741:unspliced-genomic 40S ribosomal protein S15, putative, expressed| Length = 2095 Score = 29.0 bits (57), Expect(2) = 2.5 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 / +3 Query: 149 SSSIPRMATCPPPAFSIPCPLSVSPTQVLLPFALSHVL 262 +S+ R +TCPP S P + + VLLP L+ V+ Sbjct: 249 ASTSTRSSTCPPMTSSSSSPRAPAEGVVLLPTHLASVM 362 Score = 22.6 bits (43), Expect(2) = 2.5 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = +1 / +2 Query: 358 WNLLKKKWCVGC 393 W+L+K WC C Sbjct: 758 WSLIKLSWCWIC 793
>LOC_Os06g51500:12006.t04833:unspliced-genomic expressed protein| Length = 2774 Score = 25.8 bits (50), Expect(2) = 2.6 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 / +2 Query: 179 PPPAFSIPCPLSVSPTQVLLP 241 PPPA S P P P + LP Sbjct: 239 PPPAISCPAPAPSPPHRCPLP 301 Score = 23.1 bits (44), Expect(2) = 2.6 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 / +2 Query: 239 PFALSHVLPTLDCTP 283 P +LSH LP+ C P Sbjct: 371 PLSLSHPLPSPRCPP 415
>LOC_Os12g36180:12012.t03303:unspliced-genomic auxilin-like protein, putative, expressed| Length = 7199 Score = 31.8 bits (63), Expect = 2.6 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = +2 / -2 Query: 152 SSIPRMATCPPPAFSIPCPLSVSPTQVLLPFALSHVLPTLDCTPCCICNIAC 307 SS P + P S P S T LL S L TL C P C C C Sbjct: 3061 SSSPLLRFSSCPLSSFPSVYSSPLTCFLLSSLNSSPLCTLACLPLCFCTCFC 2906
>LOC_Os08g22170:12008.t01998:unspliced-genomic hypothetical protein| Length = 228 Score = 31.8 bits (63), Expect = 2.6 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 / -1 Query: 115 STAAQPRREGGSRQRQPWP 59 S AA PRR+ R+R PWP Sbjct: 183 SRAASPRRDRARRRRSPWP 127
>LOC_Os07g20730:12007.t01877:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 7143 Score = 31.8 bits (63), Expect = 2.6 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -1 / +1 Query: 347 WNQSERGPNHRHIYMLYYICNKVC 276 WNQ R H+ IY+LY + NK C Sbjct: 589 WNQLLRCLCHKLIYLLYLVINKSC 660
>LOC_Os06g22140:12006.t02029:unspliced-genomic thioredoxin reductase 2, putative, expressed| Length = 4204 Score = 31.8 bits (63), Expect = 2.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 / -3 Query: 124 CKPSTAAQPRREGGSRQRQPWP 59 C+ S + RR GG +R+PWP Sbjct: 644 CRGSRMRRSRRNGGGARRRPWP 579
>LOC_Os05g12140:12005.t01044:unspliced-genomic Leucine Rich Repeat family protein, expressed| Length = 2913 Score = 31.8 bits (63), Expect = 2.6 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 / +2 Query: 25 G*RTQRSHRQTEAMAGAGGSLPPSEVAPRC 114 G R++RSHR+ +AG S+P SE + C Sbjct: 431 GDRSERSHRRRRGVAGLPRSIPVSEGSEAC 520
>LOC_Os04g35160:12004.t03187:unspliced-genomic metal ion transporter, putative, expressed| Length = 3195 Score = 31.8 bits (63), Expect = 2.6 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 / +1 Query: 109 AAQPRREGGSRQRQPW 62 A +PRR GG RQRQ W Sbjct: 568 AGEPRRRGGRRQRQGW 615
>LOC_Os01g72450:12001.t06533:unspliced-genomic DNA-binding protein, putative, expressed| Length = 845 Score = 31.8 bits (63), Expect = 2.6 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +1 / -3 Query: 31 RTQRSHRQTEAMAGAGGSLPPSEVAPRCWACNW 129 R RS R+ A A P+ P WAC+W Sbjct: 252 RPPRSRRRAPARRAASPPRSPASRPPAAWACSW 154
>LOC_Os12g41460:12012.t03822:unspliced-genomic hypothetical protein| Length = 3553 Score = 31.3 bits (62), Expect = 3.6 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 / -3 Query: 127 SCKPSTAAQPRREGGSRQRQPWP 59 SC P T+ PRR G R+RQ P Sbjct: 2399 SCSPLTSILPRRRGSRRRRQVQP 2331
>LOC_Os09g32670:12009.t02881:unspliced-genomic protein capI, putative, expressed| Length = 2030 Score = 31.3 bits (62), Expect = 3.6 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 / +2 Query: 149 SSSIPRMATCPPPAFSIPCPLSVSPT 226 SS P MATCP P + P P + S T Sbjct: 1340 SSPCPAMATCPSPTPTSPTPPTTSAT 1417
>LOC_Os05g50434:12005.t04694:unspliced-genomic expressed protein| Length = 7509 Score = 31.3 bits (62), Expect = 3.6 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 / +3 Query: 281 PCCICNIACKYVCDWGLSRFG 343 PCCI +I C+Y C S+ G Sbjct: 2283 PCCILSILCRYGCSIVFSKLG 2345
>LOC_Os03g47749:12003.t04135:unspliced-genomic conserved hypothetical protein| Length = 880 Score = 31.3 bits (62), Expect = 3.6 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +1 / +1 Query: 22 SG*RTQRSHRQTEAMAGAGGSLPPSEVAPRCWACN 126 SG* T + R+ EA GAGG P+ A AC+ Sbjct: 358 SG*ATGQDGRRREAQQGAGGDGAPTAAADTVLACH 462
>LOC_Os03g07120:12003.t00578:unspliced-genomic expressed protein| Length = 4833 Score = 31.3 bits (62), Expect = 3.6 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 / +1 Query: 118 PSTAAQPRREGGSRQRQPWP 59 P+ +++PRR GG+ PWP Sbjct: 4630 PTPSSRPRRSGGAASTTPWP 4689
>LOC_Os01g67410:12001.t06098:unspliced-genomic AP2/EREBP transcription factor BABY BOOM, putative, expressed| Length = 4350 Score = 31.3 bits (62), Expect = 3.6 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +1 / -1 Query: 217 IAYSSAATFCVVSCVAYPGLHTLL 288 ++Y+SAA+ CV +CV P HT L Sbjct: 3108 MSYASAASSCVPACVTPPSSHTPL 3037
>LOC_Os01g50259:12001.t04461:unspliced-genomic hypothetical protein| Length = 2239 Score = 31.3 bits (62), Expect = 3.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 / +2 Query: 127 SCKPSTAAQPRREGGSRQRQPW 62 SC PS A RR G SR PW Sbjct: 407 SCTPSRGAACRRSGASRGSSPW 472
>LOC_Os01g07140:12001.t00594:unspliced-genomic kelch motif family protein, expressed| Length = 5697 Score = 31.3 bits (62), Expect = 3.6 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 / +3 Query: 182 PPAFSIPCPLSVSPTQVLLPFALSHVLPTLDCTPCC 289 PP+F PL V TQV LP S + C CC Sbjct: 1128 PPSFFSGKPLPVGTTQVNLPELQSSNKGIIPCAVCC 1235
>LOC_Os01g52470:12001.t04674:unspliced-genomic elongation factor 2, putative, expressed| Length = 3253 Score = 28.1 bits (55), Expect(2) = 3.7 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 / -1 Query: 275 CTPCCICNIACKYVCD 322 CT CC C+ C CD Sbjct: 2155 CTACCACSAICS*RCD 2108 Score = 23.5 bits (45), Expect(2) = 3.7 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +2 / -1 Query: 164 RMATCPPPAFSIPCP 208 R CPPP++ CP Sbjct: 2653 RRRRCPPPSWEPGCP 2609
>LOC_Os11g43040:12011.t03834:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2752 Score = 29.0 bits (57), Expect(2) = 4.2 Identities = 14/43 (32%), Positives = 17/43 (39%) Frame = -2 / +3 Query: 190 SGRWTSCHSRDXXXXXXXXXASCKPSTAAQPRREGGSRQRQPW 62 + R +SC S SC P TA R GG R+ W Sbjct: 1902 TSRTSSCTSTSTGRPTAAASPSCSPRTARTWTRRGGRRRPCTW 2030 Score = 22.1 bits (42), Expect(2) = 4.2 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -2 / +3 Query: 214 RKGAWNTKSGRWTS 173 R+G W RWTS Sbjct: 1266 RRGGWTC*GRRWTS 1307
>LOC_Os05g41400:12005.t03678:unspliced-genomic indole-3-acetate beta-glucosyltransferase, putative, expressed| Length = 1518 Score = 28.6 bits (56), Expect(2) = 4.5 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 / -2 Query: 123 ASPAPRRNLGGREGAASASHGLC 55 A+ APRR GGR GA +A C Sbjct: 383 AAAAPRRERGGRGGARTAPPSWC 315 Score = 21.7 bits (41), Expect(2) = 4.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 / -3 Query: 348 LEPKRERPQSQTYL 307 LEP+RERP + L Sbjct: 1453 LEPRRERPLASAKL 1412
>LOC_Os10g02620:12010.t00151:unspliced-genomic GAGA-binding protein, putative, expressed| Length = 2822 Score = 24.0 bits (46), Expect(2) = 4.7 Identities = 6/13 (46%), Positives = 7/13 (53%) Frame = +1 / -2 Query: 91 PSEVAPRCWACNW 129 P +PRCW W Sbjct: 2248 PGTPSPRCWRTGW 2210 Score = 24.0 bits (46), Expect(2) = 4.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 / -3 Query: 260 LPTLDCTPCCI 292 L TL C PCC+ Sbjct: 2163 LSTLGCLPCCL 2131
>LOC_Os01g42780:12001.t03795:unspliced-genomic cysteine proteinase EP-B 2 precursor, putative, expressed| Length = 1656 Score = 26.3 bits (51), Expect(2) = 4.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 / +2 Query: 226 SRRYRKGAWNTKSGRWTSCHSR 161 SRR+R+ ++ S R TSC SR Sbjct: 776 SRRWRRRRGSSSSPRATSCRSR 841 Score = 24.0 bits (46), Expect(2) = 4.9 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -2 / +3 Query: 109 AAQPRREGGSRQR 71 AAQPRR GG +R Sbjct: 1176 AAQPRRHGGGLRR 1214
>LOC_Os12g15420:12012.t01397:unspliced-genomic pre-mRNA-splicing factor cwc-22, putative, expressed| Length = 6206 Score = 30.9 bits (61), Expect = 5.0 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 / +3 Query: 88 PPSEVAPRCWACNW 129 PP + P CWAC W Sbjct: 3720 PPRGLRPSCWACRW 3761
>LOC_Os10g36703:12010.t003593:unspliced-genomic OsSAUR56 - Auxin-responsive SAUR gene family member, expressed| Length = 1019 Score = 30.9 bits (61), Expect = 5.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 / +1 Query: 173 TCPPPAFSIPCPLSVSPTQVLLP 241 TCPPP+ + P P S SP+ P Sbjct: 61 TCPPPSATPPSPSSASPSPAPTP 129
>LOC_Os10g31040:12010.t02434:unspliced-genomic arsenite transport protein, putative, expressed| Length = 13444 Score = 30.9 bits (61), Expect = 5.0 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 / +2 Query: 233 LLPFALSHVLPTLDCTPCCICNIACKYVCD 322 LL FAL+H+L L C C Y+CD Sbjct: 242 LLKFALNHMLMCLFL*NMCTCATMLAYICD 331
>LOC_Os07g11070:12007.t00981:unspliced-genomic expressed protein| Length = 3954 Score = 30.9 bits (61), Expect = 5.0 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 / -1 Query: 149 SSSIPRMATCPPPAFSIPCPLSVSPTQ 229 S +PR A+CPPP S P V P + Sbjct: 924 SPPLPRPASCPPPPLSPPPMAGVRPAR 844
>LOC_Os06g21730:12006.t01990:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3203 Score = 30.9 bits (61), Expect = 5.0 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -1 / +2 Query: 362 FQSYPWNQSERGPNHR 315 F+S+PWN+ R P+HR Sbjct: 3095 FKSHPWNRCSRRPSHR 3142
>LOC_Os05g14170:12005.t01192:unspliced-genomic expressed protein| Length = 9380 Score = 30.9 bits (61), Expect = 5.0 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +2 / -1 Query: 176 CPPPAFSIPCPLSVSPTQVLLPFALSHVLPT 268 CPPP+ +P PL P P L PT Sbjct: 1454 CPPPSSPLPSPLLPPPHPTEAPLFLPRAAPT 1362
>LOC_Os04g06870:12004.t00562:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5147 Score = 30.9 bits (61), Expect = 5.0 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 / +3 Query: 33 NSEEPQTDRGHGWRWR 80 N + P+ +RGHGWR R Sbjct: 969 NDDHPEFERGHGWRCR 1016 Score = 29.9 bits (59), Expect = 9.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -2 / -2 Query: 112 TAAQPRREGGSRQRQPWPLSVCGSS 38 +++ P SRQRQPWP S G S Sbjct: 1048 SSSSPSPSPSSRQRQPWPRSNSGWS 974
>LOC_Os02g30624:12002.t05482:unspliced-genomic small nuclear ribonucleoprotein F, putative, expressed| Length = 4676 Score = 30.9 bits (61), Expect = 5.0 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -3 / -2 Query: 357 ILSLEPKRERPQSQTYLHAILH 292 +LS E K+E P+S+ Y+H+ +H Sbjct: 1189 VLSDEEKKELPESKPYMHSYIH 1124
>LOC_Os04g41900:12004.t03745:unspliced-genomic expressed protein| Length = 1119 Score = 24.9 bits (48), Expect(2) = 5.1 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +2 / +3 Query: 149 SSSIPRMATCPPPAFSIPCPLSVSPTQVLLPFALSHVLPT 268 +SS R A+CPP S + SP+ P A S PT Sbjct: 237 ASSRSRSASCPPSTASSSSSSTRSPSPPPSPGAPSSRRPT 356 Score = 23.1 bits (44), Expect(2) = 5.1 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 / +2 Query: 31 RTQRSHRQTEAMAGAGGSLPPS 96 R+Q+ H+Q + M G PP+ Sbjct: 83 RSQQQHQQQKQMGGLSVIAPPA 148
>LOC_Os03g38490:12003.t03291:unspliced-genomic DAG protein, chloroplast precursor, putative, expressed| Length = 5022 Score = 27.6 bits (54), Expect(2) = 5.3 Identities = 16/53 (30%), Positives = 22/53 (41%) Frame = +2 / +2 Query: 197 IPCPLSVSPTQVLLPFALSHVLPTLDCTPCCICNIACKYVCDWGLSRFGSRDR 355 IP L S +QV L + +C C+C C VC+ R R+R Sbjct: 1598 IPHRLCESDSQVRDWCGLHACVRLCECVCVCVCVCVCVCVCERERERERERER 1756 Score = 24.0 bits (46), Expect(2) = 5.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 / +3 Query: 149 SSSIPRMATCPPPAFSIPCPLSVS 220 +SSIPR PPP P ++V+ Sbjct: 216 TSSIPRPPPPPPPPLVKPVAIAVA 287
>LOC_Os03g03180:12003.t00204:unspliced-genomic domain of unknown function DUF614 containing protein, expressed| Length = 3564 Score = 28.1 bits (55), Expect(2) = 5.3 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = -2 / +1 Query: 124 CKPSTAAQPRREGGSRQRQPWPLSVCGSSEFVIPITCIL 8 C+P+T + RE GS PW C I + +L Sbjct: 2878 CRPNTKLKWTREMGSSAHSPWQCLQCSKCRASISLFHLL 2994 Score = 23.1 bits (44), Expect(2) = 5.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -1 / +1 Query: 389 PTHHFFFKRF 360 P HHFFF F Sbjct: 2752 PVHHFFFAGF 2781
>LOC_Os11g07960:12011.t00687:unspliced-genomic anthranilate N-benzoyltransferase protein 1, putative, expressed| Length = 2041 Score = 26.7 bits (52), Expect(2) = 5.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 / -1 Query: 116 QHRGATSEGGREPPAP 69 + RG+ GGR PPAP Sbjct: 271 RRRGSGRRGGRRPPAP 224 Score = 23.5 bits (45), Expect(2) = 5.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 / -3 Query: 226 SRRYRKGAWNTKSGRW 179 SRR R+ A +SGRW Sbjct: 1316 SRRRRRSA*GWRSGRW 1269
>LOC_Os02g29030:12002.t02597:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 15522 Score = 24.9 bits (48), Expect(3) = 6.2 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 / -1 Query: 176 CPPPAFSIPCPLS 214 C PP S+PCP S Sbjct: 11052 CCPPLCSLPCPSS 11014 Score = 24.4 bits (47), Expect(3) = 6.2 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 / -3 Query: 37 QRSHRQTEAMAGAGGSLPPSEVAPRCW 117 +R+HR++ + A +PPSE W Sbjct: 14221 ERNHRRSRSPPAARNRVPPSEPCA*RW 14141 Score = 23.1 bits (44), Expect(3) = 6.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 / -2 Query: 200 PCPLSVSPTQVLLPFALS 253 PCP S + +Q+ +PF LS Sbjct: 2447 PCPHSHN*SQMSMPFHLS 2394
>LOC_Os02g34370:12002.t03076:unspliced-genomic expressed protein| Length = 3132 Score = 27.6 bits (54), Expect(2) = 6.4 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 / +2 Query: 69 WRWRLPPSLRG 101 WRWR PP RG Sbjct: 701 WRWRRPPGARG 733 Score = 23.1 bits (44), Expect(2) = 6.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 / +1 Query: 158 IPRMATCPPPAFSIP 202 +P AT PP FS+P Sbjct: 1939 LPPSATPSPPPFSVP 1983
>LOC_Os04g46680:12004.t04197:unspliced-genomic cys2/His2 zinc-finger transcription factor, putative, expressed| Length = 1388 Score = 24.9 bits (48), Expect(2) = 6.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 / +2 Query: 98 SEGGREPPAPAMAS 57 S+GG PPAPA A+ Sbjct: 587 SDGGDAPPAPAAAA 628 Score = 22.6 bits (43), Expect(2) = 6.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 / +3 Query: 124 CKPSTAAQPRR 92 C P+T QPRR Sbjct: 507 CSPATPGQPRR 539
>LOC_Os10g38440:12010.t03086:unspliced-genomic hypothetical protein| Length = 1718 Score = 27.2 bits (53), Expect(2) = 6.8 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 / -3 Query: 61 AMAGAGGSLPPSEVAPRC 114 A A AGG + P +V PRC Sbjct: 1572 AAAVAGGDISPPQVKPRC 1519 Score = 22.6 bits (43), Expect(2) = 6.8 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +2 / -3 Query: 152 SSIPRMATCPPPAFSIPC 205 SS+ ++ PPP PC Sbjct: 561 SSLDHLSRFPPPKTDFPC 508
>LOC_Os12g27254:12012.t02438:unspliced-genomic 3-N-debenzoyl-2-deoxytaxol N-benzoyltransferase, putative, expressed| Length = 7210 Score = 30.4 bits (60), Expect = 6.8 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +1 / -2 Query: 49 RQTEAMAGAGGSLPPSEVAPRCWACNW 129 RQ A G+ P+ P WAC+W Sbjct: 3897 RQAPARQGSSPPCSPASQPPAAWACSW 3817
>LOC_Os12g07190:12012.t00603:unspliced-genomic CBS domain containing protein, expressed| Length = 5068 Score = 30.4 bits (60), Expect = 6.8 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 / +1 Query: 46 HRQTEAMAGAGGSLPPSEVAPRCWACNW 129 HR +A+ AG S VA CWA W Sbjct: 4567 HRGDKAITAAGSCTQESVVACSCWADGW 4650
>LOC_Os10g04870:12010.t00367:unspliced-genomic conserved hypothetical protein| Length = 246 Score = 30.4 bits (60), Expect = 6.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 / -2 Query: 179 PPPAFSIPCPLSVSPTQVLLP 241 PPP ++PC SP++ LLP Sbjct: 65 PPPPCTLPCAPMASPSRALLP 3
>LOC_Os09g08420:12009.t00636:unspliced-genomic protein kinase G11A, putative, expressed| Length = 3636 Score = 30.4 bits (60), Expect = 6.8 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 / -2 Query: 233 LLPFALSHVLPTLDCTPCCICNIACKYVC 319 LL F S LPTL+ + C +C+ C Y C Sbjct: 1142 LLWFGPSVSLPTLNHSTCEVCSRCCIYCC 1056
>LOC_Os08g19710:12008.t01789:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3161 Score = 30.4 bits (60), Expect = 6.8 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 / +2 Query: 359 QSYPWNQSERGPNHR 315 +SYPWN+ R P+HR Sbjct: 3104 ESYPWNRRSRCPSHR 3148
>LOC_Os08g07300:12008.t00619:unspliced-genomic HAD-superfamily hydrolase, subfamily IA, variant 1, putative,| expressed Length = 10289 Score = 30.4 bits (60), Expect = 6.8 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 / -2 Query: 269 LDCTPCCICNIACKYVCDWGLSRF 340 LD + C C+ C C WGL+R+ Sbjct: 5080 LDASDTCDCDPWCSIECLWGLTRY 5009
>LOC_Os07g46970:12007.t04333:unspliced-genomic sex determination protein tasselseed-2, putative, expressed| Length = 1895 Score = 30.4 bits (60), Expect = 6.8 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 / +2 Query: 117 PAPRRNLGGREGAASASHGLCL 52 P RR + GR+GA S GLCL Sbjct: 1829 PRRRRRVHGRQGARPGSSGLCL 1894
>LOC_Os07g38450:12007.t03510:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4213 Score = 30.4 bits (60), Expect = 6.8 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +2 / -1 Query: 161 PRMATCPPPAFSIPCPLSVSPTQVLLPFALSH 256 PR C P A + P +SPT LL LSH Sbjct: 2047 PRGRLCLPQASGLDTPGPISPTAALLSRPLSH 1952
>LOC_Os06g30080:12006.t02712:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3201 Score = 30.4 bits (60), Expect = 6.8 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 / +3 Query: 359 QSYPWNQSERGPNHR 315 +SYPWN+ R P+HR Sbjct: 3096 ESYPWNRRSRCPSHR 3140
>LOC_Os06g24704:12006.t02280:unspliced-genomic acyl-coenzyme A oxidase 2, putative, expressed| Length = 8874 Score = 30.4 bits (60), Expect = 6.8 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 / +2 Query: 185 PAFSIPCPLSVSPTQVLLPFALSH 256 P+ S+PC LSVS T L + LSH Sbjct: 3638 PSSSMPCTLSVSTTCSLSNYCLSH 3709
>LOC_Os06g19460:12006.t01765:unspliced-genomic expressed protein| Length = 973 Score = 30.4 bits (60), Expect = 6.8 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +2 / -1 Query: 149 SSSIPRMATCPPPAFSIPCPLSVSPTQVLLPFALSHVLPT 268 ++S+ TCPPP + P P S S + + V+P+ Sbjct: 307 TTSVRTSCTCPPPPSTTPLPCSFSSRNASTSASTAAVVPS 188
>LOC_Os05g39270:12005.t03469:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6022 Score = 30.4 bits (60), Expect = 6.8 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 / +1 Query: 359 QSYPWNQSERGPNHR 315 +SYPWN+ R P+HR Sbjct: 5917 ESYPWNRCSRCPSHR 5961
>LOC_Os05g28740:12005.t02522:unspliced-genomic universal stress protein, putative, expressed| Length = 1295 Score = 30.4 bits (60), Expect = 6.8 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 / +2 Query: 30 TNSEEPQTDRGHGWRWRLPPSLRGC 104 T+ EE + DR GW WR + R C Sbjct: 152 TSPEEEEEDRRGGWWWRWTRARRAC 226
>LOC_Os05g03530:12005.t00250:unspliced-genomic senescence-associated protein-like, putative, expressed| Length = 2596 Score = 30.4 bits (60), Expect = 6.8 Identities = 14/60 (23%), Positives = 24/60 (40%) Frame = -1 / +3 Query: 416 FFFFFCEKQPTHHFFFKRFQSYPWNQSERGPNHRHIYMLYYICNKVCSPG*ATHETTQKV 237 FF + H FF + + + P N H HIY+ + + + H T Q++ Sbjct: 1020 FFHIYISSSNHHLFFIRDYTTAPNNSK*DDCLHTHIYITFIRTSSILHLSKIMHHTAQEL 1199
>LOC_Os04g41260:12004.t03686:unspliced-genomic protoporphyrinogen oxidase, mitochondrial, putative, expressed| Length = 8107 Score = 30.4 bits (60), Expect = 6.8 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 / +3 Query: 173 TCPPPAFSIPCPLSVSPTQVLLPFALSHVLPTLDCT 280 +C P+FS PC + + + LP + HV CT Sbjct: 1908 SCVLPSFSCPCEIQIYTSYHTLPLVIFHVKLLKLCT 2015
>LOC_Os04g13680:12004.t01187:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1895 Score = 30.4 bits (60), Expect = 6.8 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 / +1 Query: 326 GLSRFGSRDRIGIS*KRNGVWAVFRKKKKK 415 G R G R+G +R G WA FR K K+ Sbjct: 490 GERRLGGLGRLGRGKEREGFWAGFRPKAKR 579
>LOC_Os03g51740:12003.t04503:unspliced-genomic 1-aminocyclopropane-1-carboxylate synthase 1, putative, expressed| Length = 2266 Score = 30.4 bits (60), Expect = 6.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 / -3 Query: 49 RQTEAMAGAGGSLPPSEVAPRCWA 120 R+ + +GGS PPS RCWA Sbjct: 1625 RRRTTGSASGGSCPPSRRGRRCWA 1554
>LOC_Os03g45779:12003.t05702:unspliced-genomic expressed protein| Length = 1433 Score = 30.4 bits (60), Expect = 6.8 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +2 / -1 Query: 149 SSSIPRMATCPPPAFSIPCPLSVSPTQVLLPFALS 253 S+++PR CPPP P PL Q PFA S Sbjct: 251 SNALPRPPRCPPPVPRPPQPLRRLRQQPPHPFASS 147
>LOC_Os03g44310:12003.t03819:unspliced-genomic translation initiation factor eIF-2B delta subunit, putative,| expressed Length = 5492 Score = 30.4 bits (60), Expect = 6.8 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 / +2 Query: 223 RRYRKGAWNTKSGRWTS 173 R R+GAW+ +SGRW S Sbjct: 158 RARRRGAWSPRSGRWGS 208
>LOC_Os03g40084:12003.t03442:unspliced-genomic hypothetical protein| Length = 1213 Score = 30.4 bits (60), Expect = 6.8 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -3 / +1 Query: 120 SPAPRRNLGGREGAASASHGLCL 52 SPA +R LGGR G +AS+ L L Sbjct: 40 SPASKRKLGGRGGGVTASYWLKL 108
>LOC_Os03g06240:12003.t00493:unspliced-genomic YT521-B-like family protein, expressed| Length = 4551 Score = 30.4 bits (60), Expect = 6.8 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 / +2 Query: 215 VSPTQVLLPFALSHVLPTLDCTPCCICNI 301 VS + ++LPF +L T++CT C I N+ Sbjct: 1331 VS*S*IILPFPFHVILLTINCTMCHILNV 1417
>LOC_Os02g28530:12002.t02547:unspliced-genomic hypothetical protein| Length = 2254 Score = 30.4 bits (60), Expect = 6.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 / +3 Query: 149 SSSIPRMATCPPPAFSIPC 205 SS PR++T PPP S PC Sbjct: 387 SSVAPRLSTAPPPLASPPC 443
>LOC_Os02g20120:12002.t01804:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3152 Score = 30.4 bits (60), Expect = 6.8 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 / +3 Query: 359 QSYPWNQSERGPNHR 315 +SYPWN+ R P+HR Sbjct: 3090 ESYPWNRCSRCPSHR 3134
>LOC_Os01g43190:12001.t03835:unspliced-genomic conserved hypothetical protein| Length = 2926 Score = 30.4 bits (60), Expect = 6.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 / +2 Query: 161 PRMATCPPPAFSIPCPLSVSPTQ 229 PR A C PP S P PL +PT+ Sbjct: 1862 PRHARCRPPPASRPPPLPTAPTR 1930
>LOC_Os01g08620:12001.t00740:unspliced-genomic conserved hypothetical protein| Length = 312 Score = 30.4 bits (60), Expect = 6.8 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +2 / -2 Query: 155 SIPRMATCPPPAFSIPCPLSVSPTQVLLP 241 SI T PPP S+P P SV V+LP Sbjct: 254 SICAPCTSPPPPRSLPSPRSVVALDVVLP 168
>LOC_Os01g03510:12001.t00242:unspliced-genomic stress protein, putative, expressed| Length = 5205 Score = 30.4 bits (60), Expect = 6.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 / +1 Query: 275 CTPCCICNIACKYV 316 C+PC ICN C Y+ Sbjct: 4369 CSPCMICNCMCTYI 4410
>LOC_Os01g34420:12001.t03000:unspliced-genomic expressed protein| Length = 897 Score = 25.4 bits (49), Expect(2) = 6.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 / +2 Query: 45 PQTDRGHGWRWRLPP 89 P++ GWR RLPP Sbjct: 239 PRSPPSRGWRHRLPP 283 Score = 23.5 bits (45), Expect(2) = 6.9 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +2 / +3 Query: 149 SSSIPRMATCPPPAFSIPCP 208 S+S PR+ T P+ S CP Sbjct: 588 SASAPRIPTATRPSVSPACP 647
>LOC_Os06g39090:12006.t03607:unspliced-genomic FAR1 family protein| Length = 9791 Score = 26.3 bits (51), Expect(2) = 6.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 / -2 Query: 357 ILSLEPKRERPQSQTYLHAILHMQQGVQSRV 265 ILS R R +TYL + HM+ ++ R+ Sbjct: 6040 ILSTSSTRLRYPERTYL*VVRHMKDPIEKRI 5948 Score = 25.8 bits (50), Expect(2) = 6.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 / -3 Query: 403 FAKNSPHTISFSRDSNPI 350 F+ SPH + F SNP+ Sbjct: 9309 FSSESPHVVLFRATSNPV 9256
>LOC_Os01g60860:12001.t05467:unspliced-genomic spotted leaf protein 11, putative, expressed| Length = 2493 Score = 28.1 bits (55), Expect(2) = 7.0 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 / +3 Query: 34 TQRSHRQTEAMAGAGGSLPPSEVAPR 111 + R+ R+T A GGS P S+ APR Sbjct: 1044 SSRAARRTIASRSTGGSAPASQRAPR 1121 Score = 22.1 bits (42), Expect(2) = 7.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 / +3 Query: 149 SSSIPRMATCPPPAFSIPCPLSVSPTQ 229 SS R A+C P A S P+S +P + Sbjct: 1506 SSRPTRSASCTPTAPSRRSPIS*APAR 1586
>LOC_Os12g04490:12012.t00338:unspliced-genomic conserved hypothetical protein| Length = 1038 Score = 25.8 bits (50), Expect(2) = 7.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 / +3 Query: 155 SIPRMATCPPPAFSIPCPL 211 S P +AT PPA + P PL Sbjct: 822 SAPLLATAAPPAAAPPAPL 878 Score = 23.1 bits (44), Expect(2) = 7.9 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 / +3 Query: 73 AGGSLPPSEVAPRCW 117 AGG PP PR W Sbjct: 153 AGGGRPPRAAPPR*W 197
>LOC_Os02g53960:12002.t04975:unspliced-genomic gibberellin receptor GID1L2, putative| Length = 1086 Score = 27.2 bits (53), Expect(2) = 8.2 Identities = 15/51 (29%), Positives = 22/51 (43%) Frame = -2 / -3 Query: 223 RRYRKGAWNTKSGRWTSCHSRDXXXXXXXXXASCKPSTAAQPRREGGSRQR 71 RR + + T R + C R +S +P +PRR GG+R R Sbjct: 358 RRATRRSRGTSWRRRSPCRRRRRGRRRPGGASSRRPRRRPRPRRRGGTRGR 206 Score = 21.7 bits (41), Expect(2) = 8.2 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -1 / -3 Query: 77 PAPAMASVCLW 45 PAPA AS CL+ Sbjct: 37 PAPATASSCLF 5
>LOC_Os11g17870:12011.t01560:unspliced-genomic conserved hypothetical protein| Length = 471 Score = 24.0 bits (46), Expect(2) = 8.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 / -2 Query: 167 MATCPPPAFSIPCPL 211 M + PPPA S+P P+ Sbjct: 287 MPSAPPPASSLPPPV 243 Score = 22.6 bits (43), Expect(2) = 8.3 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +1 / -1 Query: 64 MAGAGGSLPPSEVAPR 111 + G+GG PP + PR Sbjct: 465 LGGSGGGEPPPPLGPR 418
>LOC_Os01g37280:12001.t03273:unspliced-genomic expressed protein| Length = 3492 Score = 24.0 bits (46), Expect(2) = 8.4 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 / +1 Query: 48 QTDRGHGWRWRLP 86 Q G GWRW LP Sbjct: 136 QQGGGGGWRWFLP 174 Score = 23.1 bits (44), Expect(2) = 8.4 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +2 / +2 Query: 176 CPPPAFSIPCPLSVSPTQVLLPFALS 253 CPP + +++ P + LPF+LS Sbjct: 170 CPPADLARGRSVALPPPLLALPFSLS 247
>LOC_Os10g41350:12010.t03371:unspliced-genomic transposon protein, putative, Pong sub-class| Length = 2948 Score = 24.0 bits (46), Expect(2) = 8.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 / +2 Query: 164 RMATCPPPAFSIPC 205 R+ PPP F IPC Sbjct: 2060 RLPCHPPPLFLIPC 2101 Score = 23.1 bits (44), Expect(2) = 8.5 Identities = 6/13 (46%), Positives = 7/13 (53%) Frame = +2 / +3 Query: 269 LDCTPCCICNIAC 307 L C CC C + C Sbjct: 2136 LSCRHCCFCLLRC 2174
>LOC_Os03g09290:12003.t00782:unspliced-genomic protein yippee-like OJ1003C07.11, putative, expressed| Length = 2564 Score = 24.4 bits (47), Expect(2) = 8.6 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 / +2 Query: 317 CDWGLSRFGSRDRIGIS 367 C W L+RFG +G+S Sbjct: 497 CGWRLTRFGIPCELGVS 547 Score = 22.6 bits (43), Expect(2) = 8.6 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +2 / +2 Query: 197 IPCPLSVSPTQVLLPFALSHVLPTLDCTPCCIC 295 +P P S+S + FA S V T CC C Sbjct: 401 LPIPCSLSLLNLFAVFASSSVPVTWIKMICCGC 499
>LOC_Os12g19010:12012.t01749:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2470 Score = 23.5 bits (45), Expect(2) = 8.6 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 / +1 Query: 46 HRQTEAMAGAGGSLPP 93 HR A GAG LPP Sbjct: 1366 HRHRRARRGAGRPLPP 1413 Score = 23.5 bits (45), Expect(2) = 8.6 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 / +3 Query: 79 GSLPPSEVAPRCW 117 G+ P +APRCW Sbjct: 1527 GAKRPLRLAPRCW 1565
>LOC_Os07g18130:12007.t01672:unspliced-genomic hypothetical protein| Length = 4766 Score = 28.1 bits (55), Expect(2) = 9.1 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 / +2 Query: 30 TNSEEPQTDRGHGWRWRLPPSLR 98 T S PQ+DR HG LPP R Sbjct: 1484 TASPSPQSDRFHGAPVHLPPDAR 1552 Score = 22.6 bits (43), Expect(2) = 9.1 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +1 / +3 Query: 238 TFCVVSCVAY 267 + C+VSCVAY Sbjct: 3042 SLCLVSCVAY 3071
>LOC_Os01g16860:12001.t01535:unspliced-genomic AGO4-2, putative| Length = 1018 Score = 24.4 bits (47), Expect(2) = 9.2 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 / -2 Query: 191 FSIPCPLSVSPTQVLLPFALSHV 259 FS+ CPLS S ++ FA + Sbjct: 957 FSVSCPLSTSAMALMGSFAAKEI 889 Score = 22.6 bits (43), Expect(2) = 9.2 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 / -2 Query: 333 LALVPGIGLESLEKEMVCGLFFAKKKKK 416 L+L PG+ E +V L AKK KK Sbjct: 843 LSLPPGLPSSPPELRLVVVLHTAKKPKK 760
>LOC_Os06g47320:12006.t04418:unspliced-genomic T-complex protein 1 subunit eta, putative, expressed| Length = 5027 Score = 23.5 bits (45), Expect(3) = 9.3 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +2 / +1 Query: 275 CTPCCICN 298 C PCC CN Sbjct: 3226 CLPCCNCN 3249 Score = 22.6 bits (43), Expect(3) = 9.3 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 / +3 Query: 161 PRMATCPPPAFSIPCPLSVSP 223 PR + PPP P +S+SP Sbjct: 99 PRCSPPPPPPPPPPPQISISP 161 Score = 22.6 bits (43), Expect(3) = 9.3 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +1 / +3 Query: 196 YSMPPFCIAYSSAATFCVVSCVAYP 270 Y +PP + Y T+ V+YP Sbjct: 1179 YHLPPVLVVYLQPVTYT*K*AVSYP 1253
>LOC_Os12g42060:12012.t03881:unspliced-genomic OsWAK128b - OsWAK receptor-like protein kinase, expressed| Length = 3588 Score = 29.9 bits (59), Expect = 9.4 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 / -1 Query: 205 PPFCIAYSSAATFCVVSCVAYPGLHTL 285 PPFC+ YS + C++ C +H + Sbjct: 2328 PPFCLKYSIFSFLCLLLCNCIINMHAI 2248
>LOC_Os12g20169:12012.t01859:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 7270 Score = 29.9 bits (59), Expect = 9.4 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 / +1 Query: 359 QSYPWNQSERGPNHR 315 QS+PWN+ R P+HR Sbjct: 7180 QSHPWNRCSRRPSHR 7224
>LOC_Os10g29560:12010.t02297:unspliced-genomic expressed protein| Length = 8503 Score = 29.9 bits (59), Expect = 9.4 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 / -2 Query: 40 RSHRQTEAMAGAGGSLPPSEVAPRC 114 RS R AG+GG P+E AP C Sbjct: 7683 RSRRSGAGSAGSGGRGSPAEAAPTC 7609
>LOC_Os10g18550:12010.t01403:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3197 Score = 29.9 bits (59), Expect = 9.4 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 / +2 Query: 359 QSYPWNQSERGPNHR 315 +SYPWN+ R P+HR Sbjct: 3092 ESYPWNRCTRCPSHR 3136
>LOC_Os09g39050:12009.t03372:unspliced-genomic F-box domain containing protein, expressed| Length = 1449 Score = 29.9 bits (59), Expect = 9.4 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 / -3 Query: 223 RRYRKGAWNTKSGRWTSCHSR 161 R R+G+W + GRW +C R Sbjct: 316 RTSRRGSWRGRRGRWPACGRR 254
>LOC_Os09g38470:12009.t03315:unspliced-genomic hypothetical protein| Length = 4219 Score = 29.9 bits (59), Expect = 9.4 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = +1 / -3 Query: 4 QKEYK*SG*RTQRSHRQTEAMAGAGGSLPPSEVAPRCWACNW 129 Q+E + G R +R HRQ PS RCW W Sbjct: 2864 QREKRRCGTRERRGHRQPGRAVAVVVKRRPSGDGDRCWRGQW 2739
>LOC_Os08g28410:12008.t02598:unspliced-genomic retinal pigment epithelial membrane protein, expressed| Length = 10196 Score = 29.9 bits (59), Expect = 9.4 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 / +2 Query: 197 IPCPLSVSPTQVLLPFALSHVLPTLDCTPC 286 IPC S++PT+V+ ++ LPT C C Sbjct: 326 IPCCPSIAPTRVVFACGSTYGLPTTYCGFC 415
>LOC_Os08g17610:12008.t01632:unspliced-genomic expressed protein| Length = 3415 Score = 29.9 bits (59), Expect = 9.4 Identities = 8/11 (72%), Positives = 11/11 (100%) Frame = +1 / -2 Query: 355 DWNLLKKKWCV 387 DW+LLK+KWC+ Sbjct: 1320 DWDLLKRKWCM 1288
>LOC_Os07g47610:12007.t04395:unspliced-genomic transposon protein, putative, Ac/Ds sub-class| Length = 5154 Score = 29.9 bits (59), Expect = 9.4 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 / -1 Query: 208 PFCIAYSSAATFCVVSCVAYP 270 P+C SSA T +V+C+ YP Sbjct: 975 PYCFNPSSAITLTLVTCIFYP 913
>LOC_Os07g26840:12007.t02380:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3148 Score = 29.9 bits (59), Expect = 9.4 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 / +1 Query: 359 QSYPWNQSERGPNHR 315 +SYPWN+ R P HR Sbjct: 3094 ESYPWNRCSRCPGHR 3138
>LOC_Os07g08729:12007.t00747:unspliced-genomic ATP-dependent DNA helicase 2 subunit 1, putative, expressed| Length = 11043 Score = 29.9 bits (59), Expect = 9.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +2 / -2 Query: 179 PPPAFSIPCPLSVSPTQVLLP 241 PPP+ +P PLS SP + L P Sbjct: 7523 PPPSLHLPDPLSTSPPRSLPP 7461
>LOC_Os06g44460:12006.t04134:unspliced-genomic D-3-phosphoglycerate dehydrogenase, chloroplast precursor, putative,| expressed Length = 3699 Score = 29.9 bits (59), Expect = 9.4 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 / +2 Query: 275 CTPCCICNIACKYVCDWGLSRFGSRDRIGI 364 C PC AC+ C WG GS D I I Sbjct: 2849 CYPC*ETRSACRATCSWGKWD*GSEDWIFI 2938
>LOC_Os06g42110:12006.t03902:unspliced-genomic expressed protein| Length = 509 Score = 29.9 bits (59), Expect = 9.4 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 / -2 Query: 158 IPRMATCPPPAFSIPCPLSVSPTQVLLPFALSHVLPTLDCTPCCI 292 I R + PP ++P LS S T LLP + +H+L P C+ Sbjct: 196 IGRSRSRRPPHPTLPQSLSPSSTLSLLPRSAAHLLSCCCTWPMCL 62
>LOC_Os05g50470:12005.t04479:unspliced-genomic expressed protein| Length = 1383 Score = 29.9 bits (59), Expect = 9.4 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -2 / +3 Query: 118 PSTAAQPRREGGSRQRQPWPLSVCGSS 38 P+TA P RQR P P S+C SS Sbjct: 516 PATALAPGPRQRRRQRHPPPASLCSSS 596
>LOC_Os05g38620:12005.t03404:unspliced-genomic zinc finger, C2H2 type family protein| Length = 621 Score = 29.9 bits (59), Expect = 9.4 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -2 / -3 Query: 121 KPSTAAQPRREGGSRQRQ 68 +PST PRR GG+R+R+ Sbjct: 307 RPSTTTTPRRRGGARRRR 254
>LOC_Os04g50770:12004.t04555:unspliced-genomic myb-related protein Zm1, putative, expressed| Length = 1952 Score = 29.9 bits (59), Expect = 9.4 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 / -1 Query: 149 SSSIPRMATCPPPAFSIPC 205 +S R A+CPPPA + PC Sbjct: 227 TSECRRRASCPPPASTTPC 171
>LOC_Os04g42600:12004.t03808:unspliced-genomic polyadenylate-binding protein 2, putative, expressed| Length = 7248 Score = 29.9 bits (59), Expect = 9.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 / -1 Query: 121 KPSTAAQPRREGGSRQRQPWP 59 +P TA PRR G R+R+P P Sbjct: 462 RPRTATAPRRPRGPRRRRPLP 400
>LOC_Os04g18340:12004.t01577:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 7743 Score = 29.9 bits (59), Expect = 9.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -1 / +3 Query: 347 WNQSERGPNHRHIYMLYYICNKVC 276 WNQ R H+ IY+L+ + NK C Sbjct: 3330 WNQLLRFLCHKLIYLLFLVINKSC 3401
>LOC_Os03g53660:12003.t04685:unspliced-genomic XIF, putative, expressed| Length = 9362 Score = 29.9 bits (59), Expect = 9.4 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 / -2 Query: 179 PPPAFSIPCPLSVSPTQVLLPFALSHVLP 265 P P S+ P+ + +L PF L HVLP Sbjct: 5638 PAPLLSLVVPVQLLVLHLLSPFLLLHVLP 5552
>LOC_Os03g42920:12003.t03693:unspliced-genomic conserved hypothetical protein| Length = 501 Score = 29.9 bits (59), Expect = 9.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 / -3 Query: 179 PPPAFSIPCPLSVSPTQVLLPFA 247 PPP S+PC SP+ +PF+ Sbjct: 217 PPPPLSVPCEPPPSPSSFPVPFS 149
>LOC_Os03g12430:12003.t01042:unspliced-genomic PPR repeat containing protein, putative, expressed| Length = 1866 Score = 29.9 bits (59), Expect = 9.4 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +2 / +1 Query: 161 PRMATCPPPAFSIPCPLSVSPTQVLLPFALSHVL 262 PR A PPPA +P PL P P + VL Sbjct: 214 PRQAPLPPPAPPLPTPLPPVPPVAPSPLLAAPVL 315
>LOC_Os03g11330:12003.t00933:unspliced-genomic transferase, transferring glycosyl groups, putative, expressed| Length = 6254 Score = 29.9 bits (59), Expect = 9.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 / +2 Query: 226 SRRYRKGAWNTKSGRWTSCHS 164 +R YRK +W+ KS W SC S Sbjct: 3236 TRGYRKPSWSQKSLPWRSCGS 3298
>LOC_Os02g33600:12002.t03003:unspliced-genomic VQ motif family protein, expressed| Length = 1023 Score = 29.9 bits (59), Expect = 9.4 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 / +1 Query: 149 SSSIPRMATCPPPAFSIPCPLSVSPTQVLLPFA 247 SSS A+ PP F +P +SPT L P A Sbjct: 529 SSSSSASASALPPQFQLPQEFMLSPTAALSPAA 627
>LOC_Os02g30660:12002.t02759:unspliced-genomic hypothetical protein| Length = 225 Score = 29.9 bits (59), Expect = 9.4 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +2 / -2 Query: 149 SSSIPRMATCPPPAFSIPCPLSVSPTQVLLPFALSHVLPTL 271 S ++P + PPP +I C ++ PT + L + +LPT+ Sbjct: 146 SGAVPAGISTPPPKLAILCCFAMLPTPLPLLHPGTALLPTV 24
>LOC_Os02g26270:12002.t02321:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3467 Score = 29.9 bits (59), Expect = 9.4 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 / -3 Query: 209 LSVSPTQVLLPFALSHVLPTLDCTPCCICNIAC 307 LS SP + PF + LP DC C + IAC Sbjct: 3222 LSRSPVVLQAPF*RRNNLPWRDCWSCVLDTIAC 3124
>LOC_Os02g25840:12002.t02278:unspliced-genomic expressed protein| Length = 2131 Score = 29.9 bits (59), Expect = 9.4 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +2 / +1 Query: 152 SSIPRMATCPPPAFSIPCPLSVSPTQVLLPFALSHVLPTLD 274 S PR+A ++ +P P S P L P A + P+LD Sbjct: 106 SPAPRLAGMAVASYPLPIPRSPRPDAALPPDASTDTAPSLD 228
>LOC_Os02g19310:12002.t01724:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3156 Score = 29.9 bits (59), Expect = 9.4 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 / +3 Query: 359 QSYPWNQSERGPNHR 315 +SYPWN+ R P+HR Sbjct: 3099 KSYPWNRCSRCPSHR 3143
>LOC_Os01g73514:12001.t06632:unspliced-genomic 5-oxoprolinase, putative, expressed| Length = 7122 Score = 29.9 bits (59), Expect = 9.4 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 / -2 Query: 236 LPFALSHVLPTLDCTPCCICNIACK 310 LP + H PTL +PCC+ +A + Sbjct: 185 LPCSARHRAPTLPPSPCCVAPVAVR 111
>LOC_Os01g35050:12001.t03060:unspliced-genomic HYP1, putative, expressed| Length = 11019 Score = 29.9 bits (59), Expect = 9.4 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 / +3 Query: 275 CTPCCICNIACKY 313 C P CIC++ CKY Sbjct: 5724 CAPDCICSVPCKY 5762
>LOC_Os01g17320:12001.t01578:unspliced-genomic DNA-binding protein, putative, expressed| Length = 4338 Score = 29.9 bits (59), Expect = 9.4 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = +1 / +3 Query: 211 FCIAYSSAATFCVVSCVAYPGLHTLLHM*YSM*ICL 318 FCI+++ + +++C +P H LL + + + CL Sbjct: 888 FCISFACESMSRIITCTYHPMFHALLILIFGLANCL 995
>LOC_Os06g48320:12006.t04518:unspliced-genomic lipid binding protein, putative, expressed| Length = 3552 Score = 26.7 bits (52), Expect(2) = 9.5 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +3 / -1 Query: 45 PQTDRGHGWRWR 80 P+ RG GWRWR Sbjct: 801 PRRARGGGWRWR 766 Score = 23.5 bits (45), Expect(2) = 9.5 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 / -2 Query: 281 PCCICNIAC 307 PCC C+ AC Sbjct: 44 PCCCCSSAC 18
>LOC_Os01g21310:12001.t01868:unspliced-genomic conserved hypothetical protein| Length = 702 Score = 25.8 bits (50), Expect(2) = 9.9 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +1 / +1 Query: 208 PFCIAYSSAATFCVVSCV 261 P C+ +S + T C+ SC+ Sbjct: 541 PACLEWSISGTVCMTSCI 594 Score = 22.1 bits (42), Expect(2) = 9.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 / +1 Query: 149 SSSIPRMATCPPPAFSIPCPLSVSPT 226 SSS P T PPA SPT Sbjct: 229 SSSTPGCGTASPPASPTTTSTPSSPT 306 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 187,111,343 Number of extensions: 3324368 Number of successful extensions: 24777 Number of sequences better than 10.0: 137 Length of query: 138 Length of database: 55,613,886 Length adjustment: 47 Effective length of query: 91 Effective length of database: 52,968,820 Effective search space: 4820162620 Effective search space used: 4820162620 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
