| Clone Name | FLbaf4h05 |
|---|---|
| Clone Library Name | barley_pub |
>Q7TQP2:GP135_MOUSE Probable G-protein coupled receptor 135 - Mus musculus (Mouse)| Length = 457 Score = 33.1 bits (74), Expect = 1.8 Identities = 18/45 (40%), Positives = 25/45 (55%) Frame = +3 Query: 54 SQPENRPSAMSDGQGNAPPGGTYPSAVPIAFSLCSV*NESLVNSS 188 ++P RP+A + QG+A PGG +A A S SV +L N S Sbjct: 5 ARPPGRPAASATLQGSAHPGGAASTATAAALSFSSVATVTLGNQS 49
>P31382:PMT2_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 2 -| Saccharomyces cerevisiae (Baker's yeast) Length = 759 Score = 32.0 bits (71), Expect = 4.1 Identities = 22/57 (38%), Positives = 29/57 (50%) Frame = -1 Query: 828 IETYGPDSASNPPAVTCTAHHGWACRSNW*LHRRRGMDSWRSETETKAEALDTARAF 658 I+TY PD SN VTC + + W +R RG+ SW SE ET E L ++ Sbjct: 365 IQTY-PDG-SNQQQVTCYGYKD--ANNEWFFNRERGLPSW-SENETDIEYLKPGTSY 416
>Q810L3:CHFR_MOUSE E3 ubiquitin-protein ligase CHFR - Mus musculus (Mouse)| Length = 664 Score = 32.0 bits (71), Expect = 4.1 Identities = 26/89 (29%), Positives = 40/89 (44%), Gaps = 3/89 (3%) Frame = -1 Query: 441 EDCSQPEQAQGGPAAVLSPWARRCLPDGR*SSLQ*PHTSTGFIL---AKQPAKVDGTEGG 271 +DCS P Q +LSP A+ CL + + P TST +L + + + T G Sbjct: 146 KDCSGPGQGDDPQVPLLSPMAQTCLEEPQ------PSTSTSDLLPTASTSSTEPELTSAG 199 Query: 270 DRNLGSGIRFNTWLC*LIHRSVSPRGGST 184 ++ S NT S+SP+G S+ Sbjct: 200 QKHSSSSGPGNT--------SISPKGRSS 220
>Q7TQN7:GP135_RAT Probable G-protein coupled receptor 135 - Rattus norvegicus (Rat)| Length = 457 Score = 31.2 bits (69), Expect = 7.0 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +3 Query: 54 SQPENRPSAMSDGQGNAPPGGTYPSAVPIAFSLCSV*NESLVNSS 188 ++P +RP+A + G+A PGG +A A S SV +L N S Sbjct: 5 ARPPSRPAASATLPGSAHPGGAASTATAAALSFSSVATVTLGNQS 49
>Q8R2H5:PHLD_RAT Phosphatidylinositol-glycan-specific phospholipase D precursor -| Rattus norvegicus (Rat) Length = 843 Score = 30.8 bits (68), Expect = 9.1 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 4/60 (6%) Frame = -3 Query: 277 GRRPKSWFRHQI*HMVVLINPPLRL--SQRW--IDELTKLSFHTEQSEKAMGTADGYVPP 110 G SWF + + H V + N L L S W I + + S Q +K++G GY PP Sbjct: 574 GEEDFSWFGYSL-HGVTVANRSLLLIGSPTWKNISRMARSSHQKNQEKKSLGRVYGYFPP 632 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 177,104,276 Number of extensions: 3938080 Number of successful extensions: 11071 Number of sequences better than 10.0: 5 Number of HSP's gapped: 11053 Number of HSP's successfully gapped: 5 Length of query: 337 Length of database: 100,686,439 Length adjustment: 114 Effective length of query: 223 Effective length of database: 69,416,809 Effective search space: 15479948407 Effective search space used: 15479948407 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)