| Clone Name | FLbaf5b13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q6P4Y6:IRS1_XENTR Insulin receptor substrate 1 - Xenopus tropica... | 32 | 3.1 | 2 | Q60177:PSMA_METJA Proteasome alpha subunit - Methanococcus janna... | 30 | 9.0 | 3 | P70661:NGN3_MOUSE Neurogenin-3 - Mus musculus (Mouse) | 30 | 9.0 |
|---|
>Q6P4Y6:IRS1_XENTR Insulin receptor substrate 1 - Xenopus tropicalis (Western clawed| frog) (Silurana tropicalis) Length = 654 Score = 32.0 bits (71), Expect = 3.1 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = +2 Query: 383 GPCRRPSIEHGAPTYRRLPGGNRSEPSPHASADCRCS 493 GPCR P+ +YR LP + EP P A A C S Sbjct: 492 GPCRVPA------SYRSLPRSYKMEPQPSARASCSSS 522
>Q60177:PSMA_METJA Proteasome alpha subunit - Methanococcus jannaschii| Length = 261 Score = 30.4 bits (67), Expect = 9.0 Identities = 17/57 (29%), Positives = 31/57 (54%) Frame = -2 Query: 407 RSTDGGRDRPVGQSLLQPQRRRRVGLDED*PEDLHVLTRARLDVLVQDVDPSLLLLR 237 ++T G RPV LL+ + R + LDE + LT+A D+ ++VD ++ ++ Sbjct: 162 KATAIGSGRPVVMELLEKEYRDDITLDEGLELAITALTKANEDIKPENVDVCIITVK 218
>P70661:NGN3_MOUSE Neurogenin-3 - Mus musculus (Mouse)| Length = 214 Score = 30.4 bits (67), Expect = 9.0 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -2 Query: 479 LPKHVGWARIG-CRREAVGTSERRARSTDGGRDRPVGQSLLQPQRRRR 339 +P+ A +G CR GTS R+ R+ GGR+RP + L QRR R Sbjct: 42 IPRDCSEAEVGDCR----GTS-RKLRARRGGRNRPKSELALSKQRRSR 84 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 139,719,977 Number of extensions: 3118967 Number of successful extensions: 8333 Number of sequences better than 10.0: 3 Number of HSP's gapped: 8330 Number of HSP's successfully gapped: 3 Length of query: 279 Length of database: 100,686,439 Length adjustment: 112 Effective length of query: 167 Effective length of database: 69,965,399 Effective search space: 11684221633 Effective search space used: 11684221633 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)