ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf131a21 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os08g02640:12008.t00158:unspliced-genomic succinate dehydrogenase iron-sulfur protein,mitochondrial| precursor, putative, expressed Length = 3537 Score = 226 bits (488), Expect(4) = e-147 Identities = 88/100 (88%), Positives = 92/100 (92%) Frame = +1 / +1 Query: 469 SEAAGASTISPLPHMFVVKDLVVDMTNFYNQYKSVEPWLKRKDPASAGGKEIYQSKADRA 648 S A+ ASTISPLPHMFV+KDLVVDMTNFYNQYKSVEPWLKRKD GKEI Q+KADRA Sbjct: 448 SSASSASTISPLPHMFVIKDLVVDMTNFYNQYKSVEPWLKRKDAPPQPGKEIPQTKADRA 627 Query: 649 KLDGMYECILCACCSTSCPSYWWNPEEYLGPAALLHANRW 768 KLDGMYECILCACCSTSCPSYWWNPEEYLGPAALLHANR+ Sbjct: 628 KLDGMYECILCACCSTSCPSYWWNPEEYLGPAALLHANRY 747 Score = 204 bits (439), Expect(4) = e-147 Identities = 80/87 (91%), Positives = 84/87 (96%) Frame = +1 / +1 Query: 229 TKTFSIYRWDPDSPSTKPHLKDYKVDLSDCGPMVLDALLKIKNEQDPSLTFRRSCREGIC 408 TKTFSIYRWDPDSPSTKPHLKDYKVDLSDCGPMVLD LLKIKNEQDPSLTFRRSCREGIC Sbjct: 211 TKTFSIYRWDPDSPSTKPHLKDYKVDLSDCGPMVLDVLLKIKNEQDPSLTFRRSCREGIC 390 Query: 409 GSCAMNIDGDNGLACLTKISSEAAGAS 489 GSCAMNIDGDNGLACLTKISS ++ ++ Sbjct: 391 GSCAMNIDGDNGLACLTKISSASSAST 471 Score = 140 bits (301), Expect(4) = e-147 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = +1 / +3 Query: 763 RWIQDSRDEFTKERLDSINDEFKLYRCHTIKNCTHACPKGLNPAKQIDTIKKLQLGA*V 939 RWIQDSRD+FTKERLDSINDEFKLYRCHTIKNCTHACPKGLNPAK IDTIKKLQL A*V Sbjct: 3000 RWIQDSRDQFTKERLDSINDEFKLYRCHTIKNCTHACPKGLNPAKHIDTIKKLQLEA*V 3176 Score = 24.4 bits (47), Expect(4) = e-147 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 / +3 Query: 1127 HHILMLMHEVIH 1162 H+++ MHEVIH Sbjct: 3426 HYVVRFMHEVIH 3461 Score = 186 bits (401), Expect(4) = e-109 Identities = 83/101 (82%), Positives = 87/101 (86%) Frame = -1 / -2 Query: 770 IHLLAWSSAAGPRYSSGFHQ*DGQDVEQQAQRMHSYMPSSLARSALDW*ISFPPADAGSL 591 ++LLAW SAAGPRYSSGFHQ*+GQ+VEQQAQRMHSYMPSSLARSAL ISFP SL Sbjct: 749 VYLLAWRSAAGPRYSSGFHQ*EGQEVEQQAQRMHSYMPSSLARSALVCGISFPGCGGASL 570 Query: 590 RLSHGSTLLYWL*KLVMSTTRSLTTNMCGSGEIVEAPAASE 468 RLSHGSTLLYWL*KLVMSTTRSL TNM GSGEIVEA A E Sbjct: 569 RLSHGSTLLYWL*KLVMSTTRSLMTNMWGSGEIVEAEDADE 447 Score = 159 bits (341), Expect(4) = e-109 Identities = 70/82 (85%), Positives = 75/82 (91%) Frame = -1 / -2 Query: 473 SEEILVRQASPLSPSMFMAQLPQMPSRQLRRKVRDGSCSFLILRSASSTMGPQSERSTL* 294 ++EILVRQA PLSPSMF+AQLPQ+PSRQLRRKV DGSCSFLIL S SST+GPQSERSTL* Sbjct: 455 ADEILVRQARPLSPSMFIAQLPQIPSRQLRRKVSDGSCSFLILSSTSSTIGPQSERSTL* 276 Query: 293 SLRWGFVDGESGSQR*IEKVLV 228 SLRWGFVDGESGS *IE VLV Sbjct: 275 SLRWGFVDGESGSHL*IENVLV 210 Score = 97.7 bits (207), Expect(4) = e-109 Identities = 44/60 (73%), Positives = 52/60 (86%) Frame = -3 / -2 Query: 942 SHSGSELQLLYCVDLLCRVQPLGAGMRAVLDGVAAVQLELVVDGVKALLCELITAVLDPP 763 +HSG EL+LL CVD+L V+ LGAG+ AVLDGVAAVQLELVVDG++ALL EL+TAVL PP Sbjct: 3179 AHSGLELELLDCVDVLRWVEALGAGVCAVLDGVAAVQLELVVDGIQALLSELVTAVLYPP 3000 Score = 24.0 bits (46), Expect(4) = e-109 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -2 / -2 Query: 1168 KFMNYFMHEHQNMM 1127 K MNYFMH+ ++M Sbjct: 3467 KSMNYFMHKPHDIM 3426 Score = 107 bits (228), Expect(4) = 8e-69 Identities = 46/57 (80%), Positives = 46/57 (80%) Frame = +3 / +3 Query: 486 LHDLAAPAHVRRQGPRRRHDQLLQPVQERRAVAQAQGPGVGRREGDLPVQGRPRQAR 656 LHDLAAP HVR QGPRRRHDQLLQPVQER AVAQAQG REGD QGRPRQAR Sbjct: 465 LHDLAAPPHVRHQGPRRRHDQLLQPVQERGAVAQAQGRAAAAREGDPADQGRPRQAR 635 Score = 100 bits (213), Expect(4) = 8e-69 Identities = 43/59 (72%), Positives = 46/59 (77%) Frame = +3 / +2 Query: 762 QVDPRQP**VHKGAP*LHQRRVQAVPLPHHQELHACLPQGAEPCKADRHNKEAAARSLS 938 QVD QP* VH GAP HQRRVQAVPLPHHQELH LPQG +P +A RHN+EA AR LS Sbjct: 2999 QVDTGQP*PVH*GAPGFHQRRVQAVPLPHHQELHTRLPQGPQPSEAHRHNQEAPARGLS 3175 Score = 93.6 bits (198), Expect(4) = 8e-69 Identities = 39/56 (69%), Positives = 40/56 (71%) Frame = +3 / +3 Query: 228 HQXXXXXXXXXXFPVDEAPPQGLQGGPLRLRPHGARRAPQDQERAGPVPHLPPELP 395 HQ VDEAPPQGLQGGPLRLR GARRA QDQERAGPV HLPP+LP Sbjct: 210 HQDVLDLQVGSRLAVDEAPPQGLQGGPLRLRADGARRAAQDQERAGPVAHLPPQLP 377 Score = 30.4 bits (60), Expect(4) = 8e-69 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +2 / +2 Query: 713 GGTQKSISAPQRCSMPTG 766 GGT +S SAP R S PTG Sbjct: 692 GGTPRSTSAPPRSSTPTG 745 Score = 174 bits (374), Expect(3) = 1e-58 Identities = 70/96 (72%), Positives = 71/96 (73%) Frame = -2 / -3 Query: 787 HHGCLGSTCWHGAALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLR 608 H G TCW G A RGR T GSTSR GR WSSRRRGCTRTC RAWRGRPW+ SPS Sbjct: 766 HLGRWWYTCWRGGARRGRGTPRGSTSRRGRRWSSRRRGCTRTCRRAWRGRPWSAGSPSRA 587 Query: 607 PTPGPCA*ATARRSCTGCRSWSCRRRGP*RRTCAGA 500 PCA*ATA RSCTGCRSWSCRRRGP* RTC GA Sbjct: 586 AAARPCA*ATAPRSCTGCRSWSCRRRGP**RTCGGA 479 Score = 78.5 bits (165), Expect(3) = 1e-58 Identities = 32/42 (76%), Positives = 33/42 (78%) Frame = -2 / -1 Query: 889 GSAPWGRHACSS*WCGSGTA*TRR*WSQGAPL*THHGCLGST 764 G PWGR CSS*WCGSGTA*TRR*W+ GAP *T HGC ST Sbjct: 3126 G*GPWGRRVCSS*WCGSGTA*TRR*WNPGAP**TGHGCPVST 3001 Score = 23.5 bits (45), Expect(3) = 1e-58 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 / -3 Query: 271 TGNPGPSGRSRRSWC 227 T + P+ RSR SWC Sbjct: 253 TASRDPTCRSRTSWC 209 Score = 115 bits (246), Expect = 6e-25 Identities = 52/74 (70%), Positives = 54/74 (72%) Frame = -1 / -3 Query: 938 TQAPSCSFFIVSICFAGFSPLGQACVQFLMVWQRYSLNSSLMESRRSFVNSSRLSWIHLL 759 TQA S SF IVS+CFAG PLGQACVQFLMVWQRYSLNSSLMESRRS VN SRLS IHL Sbjct: 3175 TQASSWSFLIVSMCFAGLRPLGQACVQFLMVWQRYSLNSSLMESRRSLVNWSRLSCIHLK 2996 Query: 758 AWSSAAGPRYSSGF 717 S G+ Sbjct: 2995 QGMDVHRTEQSQGY 2954 Score = 91.3 bits (193), Expect = 1e-17 Identities = 43/66 (65%), Positives = 47/66 (71%) Frame = -3 / -1 Query: 765 PVGMEQRCGAEILFWVPPVGRAGCGAAGAEDALVHAIEXXXXXXXXXXXLPSGRRRVLAL 586 PVG+E+R GAE+L VPPVG AG GAAGAEDALVHA+E LP RRRVLAL Sbjct: 744 PVGVEERGGAEVLLGVPPVGGAGGGAAGAEDALVHAVELGAVGLGLRDLLPGLRRRVLAL 565 Query: 585 EPRLDA 568 EPRL A Sbjct: 564 EPRLHA 547
>LOC_Os09g20440:12009.t01778:unspliced-genomic succinate dehydrogenase and fumarate reductase iron-sulfur protein,| expressed Length = 2516 Score = 331 bits (717), Expect(2) = 4e-98 Identities = 123/195 (63%), Positives = 152/195 (77%) Frame = +1 / +2 Query: 232 KTFSIYRWDPDSPSTKPHLKDYKVDLSDCGPMVLDALLKIKNEQDPSLTFRRSCREGICG 411 K F +YRW PD+PS +PHL+ Y VDL+ CGPMVLD L KIK E D +L FRRSCREGICG Sbjct: 1706 KEFRVYRWSPDAPSRRPHLQSYHVDLATCGPMVLDVLQKIKAEHDATLAFRRSCREGICG 1885 Query: 412 SCAMNIDGDNGLACLTKISSEAAGASTISPLPHMFVVKDLVVDMTNFYNQYKSVEPWLKR 591 SC+M IDG N +ACL + ++ + A+T++PLPHM+VV+DLVVD+T+FY QYKSVEPWLKR Sbjct: 1886 SCSMCIDGVNTVACLRPVDTDTSSATTVTPLPHMYVVRDLVVDLTSFYQQYKSVEPWLKR 2065 Query: 592 KDPASAGGKEIYQSKADRAKLDGMYECILCACCSTSCPSYWWNPEEYLGPAALLHANRWI 771 K E QS +R +LDG+YECILCACCS +CPSYWWN E +LGPAALLHA RW+ Sbjct: 2066 KTKTKTETTEHAQSPEERKRLDGLYECILCACCSAACPSYWWNAEAFLGPAALLHAYRWV 2245 Query: 772 QDSRDEFTKERLDSI 816 DSRDE+ ER+ ++ Sbjct: 2246 SDSRDEYAAERVQAL 2290 Score = 48.3 bits (99), Expect(2) = 4e-98 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +1 / +2 Query: 829 KLYRCHTIKNCTHACPKGLNPAKQIDTIKKL 921 KLYRC IK+CT CPK L+PA I +K L Sbjct: 2306 KLYRCRMIKSCTATCPKSLDPAAAISAMKTL 2398 Score = 109 bits (232), Expect(3) = 6e-42 Identities = 60/112 (53%), Positives = 64/112 (57%) Frame = -1 / -3 Query: 584 SHGSTLLYWL*KLVMSTTRSLTTNMCGSGEIVEAPAASEEILVRQASPLSPSMFMAQLPQ 405 SHGST LY *KLV STTRSLTT M GSG V A S +R A+ +PSM M PQ Sbjct: 2058 SHGSTDLYCW*KLVRSTTRSLTTYMWGSGVTVVADEVSVSTGLRHATVFTPSMHMEHDPQ 1879 Query: 404 MPSRQLRRKVRDGSCSFLILRSASSTMGPQSERSTL*SLRWGFVDGESGSQR 249 MPSR RR SCS LI SSTMGP RST R G +G SG R Sbjct: 1878 MPSRHDRRNASVASCSALIFCRTSSTMGPHVARSTWYDCRCGRREGASGLHR 1723 Score = 72.1 bits (151), Expect(3) = 6e-42 Identities = 36/58 (62%), Positives = 38/58 (65%) Frame = -1 / -3 Query: 803 RSFVNSSRLSWIHLLAWSSAAGPRYSSGFHQ*DGQDVEQQAQRMHSYMPSSLARSALD 630 RS SSRLS H A SSAAGPR +S FHQ*DG Q A RMHSY PSSL S+ D Sbjct: 2277 RSAAYSSRLSDTHRYACSSAAGPRNASAFHQ*DGHAALQHAHRMHSYSPSSLFLSSGD 2104 Score = 29.0 bits (57), Expect(3) = 6e-42 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 / -1 Query: 892 QGSAPWGRHACSS*WCGSGTA 830 +G WGR CSS* GSG A Sbjct: 2369 RGRGSWGRWPCSS*SSGSGRA 2307 Score = 81.7 bits (172), Expect(2) = 2e-17 Identities = 46/101 (45%), Positives = 50/101 (49%) Frame = -2 / -1 Query: 802 APL*THHGCLGSTCWHGAALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGR 623 AP T GC T AA T STSRTG S R CTRT A P T R Sbjct: 2276 APPRTRRGCPTPTGTRAAAPPAPGTPPRSTSRTGTPRCSTRTECTRTARPASSSPPATAR 2097 Query: 622 SPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRTCAGA 500 +PS + + ATA +CT RSWS RRRGP RRTC A Sbjct: 2096 APSSPSSSSSSSSATAPPTCTAGRSWSGRRRGPSRRTCGAA 1974 Score = 28.1 bits (55), Expect(2) = 2e-17 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 / -2 Query: 888 VQPLGAGMRAVLDGVAAVQL 829 V+ LGAG RA LD AAV+L Sbjct: 2365 VEALGAGGRAALDHPAAVEL 2306 Score = 46.9 bits (96), Expect(4) = 3e-15 Identities = 24/52 (46%), Positives = 29/52 (55%) Frame = +3 / +1 Query: 498 AAPAHVRRQGPRRRHDQLLQPVQERRAVAQAQGPGVGRREGDLPVQGRPRQA 653 AA HVRR+GPRRR DQLL VQ AVA+ + +G V G +A Sbjct: 1972 AAAPHVRREGPRRRPDQLLPAVQVGGAVAEEEDEDEDGDDGARAVAGGEEEA 2127 Score = 33.6 bits (67), Expect(4) = 3e-15 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +3 / +1 Query: 828 QAVPLPHHQELHACLPQGAEPCKADRHNKEAA 923 QA+PLP QELH LPQ P + +++ A Sbjct: 2305 QALPLPDDQELHGHLPQEPRPRRRHLRHEDPA 2400 Score = 28.1 bits (55), Expect(4) = 3e-15 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 / +3 Query: 713 GGTQKSISAPQRCSMPTGGSKTAVMSSQ 796 GGT++ +RC TGG +TA S++ Sbjct: 2187 GGTRRRSWGRRRCCTRTGGCRTAATSTR 2270 Score = 27.2 bits (53), Expect(4) = 3e-15 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +3 / +1 Query: 267 PVDEAPPQGLQGGPLRLRPHGARRAPQDQERAGPVPHLPPELP 395 P+ A P + P +R HGA R +DQ A +P +P Sbjct: 1741 PLAAAAPAVVPRRPRHMRSHGAGRPAEDQGGARRDAGVPAVVP 1869 Score = 44.1 bits (90), Expect = 0.002 Identities = 21/46 (45%), Positives = 29/46 (63%) Frame = -3 / -2 Query: 789 LITAVLDPPVGMEQRCGAEILFWVPPVGRAGCGAAGAEDALVHAIE 652 L+ AV PPV ++QR + VPPVGRA AA A++ALV ++ Sbjct: 2263 LVAAVRHPPVRVQQRRRPQERLRVPPVGRARRAAARAQNALVQPVQ 2126
>LOC_Os02g30110:12002.t02704:unspliced-genomic cytochrome P450, putative, expressed| Length = 5541 Score = 34.5 bits (69), Expect(2) = 2e-04 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -2 / +1 Query: 685 RRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPC 590 RR GCTR C + RP T SP+ G C Sbjct: 1333 RRSGCTRRCRSSRTSRPPTATSPASTSARGRC 1428 Score = 30.9 bits (61), Expect(2) = 2e-04 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 / +1 Query: 721 GSTSRTGRMWSSRRRGCTR 665 G +R+ R W SRRRGC R Sbjct: 1231 GLAARSTRAWGSRRRGCWR 1287
>LOC_Os12g09620:12012.t00841:unspliced-genomic expressed protein| Length = 763 Score = 46.0 bits (94), Expect = 5e-04 Identities = 21/72 (29%), Positives = 28/72 (38%) Frame = -2 / +2 Query: 763 CWHGAALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA* 584 CW G RG G + + R T WRGR W+G +P+ P P Sbjct: 188 CWRGTTSRGGSCRWGWRGTSSGRTGASRCTSRGTASSCWRGRGWSGTAPASPAPPPPAGS 367 Query: 583 ATARRSCTGCRS 548 +R S + C S Sbjct: 368 RRSRASTSRCSS 403
>LOC_Os10g30530:12010.t03529:unspliced-genomic protein kinase, putative, expressed| Length = 2560 Score = 45.5 bits (93), Expect = 7e-04 Identities = 23/60 (38%), Positives = 29/60 (48%) Frame = -2 / +2 Query: 691 SSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRT 512 S RR C+R+ +WR R GRS + P P P + S TGC + R P RRT Sbjct: 1814 SRRRPTCSRSGRSSWRWRAGGGRSSAAAP*PPPPTRTASSCSPTGCSTGGTRATSPPRRT 1993 Score = 25.8 bits (50), Expect(2) = 1.6 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 / +2 Query: 718 STSRTGRMWSSRRRGCTRTC 659 S+ RTGR S+R TRTC Sbjct: 1202 SSGRTGRWSSARTGSRTRTC 1261 Score = 25.8 bits (50), Expect(2) = 1.6 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = -2 / +2 Query: 640 RPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*R 518 R T SP T C+ + +CTG S RR P*R Sbjct: 1247 RTRTCSSPPPASTASGCSASAGSAACTGACSRRPGRRSP*R 1369 Score = 32.2 bits (64), Expect = 7.3 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +3 / +3 Query: 504 PAHVRRQGPRRRHDQLLQPVQERRAVAQAQGPG 602 PA VR QGP RRH +L + RR + + PG Sbjct: 1233 PAPVRVQGPVRRHRRLRRQAAARRRRVRPRVPG 1331
>LOC_Os11g07600:12011.t00651:unspliced-genomic ATPase, coupled to transmembrane movement of substances, putative,| expressed Length = 3737 Score = 32.2 bits (64), Expect(2) = 8e-04 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -2 / +2 Query: 721 GSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTG 626 G SR+G SRR GC+R+ R W P G Sbjct: 2642 GGASRSGGTRRSRRCGCSRSSRRRWWRGPCGG 2737 Score = 30.9 bits (61), Expect(2) = 8e-04 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 / +2 Query: 598 GPCA*ATARRSCTGCRSWSCR 536 GPC +ARR CT R SCR Sbjct: 2846 GPCWRGSARRGCTRSRPTSCR 2908
>LOC_Os01g17010:12001.t01549:unspliced-genomic phospholipid-transporting ATPase 1, putative, expressed| Length = 6287 Score = 45.1 bits (92), Expect = 0.001 Identities = 26/67 (38%), Positives = 30/67 (44%) Frame = -2 / +2 Query: 718 STSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSC 539 ST R GR S RR C+R R+ P RSPS PTP + R +G R Sbjct: 23 STPRRGRRSSRRRHRCSRRRSRSRPSEPTASRSPSRCPTPSAGSPTRRRPRRSGGRRRGA 202 Query: 538 RRRGP*R 518 RR P R Sbjct: 203 ARRSPAR 223
>LOC_Os06g02580:12006.t00151:unspliced-genomic nickel ion transporter, putative, expressed| Length = 1838 Score = 44.1 bits (90), Expect = 0.002 Identities = 24/68 (35%), Positives = 29/68 (42%) Frame = -2 / +2 Query: 709 RTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRR 530 R W + RT R+ +P RSPS R PG C + RS CR RR Sbjct: 941 RRASRWRTAAAAAARTVARSMLYQPPGRRSPSPRSPPGSCTGCSPTRS*WSCRRSPSRRA 1120 Query: 529 GP*RRTCA 506 P RR+ A Sbjct: 1121 SPARRSLA 1144
>LOC_Os05g44770:12005.t03965:unspliced-genomic receptor-like protein kinase 5 precursor, putative, expressed| Length = 4146 Score = 38.2 bits (77), Expect(2) = 0.004 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = -2 / +2 Query: 688 SRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRS 548 +RRRG R+ R W G +G + R C + RRSCTG S Sbjct: 2411 ARRRGRRRSGERRWTGWRGSGWPSARRGASATCTTSARRRSCTGTSS 2551 Score = 22.6 bits (43), Expect(2) = 0.004 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 / +2 Query: 781 GCLGSTCWHGAALRGR 734 G G+ CW A RGR Sbjct: 2381 GSTGTNCWPVARRRGR 2428
>LOC_Os01g47710:12001.t04217:unspliced-genomic homeobox domain containing protein, expressed| Length = 4361 Score = 35.9 bits (72), Expect(2) = 0.005 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -2 / +2 Query: 619 PSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRT 512 P++RP P RR C R W+C RR P R T Sbjct: 962 PTVRPGPASLRGLRRRRRCP*RRPWTCSRRSPRRAT 1069 Score = 24.4 bits (47), Expect(2) = 0.005 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 / +3 Query: 705 RAGCGAAGAEDALVHA 658 RAG GA G A+VHA Sbjct: 819 RAGGGAPGGRGAVVHA 866
>LOC_Os03g12570:12003.t01056:unspliced-genomic DNA cytosine methyltransferase MET2a, putative, expressed| Length = 11118 Score = 31.8 bits (63), Expect(2) = 0.007 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 / +3 Query: 772 GSTCWHGAALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWR 644 G T W AA R T R R RG R HRAWR Sbjct: 9051 GRTAWTKAAAGTRSTRQARRRRAAR*AGRTGRGRCRRRHRAWR 9179 Score = 28.1 bits (55), Expect(2) = 0.007 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -2 / +3 Query: 577 ARRSCTGCRSWSCRRRGP*RRTCAG 503 +RR+ + SW RR G RRTC G Sbjct: 9186 SRRAPSRTTSWRWRRAGSRRRTCWG 9260
>LOC_Os01g72340:12001.t06522:unspliced-genomic beta-galactosidase, putative, expressed| Length = 8155 Score = 41.8 bits (85), Expect = 0.009 Identities = 28/77 (36%), Positives = 34/77 (44%) Frame = -2 / -1 Query: 754 GAALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATA 575 G A RGR S+ R+ ++RRR R R G P TGR P R G C A Sbjct: 7414 GYASRGRAPRRHSSWRSPASAATRRRPTRRGRTRRRPGAPPTGRQPGRRTRRGQCTARAA 7235 Query: 574 RRSCTGCRSWSCRRRGP 524 RR + R + R GP Sbjct: 7234 RRRRSRTRRRARRPSGP 7184
>LOC_Os03g19310:12003.t01697:unspliced-genomic glycosyltransferase 3, putative, expressed| Length = 1732 Score = 41.4 bits (84), Expect = 0.013 Identities = 22/61 (36%), Positives = 26/61 (42%) Frame = -2 / -3 Query: 751 AALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATAR 572 A+ GR G RT W + RR RTC PW R + R T G C * + R Sbjct: 1088 ASRGGRRAPTGRRPRTAAGW*ASRRRSCRTCRGRGPAAPWAPRRRAGRATTGSCG**SCR 909 Query: 571 R 569 R Sbjct: 908 R 906
>LOC_Os01g37600:12001.t03302:unspliced-genomic agenet domain containing protein, expressed| Length = 5372 Score = 41.4 bits (84), Expect = 0.013 Identities = 22/63 (34%), Positives = 27/63 (42%) Frame = -2 / +2 Query: 691 SSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRT 512 + RRRG + TC WR G + P G A RR CT CRS +R R Sbjct: 731 TGRRRGASSTCSTWWRRTTGKGGGRAWCPRHGRLAGGRRRRRCTPCRSRRAGKRRSSRPR 910 Query: 511 CAG 503 +G Sbjct: 911 SSG 919
>LOC_Os07g09300:12007.t00805:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 11907 Score = 33.1 bits (66), Expect(3) = 0.014 Identities = 17/32 (53%), Positives = 18/32 (56%) Frame = -2 / -1 Query: 595 PCA*ATARRSCTGCRSWSCRRRGP*RRTCAGA 500 PCA T RR GC + S RRR * RT A A Sbjct: 639 PCAGRTGRRRTAGCTAGSRRRRPR*TRTPARA 544 Score = 29.5 bits (58), Expect(3) = 0.014 Identities = 15/44 (34%), Positives = 18/44 (40%) Frame = -2 / -1 Query: 703 GRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATAR 572 GR ++ RR R WR R W GR+ R A* R Sbjct: 1482 GRCSTASRRRGRAAASRPWRRRAWRGRTAPCRRPSAGAA*CRPR 1351 Score = 24.9 bits (48), Expect(3) = 0.014 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 / -3 Query: 965 HGGRPCSAHTQAPSCSFFIVSICF 894 H PC+ H +P S + S CF Sbjct: 5134 HRHHPCARHLGSPCKSLTLNSCCF 5063
>LOC_Os08g29980:12008.t02751:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 5041 Score = 40.9 bits (83), Expect = 0.018 Identities = 20/52 (38%), Positives = 22/52 (42%) Frame = -2 / -2 Query: 685 RRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRR 530 RRR C + C WRGR RSP P P A T + C RRR Sbjct: 906 RRRCCRQACGGCWRGR*CARRSPRRSPPPSRSAPRTHAGAAAPCSRARARRR 751
>LOC_Os03g09160:12003.t00771:unspliced-genomic expressed protein| Length = 816 Score = 26.3 bits (51), Expect(4) = 0.023 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -2 / -3 Query: 655 RAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTG 557 RA R RP GR P +P TAR C+G Sbjct: 544 RAPRRRPSPGRCPCAPASPCRGRHTTARSPCSG 446 Score = 25.4 bits (49), Expect(4) = 0.023 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 / -3 Query: 268 GNPGPSGRSRRS 233 G PGPSGR RR+ Sbjct: 172 GIPGPSGRGRRT 137 Score = 22.1 bits (42), Expect(4) = 0.023 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -2 / -3 Query: 826 TRR*WSQGAPL*THHGCLGSTCWHGAA 746 +RR WS+GAP C GAA Sbjct: 658 SRRPWSRGAPSPPPWACGRRAASRGAA 578 Score = 22.1 bits (42), Expect(4) = 0.023 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 / -3 Query: 583 ATARRSCTGCRSWSCRRRGP*RRTCAG 503 A ARR R RR RR CAG Sbjct: 349 AAARRRTARRRRRGAARRRGPRRACAG 269 Score = 25.8 bits (50), Expect(2) = 5.5 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +3 / +3 Query: 555 QPVQERRAVAQAQGPGVGRREGDLPVQGRPRQAR 656 QP Q RAV G +G P +GR R AR Sbjct: 444 QPEQGDRAVVWRPRHGEAGAQGQRPGEGRRRGAR 545 Score = 24.0 bits (46), Expect(2) = 5.5 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +1 / +1 Query: 400 GICGSCAMNIDGDNGLACLTKISSEAAGASTISPLPHMFVVKDLVV 537 G C CA+ G A L ++ A A + P FVV +L V Sbjct: 250 GACSPCALRTLGAVLAAALLLGAAAALSAVVLRPDAPSFVVDNLSV 387
>LOC_Os06g42080:12006.t03899:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1834 Score = 40.5 bits (82), Expect = 0.024 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = -2 / -3 Query: 682 RRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRR 530 RR C R C WRGR RSP P P A T + C RRR Sbjct: 488 RRCCRRACGGCWRGR*CARRSPRRSPPPSRSAPRTHAGAAAPCSRARARRR 336
>LOC_Os04g20164:12004.t01755:unspliced-genomic amine oxidase precursor, putative, expressed| Length = 7590 Score = 40.5 bits (82), Expect = 0.024 Identities = 17/40 (42%), Positives = 20/40 (50%) Frame = -2 / -3 Query: 646 RGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRG 527 RGR T +P+L P P A C+ R W CRRRG Sbjct: 967 RGRSGTRAAPALAPPPESAPSVRAGSRCSRRRGWGCRRRG 848
>LOC_Os02g26320:12002.t02326:unspliced-genomic fasciclin-like arabinogalactan protein 10 precursor, putative,| expressed Length = 1158 Score = 40.5 bits (82), Expect = 0.024 Identities = 21/53 (39%), Positives = 26/53 (49%) Frame = -2 / -2 Query: 709 RTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCR 551 RTGR W +RR G + +C RA+R R GR P+ A RR CR Sbjct: 401 RTGRGW*ARRSGSSSSCRRAFRCRSSRGRRGRRAPSAARRKGARRRRPRRRCR 243
>LOC_Os01g50040:12001.t04441:unspliced-genomic expressed protein| Length = 4799 Score = 40.5 bits (82), Expect = 0.024 Identities = 25/64 (39%), Positives = 27/64 (42%) Frame = -2 / +1 Query: 706 TGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRG 527 T R +RRR C R R RGR W R P P A A RRS + S C Sbjct: 133 TARRARARRRRCRRRRGRRRRGRCWPSRWPDAAPRGPASASAWPRRSRSCSSSPRCSAPS 312 Query: 526 P*RR 515 P RR Sbjct: 313 PSRR 324
>LOC_Os09g23820:12009.t02065:unspliced-genomic cytochrome P450 72A1, putative, expressed| Length = 2234 Score = 31.3 bits (62), Expect(2) = 0.032 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -2 / -3 Query: 742 RGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRS 620 RGR G +R+ S RR + AWRGRPW R+ Sbjct: 2208 RGRRAWGGG*ARSPARGGSCRRWRSGRPRGAWRGRPWPRRA 2086 Score = 26.3 bits (51), Expect(2) = 0.032 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 / -3 Query: 553 RSWSCRRRGP*RRTCAG 503 R W R R P RR+CAG Sbjct: 2106 RPWPRRARTPGRRSCAG 2056
>LOC_Os07g48040:12007.t04438:unspliced-genomic peroxidase 2 precursor, putative, expressed| Length = 1743 Score = 40.0 bits (81), Expect = 0.033 Identities = 25/73 (34%), Positives = 25/73 (34%) Frame = -2 / +1 Query: 760 WHGAALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*A 581 WHGA GR TS SR R R WT R P TP Sbjct: 1018 WHGAGASGRGYTTRPTSTPPLRRRSRPTARRRRAAATATWRRWTRRRPPRSTTPTTATCC 1197 Query: 580 TARRSCTGCRSWS 542 R SCT RS S Sbjct: 1198 RTRGSCTPTRSCS 1236
>LOC_Os04g06920:12004.t00567:unspliced-genomic conserved hypothetical protein| Length = 2734 Score = 34.1 bits (68), Expect(2) = 0.043 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -2 / +2 Query: 781 GCLGSTCWHGAALRGRDTLLGSTSRTGRMWSSRRRGCT 668 GC S+ WH L TL+G T W + GCT Sbjct: 56 GCQSSSWWHSGRLSCCSTLVGRTPSRPTPWRTTGCGCT 169 Score = 23.1 bits (44), Expect(2) = 0.043 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -2 / +2 Query: 565 CTGCRSWSCRRRGP 524 CT CR CR R P Sbjct: 164 CTTCRVLRCRSRQP 205
>LOC_Os01g47070:12001.t04156:unspliced-genomic acidic endochitinase precursor, putative, expressed| Length = 1265 Score = 29.5 bits (58), Expect(2) = 0.045 Identities = 14/46 (30%), Positives = 18/46 (39%) Frame = -2 / -2 Query: 700 RMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSC 563 R W + GC R R P +P+ RP G A + SC Sbjct: 736 RRWRTGTAGCCRIAPTRCRTAPSAAPAPATRPGRGTAAPPSGSPSC 599 Score = 27.6 bits (54), Expect(2) = 0.045 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 / -2 Query: 577 ARRSCTGCRSWSCRRRGP*RR 515 ARRS GCRS RR P RR Sbjct: 559 ARRSAPGCRSRCRSRRRPARR 497
>LOC_Os11g16770:12011.t01457:unspliced-genomic ATP-dependent Clp protease ATP-binding subunit clpA homolog| CD4B,chloroplast precursor, putative, expressed Length = 5299 Score = 39.6 bits (80), Expect = 0.045 Identities = 24/65 (36%), Positives = 26/65 (40%) Frame = -2 / +3 Query: 706 TGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRG 527 T R RR C T WR W G S R T G A+ RR C G R+ C Sbjct: 4554 TARRSRRRRPWCGST*ASTWRSTRWRGWSARRRGTSGTARVAS*RRRCDGGRTRWCCSTR 4733 Query: 526 P*RRT 512 RRT Sbjct: 4734 SRRRT 4748
>LOC_Os03g06230:12003.t00492:unspliced-genomic expressed protein| Length = 3928 Score = 39.6 bits (80), Expect = 0.045 Identities = 22/60 (36%), Positives = 25/60 (41%) Frame = -2 / -1 Query: 685 RRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRTCA 506 RR G +C A R W R P R T GP T + RRR P*RRT + Sbjct: 262 RRAGAAASCRSAR*ARRWARRWPGRRRTGGPSVRTTPPATAASGPPPPSRRRRP*RRTAS 83
>LOC_Os02g09620:12002.t00809:unspliced-genomic anther-specific proline-rich protein APG, putative, expressed| Length = 3699 Score = 39.6 bits (80), Expect = 0.045 Identities = 22/63 (34%), Positives = 28/63 (44%) Frame = -2 / -1 Query: 688 SRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRTC 509 SRRRG +R C R RG P + PT P R S + R +CR R R+ Sbjct: 420 SRRRGRSRRCRRPGRGTPGRAAAGRGTPT*SPARGGRCRTSPSRARRRACRARTAGSRSA 241 Query: 508 AGA 500 A + Sbjct: 240 AAS 232
>LOC_Os11g12390:12011.t01126:unspliced-genomic conserved hypothetical protein| Length = 393 Score = 33.1 bits (66), Expect(2) = 0.048 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -2 / +2 Query: 652 AWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWS 542 +WR T + RP+P P A T RRSC WS Sbjct: 248 SWRSISPTSPRLASRPSPMPAAPGTMRRSCCHILPWS 358 Score = 24.0 bits (46), Expect(2) = 0.048 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -2 / +2 Query: 718 STSRTGRMWSSRRRGCTRTCHRAWRG 641 + + T R SSRR CT H W G Sbjct: 89 AATTTRRTSSSRRCPCTPCWHWRWLG 166
>LOC_Os10g39000:12010.t03142:unspliced-genomic expressed protein| Length = 1404 Score = 32.7 bits (65), Expect(2) = 0.055 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -2 / -1 Query: 583 ATARRSCTGCRSWSCRRRGP 524 +TARR T CRS S RRRGP Sbjct: 387 STARRRRTACRSRSRRRRGP 328 Score = 28.1 bits (55), Expect(2) = 0.055 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -2 / -2 Query: 1153 FMHEHQNMMNHQTRYSTERTKSGSN 1079 +MH + N NH R + T S SN Sbjct: 1316 YMHAYNNHFNHNDRRGQKNTPSSSN 1242
>LOC_Os07g05640:12007.t00447:unspliced-genomic proton myo-inositol cotransporter, putative, expressed| Length = 3471 Score = 28.6 bits (56), Expect(2) = 0.058 Identities = 17/49 (34%), Positives = 19/49 (38%) Frame = -2 / +3 Query: 712 SRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRS 566 +R S RG R WR R W SP R G C + RRS Sbjct: 2751 TRAAARGGSGTRGGARAGTGGWRWRGWRCTSPPSRRGWGRCRGS*TRRS 2897 Score = 28.1 bits (55), Expect(2) = 0.058 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -2 / +3 Query: 583 ATARRSCTGCRSWSCRRRGP*RRTCAG 503 A RR TGCR+W R R RT +G Sbjct: 2925 AARRRRRTGCRTWRWRSRSCR*RTPSG 3005
>LOC_Os10g01100:12010.t00010:unspliced-genomic receptor-like protein kinase, putative, expressed| Length = 2947 Score = 36.3 bits (73), Expect(2) = 0.059 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = -2 / +2 Query: 655 RAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP 524 R+ G P T +P R TP PC+ +T R SC G + + GP Sbjct: 404 RSSYGTPTTTTTPPWRATPIPCSPSTRRGSCRGATTATAPPFGP 535 Score = 25.4 bits (49), Expect(2) = 0.059 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 / +3 Query: 1019 PWSKNKPNGRLITTFRHLHGGR 954 P SK+K + L + +H HGGR Sbjct: 114 PKSKSKKSNSLPQSSKHNHGGR 179
>LOC_Os09g15530:12009.t01341:unspliced-genomic hypothetical protein| Length = 1349 Score = 30.4 bits (60), Expect(2) = 0.061 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -2 / -2 Query: 769 STCWHGAALRGRDTLLGSTSRTGRMWSSRRRGC 671 +T W RGR + + TGR W RRR C Sbjct: 415 ATTWRRG*SRGRRSAACRSRWTGRRWRRRRRRC 317 Score = 26.3 bits (51), Expect(2) = 0.061 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 / -2 Query: 574 RRSCTGCRSWSCRRRGP*RR 515 R + SW CRRRG RR Sbjct: 316 RGAAAATGSWGCRRRGSCRR 257
>LOC_Os03g47830:12003.t04145:unspliced-genomic argonaute-like protein, putative, expressed| Length = 12542 Score = 39.1 bits (79), Expect = 0.062 Identities = 20/53 (37%), Positives = 26/53 (49%) Frame = -2 / +2 Query: 718 STSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCT 560 S+ R GR RRR R C R RG +GR+ + PT C+ T R + T Sbjct: 317 SSRRRGRSVRCRRRRARRWCSRRGRGSGRSGRAAASAPTISSCSLPTRRSTIT 475
>LOC_Os01g68370:12001.t06193:unspliced-genomic protein viviparous, putative, expressed| Length = 3834 Score = 39.1 bits (79), Expect = 0.062 Identities = 20/51 (39%), Positives = 24/51 (47%) Frame = -2 / +2 Query: 718 STSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRS 566 + SR+ R RR C R W GR + RSPS P PC + RRS Sbjct: 1103 AASRSPRRPRRRRATCMRRAEGTWPGRSNSRRSPSPPRAPTPCRRSCHRRS 1255
>LOC_Os01g09770:12001.t00854:unspliced-genomic expressed protein| Length = 3461 Score = 39.1 bits (79), Expect = 0.062 Identities = 18/42 (42%), Positives = 21/42 (50%) Frame = -2 / +1 Query: 712 SRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA 587 +R R W RR CT T R RGR WT S + R + G A Sbjct: 2395 ARARRWWPCWRRRCTPTTRRCRRGRSWTRSSGTARRSGGGSA 2520
>LOC_Os10g30200:12010.t02354:unspliced-genomic skp1 family, dimerisation domain containing protein| Length = 777 Score = 33.6 bits (67), Expect(2) = 0.063 Identities = 20/49 (40%), Positives = 22/49 (44%) Frame = -2 / -3 Query: 706 TGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCT 560 T R +RR G R R WR RP + R S P P P A RR T Sbjct: 277 TRRGGRARRSGRRRWGWRPWRTRPRSCRGASSTPAPPPPTRAPPRRRPT 131 Score = 23.1 bits (44), Expect(2) = 0.063 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -3 / -1 Query: 876 GAGMRAVLDGVAAVQLELVVDGVKALLCELITAVLD 769 G G LDG ++ + V G++ ++ + AVLD Sbjct: 378 GGGGGGELDGEGRERVAVAVGGLRVVVRRVPLAVLD 271
>LOC_Os08g31090:12008.t02858:unspliced-genomic expressed protein| Length = 1256 Score = 32.7 bits (65), Expect(2) = 0.067 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = -3 / -2 Query: 870 GMRAVLDGVAAVQLELVVDGVKALLCELITAVLDPPVGMEQRCGAEILFWVPP 712 G R AA ++ +V DGV AL E++ +LD P+G L+ + P Sbjct: 889 GRRDAAGAAAAQRVGVVDDGVDALQLEVLPELLDEPLGPRVHLRLPFLYLLCP 731 Score = 27.6 bits (54), Expect(2) = 0.067 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 / -1 Query: 637 PWTGRSPSLRPTPGPCA 587 PWT SP P+P P A Sbjct: 524 PWTASSPPRPPSPAPAA 474
>LOC_Os03g12140:12003.t01013:unspliced-genomic glucan endo-1,3-beta-glucosidase 3 precursor, putative, expressed| Length = 4260 Score = 28.1 bits (55), Expect(3) = 0.075 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 / -1 Query: 580 TARRSCTGCRSWSCRRRGP*RRTCA 506 +ARR GCR W R P RR A Sbjct: 2496 SARRR*RGCRCWRAPRASPGRRRTA 2422 Score = 27.6 bits (54), Expect(3) = 0.075 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = -2 / -1 Query: 763 CWHGAALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRP 635 C RG +SR G + R R C R W GRP Sbjct: 3198 CTSARRRRGASACRWCSSRAG*GYCCRCRRCRRWRRARWTGRP 3070 Score = 26.3 bits (51), Expect(3) = 0.075 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 / -1 Query: 637 PWTGRSPSLRPTPGP 593 PWT R+ + P PGP Sbjct: 2829 PWTART*AAAPAPGP 2785
>LOC_Os11g04180:12011.t00309:unspliced-genomic dual specificity protein phosphatase 12, putative, expressed| Length = 2791 Score = 32.7 bits (65), Expect(2) = 0.076 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -2 / +3 Query: 607 PTPGPCA*ATARRSCTGCRSWSCRRRGP*RRTCA 506 P G C +A S G R W CR P RRTC+ Sbjct: 366 PPGGCCGWWSALGSGCGSRGWPCRCGTPRRRTCS 467 Score = 28.6 bits (56), Expect(2) = 0.076 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 / +3 Query: 768 PPVGMEQRCGAEILFWVPPVGR 703 PP + +RC A +L +PP R Sbjct: 27 PPARVPRRCSARVLLHLPPTSR 92
>LOC_Os06g43620:12006.t04052:unspliced-genomic haemolysin-III related family protein, expressed| Length = 3250 Score = 33.6 bits (67), Expect(2) = 0.078 Identities = 19/45 (42%), Positives = 23/45 (51%) Frame = -2 / -3 Query: 742 RGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLR 608 RGR G T RT R ++ RG RT R R PW R+P+ R Sbjct: 2780 RGRSGGCGRTGRTCRGATAPGRG*GRTRCRRGRTPPWRPRTPASR 2646 Score = 22.6 bits (43), Expect(2) = 0.078 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -2 / -3 Query: 538 RRRGP*RRTCA 506 RRRGP RRT A Sbjct: 2594 RRRGPWRRTAA 2562
>LOC_Os05g03420:12005.t00239:unspliced-genomic conserved hypothetical protein| Length = 1773 Score = 33.6 bits (67), Expect(2) = 0.081 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 / +2 Query: 721 GSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRP 605 G GR RRRG T RA RG P TGR L P Sbjct: 476 GGGGGEGRPQGRRRRGLLSTSLRAGRGAPTTGRRWPLDP 592 Score = 22.6 bits (43), Expect(2) = 0.081 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 / +2 Query: 574 RRSCTGCRSWSCRRRG 527 R+ CT CRRRG Sbjct: 674 RQGCTAPGGGGCRRRG 721
>LOC_Os01g52190:12001.t04646:unspliced-genomic aspartic proteinase nepenthesin-1 precursor, putative| Length = 1341 Score = 31.3 bits (62), Expect(2) = 0.082 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -2 / -3 Query: 604 TPGPCA*ATARRSCTGCRSWSCRRR 530 TPGP ++ R CTG R CR R Sbjct: 382 TPGPSGRSSGGRGCTGARRGRCRCR 308 Score = 24.9 bits (48), Expect(2) = 0.082 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 / -3 Query: 709 RTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPT 602 R R W SRRR TC R R R R T Sbjct: 541 RGRRCWRSRRRRLPCTCSLLRRRRRCRSRGTGARGT 434
>LOC_Os12g36240:12012.t03309:unspliced-genomic subtilisin-chymotrypsin inhibitor CI-1B, putative, expressed| Length = 512 Score = 38.6 bits (78), Expect = 0.086 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -2 / -2 Query: 694 WSSRRRGCTRTCHRAWRGRPWTGRSP 617 W RR C R C R W G PW+ SP Sbjct: 307 WWGCRRRCRRRCGRGWGGSPWSPASP 230
>LOC_Os08g37370:12008.t03474:unspliced-genomic mitochondrial 2-oxoglutarate/malate carrier protein, putative,| expressed Length = 1484 Score = 38.6 bits (78), Expect = 0.086 Identities = 22/49 (44%), Positives = 24/49 (48%) Frame = -2 / +2 Query: 709 RTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSC 563 R R S RRR R+ RGRPW R LR P * +ARRSC Sbjct: 374 RRRRRRSRRRRRRCGRRWRSTRGRPWRSRMT*LRRRGSPGR*PSARRSC 520
>LOC_Os05g25180:12005.t02174:unspliced-genomic zinc finger, C3HC4 type family protein, expressed| Length = 5883 Score = 38.6 bits (78), Expect = 0.086 Identities = 19/37 (51%), Positives = 20/37 (54%) Frame = -2 / +2 Query: 706 TGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPG 596 TGR S R R RA RGRP GR+ S RP PG Sbjct: 455 TGRSRSGSRAAPGRPTRRASRGRPRRGRTRSRRPPPG 565
>LOC_Os03g23960:12003.t02091:unspliced-genomic SF16-like protein, putative, expressed| Length = 2461 Score = 38.6 bits (78), Expect = 0.086 Identities = 25/81 (30%), Positives = 31/81 (38%) Frame = -2 / +3 Query: 754 GAALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATA 575 G G G R G ++ RR T R R RP +G R P P Sbjct: 2031 GTRRGGHSPAPGGARRRGTTTAAARRRSRGTWRRRRRPRPSSGP*ARPRSAPAPARRTPT 2210 Query: 574 RRSCTGCRSWSCRRRGP*RRT 512 R S + + SCRR P RR+ Sbjct: 2211 RSSASRSPTASCRRSPPCRRS 2273
>LOC_Os01g61510:12001.t05530:unspliced-genomic ammonium transporter 2, putative, expressed| Length = 2513 Score = 36.8 bits (74), Expect(2) = 0.094 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -2 / +1 Query: 640 RPWTGRSPSLRPTPGPCA*ATARRSCTGCRS 548 R WT SPS PTP + A + R+C+ CR+ Sbjct: 1771 RRWTTPSPSSTPTPSRASSAASSRACSPCRT 1863 Score = 24.0 bits (46), Expect(2) = 0.094 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -2 / +2 Query: 721 GSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPS 614 G +R R SS R +R R PW+ R+PS Sbjct: 278 GRPARR*RRGSSWRARRSRPRRTTGRTAPWSRRAPS 385
>LOC_Os07g46370:12007.t04273:unspliced-genomic EMB2221, putative, expressed| Length = 9923 Score = 28.6 bits (56), Expect(2) = 0.098 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 / -3 Query: 739 GRDTLLGSTSRTGRMWSSRRRGCTR 665 GR + GS R W +RRR C R Sbjct: 384 GRASRTGSRGGRSRCWPTRRRACRR 310 Score = 27.2 bits (53), Expect(2) = 0.098 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -2 / -3 Query: 646 RGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRG 527 R R W R P P P A +AR CT RR G Sbjct: 312 RRRSWCRRRGRAPPAPAPSAPPSARS*CTPSPPARPRRSG 193
>LOC_Os11g38860:12011.t03429:unspliced-genomic methyltransferase, putative, expressed| Length = 5664 Score = 30.9 bits (61), Expect(2) = 0.10 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -2 / +1 Query: 580 TARRSCTGCRSWSCRRRGP*RRT 512 TA + +GC +W RRRG *RR+ Sbjct: 664 TAPATASGCGAWCRRRRGT*RRS 732 Score = 24.9 bits (48), Expect(2) = 0.10 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -2 / +1 Query: 664 TCHRAWRGRPWTGRSPSLR 608 T AWR RPW R S R Sbjct: 514 TAAPAWRTRPWRRRRRSSR 570 Score = 34.5 bits (69), Expect = 1.5 Identities = 20/57 (35%), Positives = 24/57 (42%) Frame = -2 / +1 Query: 718 STSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRS 548 S+ R R W + RR TR+ RGR W S + T C RR T RS Sbjct: 562 SSRRARRRWRTTRRATTRSAR*GSRGRTWCTGSGTAPATASGCGAWCRRRRGT*RRS 732
>LOC_Os11g38670:12011.t03410:unspliced-genomic ATP-dependent RNA helicase ded-1, putative, expressed| Length = 5258 Score = 38.2 bits (77), Expect = 0.12 Identities = 22/67 (32%), Positives = 27/67 (40%) Frame = -2 / +2 Query: 715 TSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCR 536 TS R RR R+ W R T + + P PC+ +R G SW R Sbjct: 419 TSPWRRAGGRCRRRWARSPRSTWARRSTTTSAGASTCAPRPCSGTPSRSRSRGGTSWRAR 598 Query: 535 RRGP*RR 515 R GP RR Sbjct: 599 RPGPGRR 619
>LOC_Os07g37040:12007.t03373:unspliced-genomic octicosapeptide/Phox/Bem1p, putative, expressed| Length = 1782 Score = 38.2 bits (77), Expect = 0.12 Identities = 23/53 (43%), Positives = 26/53 (49%) Frame = -2 / +2 Query: 736 RDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*AT 578 R T TSRT R +S R RT RA GRP R+ R T PCA +T Sbjct: 857 RSTRRWPTSRTTRRFSRGGRRLPRTSPRARHGRPRRRRT*RSRCTTSPCARST 1015
>LOC_Os05g34550:12005.t03049:unspliced-genomic MLO-like protein 1, putative, expressed| Length = 5272 Score = 38.2 bits (77), Expect = 0.12 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = -2 / +3 Query: 721 GSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSL 611 G R R WSSRRRG R C R+W P + + S+ Sbjct: 111 GRWRRRRRRWSSRRRGSWRRCARSWCSSPSSPSAASI 221
>LOC_Os06g08310:12006.t00712:unspliced-genomic ATPase 8, plasma membrane-type, putative, expressed| Length = 4846 Score = 36.8 bits (74), Expect(2) = 0.12 Identities = 24/57 (42%), Positives = 27/57 (47%) Frame = -2 / -3 Query: 685 RRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RR 515 RRR R R R RP + SP P PG C+ AT RR RS + R R RR Sbjct: 932 RRRCARRWR*RRPRSRPASPWSPRTPPAPGACSPATTRR*APTGRS*AGRPRAASRR 762 Score = 24.4 bits (47), Expect(2) = 0.12 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 / -3 Query: 880 PWGRHACSS*WC 845 PWGR ACS C Sbjct: 1430 PWGRRACSRCRC 1395
>LOC_Os06g07700:12006.t00652:unspliced-genomic conserved hypothetical protein| Length = 1797 Score = 32.2 bits (64), Expect(2) = 0.13 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 / -3 Query: 601 PGPCA*ATARRSCTGCRSWSCRRRGP*R 518 P C A RR C C SCRRR P*R Sbjct: 127 PS*CGRAWCRRRCCCCLRRSCRRR*P*R 44 Score = 27.6 bits (54), Expect(2) = 0.13 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = -2 / -3 Query: 694 WSSRRRGCTRTCHRAWRGRP 635 W R C +C R WR P Sbjct: 1459 WPRRSPSCGSSCRRTWRSAP 1400
>LOC_Os04g50950:12004.t04573:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 4064 Score = 32.7 bits (65), Expect(2) = 0.14 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -2 / +2 Query: 718 STSRTGRMWSSRRRGCTRTCHRAWRGRPW 632 +TSR+ ++RRR R C R WR PW Sbjct: 3527 ATSRSWSSSTARRRSP*RACARPWRCSPW 3613 Score = 22.6 bits (43), Expect(2) = 0.14 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -2 / +2 Query: 634 WTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCR 536 WT S S R + TAR SWSCR Sbjct: 3719 WTTSSGSWRRCARSTSSCTARSPGPTG*SWSCR 3817
>LOC_Os12g41490:12012.t03825:unspliced-genomic receptor-like protein kinase homolog RK20-1, putative, expressed| Length = 2793 Score = 31.3 bits (62), Expect(2) = 0.14 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 / -1 Query: 568 SCTGCRSWSCRRRGP*RRTCA 506 SCTGCR SCRR RT A Sbjct: 201 SCTGCRRCSCRRSSTTARTGA 139 Score = 24.0 bits (46), Expect(2) = 0.14 Identities = 16/51 (31%), Positives = 19/51 (37%) Frame = -2 / -1 Query: 721 GSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARR 569 G R RRRG T R GR+P RP+ * + RR Sbjct: 396 GFPGTPARSRPERRRGIPGTASSCGRRST**GRTPGRRPSRPSWC*TSRRR 244
>LOC_Os07g49250:12007.t04553:unspliced-genomic pyruvate decarboxylase isozyme 3, putative, expressed| Length = 2163 Score = 27.6 bits (54), Expect(2) = 0.15 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 / +2 Query: 789 VHKGAP*LHQRRVQAVPLPHHQ 854 +H+G P L + R Q P PHH+ Sbjct: 392 LHRGGPQLQRLRHQPHPPPHHR 457 Score = 27.6 bits (54), Expect(2) = 0.15 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 / +3 Query: 927 RSLSVSRAGSSPVEMSESCNQPAI 998 R++S + S PV +S SCN PA+ Sbjct: 555 RAISTAIRESKPVYISVSCNLPAV 626
>LOC_Os05g05670:12005.t00457:unspliced-genomic 1-aminocyclopropane-1-carboxylate oxidase, putative, expressed| Length = 1928 Score = 31.8 bits (63), Expect(2) = 0.15 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 / -2 Query: 694 WSSRRRGCTRTCHRAWRGRPWTGR 623 WS RR GC RT A R W GR Sbjct: 1513 WSPRRPGCRRTRRSAGCRRAWGGR 1442 Score = 23.5 bits (45), Expect(2) = 0.15 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = -2 / -2 Query: 640 RPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRR 530 R W R+ + RPT P A RR G RRR Sbjct: 1381 RRWRRRAAARRPTRRP*APGGRRRGRPGTAG*RRRRR 1271
>LOC_Os11g24550:12011.t02076:unspliced-genomic snRNP protein, putative, expressed| Length = 1556 Score = 29.0 bits (57), Expect(2) = 0.15 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -2 / +2 Query: 622 SPSLRPTPGPCA*ATARRSCTGCRSWSCRRRG 527 +P+ RPTP P T C +W+ RR G Sbjct: 650 TPTTRPTPTPTPPRTQ**RCASTTTWTPRRSG 745 Score = 26.3 bits (51), Expect(2) = 0.15 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 / +2 Query: 718 STSRTGRMWSSRRRGCTRTCHRAWR 644 S+SR+ S R GC+R R+WR Sbjct: 557 SSSRSRGRRSRRTGGCSRRDRRSWR 631
>LOC_Os10g33240:12010.t02626:unspliced-genomic expressed protein| Length = 3550 Score = 37.7 bits (76), Expect = 0.16 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 / +2 Query: 700 RMWSSRRRGCTRTCHRAWRGRPWTGR 623 R W SRR GC R R WR R W R Sbjct: 272 RRWGSRRGGCRRRRRRWWRSR*WCAR 349
>LOC_Os08g13250:12008.t01203:unspliced-genomic BTB/POZ domain containing protein| Length = 2449 Score = 37.7 bits (76), Expect = 0.16 Identities = 23/54 (42%), Positives = 25/54 (46%) Frame = -2 / -1 Query: 691 SSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRR 530 S R R R WR GRSPS R TP P A+A R G R + RRR Sbjct: 700 SGAARRTRRGACRRWRSVRRRGRSPSSRRTPPP*TPASAWRG*PGARRRARRRR 539
>LOC_Os05g29750:12005.t02575:unspliced-genomic cytochrome P450 71E1, putative, expressed| Length = 1809 Score = 37.7 bits (76), Expect = 0.16 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 / +1 Query: 685 RRRGCTRTCHRAWRGRPW 632 RR GCTR C +WRGR W Sbjct: 1213 RRSGCTRRCRCSWRGRRW 1266 Score = 35.0 bits (70), Expect = 1.1 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 / +2 Query: 556 CRSWSCRRRGP*RRTCAGA 500 CR WSCRR P RR CA A Sbjct: 251 CRRWSCRRPPPPRRCCARA 307
>LOC_Os01g16220:12001.t01472:unspliced-genomic sad1/unc-84-like protein 2, putative, expressed| Length = 2659 Score = 37.7 bits (76), Expect = 0.16 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -2 / +2 Query: 655 RAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRS 548 R WR R W+ R+ S TPGP *AT +G S Sbjct: 542 RCWRRRGWSSRASSSASTPGPTT*ATRSARSSGWSS 649
>LOC_Os07g24230:12007.t02120:unspliced-genomic folate/biopterin transporter family protein, expressed| Length = 3473 Score = 36.8 bits (74), Expect(2) = 0.17 Identities = 18/42 (42%), Positives = 23/42 (54%) Frame = +3 / -1 Query: 519 RQGPRRRHDQLLQPVQERRAVAQAQGPGVGRREGDLPVQGRP 644 R+ PRRRH Q L+ + RR Q P GRR G + G+P Sbjct: 323 RRRPRRRHRQRLRRRRRRRRRRPRQPPRRGRRRGGVLEPGQP 198 Score = 23.5 bits (45), Expect(2) = 0.17 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +1 / -1 Query: 280 PHLKDYKVDLSDCGPMVLDALLKIKNEQDPSLT 378 PH + + L+DC P V + L +I ++ +T Sbjct: 2564 PHKRVKDLLLADCCPQV*ELLAEIVRQRGSDMT 2466
>LOC_Os09g27940:12009.t02472:unspliced-genomic aspartic proteinase nepenthesin-1 precursor, putative, expressed| Length = 3081 Score = 31.8 bits (63), Expect(2) = 0.19 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = -2 / -1 Query: 628 GRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRTCA 506 G + R T G +RR C+GCR SCR R RT + Sbjct: 756 GWRAATRATAGRGRSRRSRRRCSGCRRSSCRSRTRAARTAS 634 Score = 23.1 bits (44), Expect(2) = 0.19 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 / -1 Query: 688 SRRRGCTRTCHRAWRGR 638 SRR G R+ AW GR Sbjct: 909 SRRSGSGRSAGSAWSGR 859
>LOC_Os08g09420:12008.t00827:unspliced-genomic F-box domain containing protein, expressed| Length = 3003 Score = 27.6 bits (54), Expect(2) = 0.19 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -2 / +2 Query: 580 TARRSCTGCRSWSC 539 T RR C G RSW C Sbjct: 413 TGRRGCRGKRSWPC 454 Score = 27.2 bits (53), Expect(2) = 0.19 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 / +2 Query: 670 TRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATA 575 TR+ R WR TGRS S R T P + A++ Sbjct: 194 TRSRRRRWRRTRRTGRSLSCRTTRFPTSSASS 289
>LOC_Os02g45700:12002.t04157:unspliced-genomic transferase, transferring glycosyl groups, putative, expressed| Length = 2233 Score = 31.8 bits (63), Expect(2) = 0.20 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -2 / -3 Query: 739 GRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWT 629 GRD LG + RT W S G T R R P+T Sbjct: 1211 GRDRALGKSGRTTSRWCSDTSGATGWAARRPRRSPYT 1101 Score = 23.1 bits (44), Expect(2) = 0.20 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -2 / -1 Query: 595 PCA*ATARRSCTGCRSWSCRR 533 PC + RRS T + CRR Sbjct: 1051 PCTRGSGRRSRTATGTGGCRR 989
>LOC_Os10g29260:12010.t02270:unspliced-genomic speckle-type POZ protein, putative| Length = 965 Score = 29.9 bits (59), Expect(2) = 0.21 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -2 / +1 Query: 607 PTPGPCA*ATARRSCTGCRSWSC 539 P P PC T R+C+ C S SC Sbjct: 565 PPPEPCTSRTLSRACSRCCSASC 633 Score = 24.9 bits (48), Expect(2) = 0.21 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -2 / +1 Query: 664 TCHRAWRGRPWTGRSPSLR 608 TC RA R R W RS + R Sbjct: 427 TCWRARRARMWCSRSAARR 483
>LOC_Os12g36220:12012.t03307:unspliced-genomic MPI, putative| Length = 846 Score = 37.3 bits (75), Expect = 0.22 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 / -2 Query: 721 GSTSRTGRMWSSRRRGCTRTCHRAWRGRPWT 629 G R W RR C R C R W G PW+ Sbjct: 260 GRQMRQASRWWGCRRRCRRRCGRGWGGSPWS 168
>LOC_Os12g04200:12012.t00309:unspliced-genomic chitin-inducible gibberellin-responsive protein 2, putative| Length = 1868 Score = 37.3 bits (75), Expect = 0.22 Identities = 23/69 (33%), Positives = 27/69 (39%) Frame = -2 / +2 Query: 742 RGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSC 563 RG S+ R W+ RRR TC R WRG GR P G + RR+ Sbjct: 1280 RGSGRRSSSSRRCSTCWTRRRRRRGATCGRCWRGTC*GGRRWG*SPGKGRSGWSGRRRTG 1459 Query: 562 TGCRSWSCR 536 G R R Sbjct: 1460 GGRRGIGAR 1486
>LOC_Os04g56780:12004.t05146:unspliced-genomic protein WUSCHEL, putative, expressed| Length = 1051 Score = 37.3 bits (75), Expect = 0.22 Identities = 22/58 (37%), Positives = 24/58 (41%) Frame = -2 / +2 Query: 721 GSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRS 548 G R GR SR R C A GRP RS P A + AR S TG R+ Sbjct: 89 GRAGRGGRRRRSRSRSCGSCTTAAASGRPTRSRSSGSPPCCASTAASRARTSSTGSRT 262
>LOC_Os04g53430:12004.t04815:unspliced-genomic speckle-type POZ protein, putative, expressed| Length = 1122 Score = 37.3 bits (75), Expect = 0.22 Identities = 20/56 (35%), Positives = 22/56 (39%) Frame = -2 / -3 Query: 694 WSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRG 527 W RRR C R C RA R SP+ P + RR S CRR G Sbjct: 913 WRGRRRRCPRRCPRAASPRTSAAASPARTCPPRRAGAPSPRRRRRRAASCPCRRSG 746
>LOC_Os04g40990:12004.t03660:unspliced-genomic malate synthase, glyoxysomal, putative, expressed| Length = 2480 Score = 37.3 bits (75), Expect = 0.22 Identities = 19/47 (40%), Positives = 24/47 (51%) Frame = -2 / -2 Query: 691 SSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCR 551 S RRRGC R+ R+ RG W R R G + A +RR+ G R Sbjct: 799 SGRRRGCGRSRGRSRRGSRWPARRRRGRAPRGGASRAASRRASRGGR 659
>LOC_Os01g66610:12001.t06021:unspliced-genomic serine/threonine-protein kinase receptor precursor, putative,| expressed Length = 4412 Score = 37.3 bits (75), Expect = 0.22 Identities = 23/72 (31%), Positives = 26/72 (36%) Frame = -2 / -2 Query: 715 TSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCR 536 +S G SR R + R W G W R + P A RR G SW R Sbjct: 2923 SSCRGTRARSRERSRSPRSRRRWAGSRWASRRTCRSSSSAPPAARRRRRRIAGRCSWRSR 2744 Query: 535 RRGP*RRTCAGA 500 R G T A A Sbjct: 2743 RCGRPAATAAAA 2708
>LOC_Os06g36450:12006.t03341:unspliced-genomic transporter like protein, putative, expressed| Length = 2573 Score = 35.9 bits (72), Expect(2) = 0.23 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -2 / +2 Query: 691 SSRRRGCTRTCHRAWRGRPWTGRSPSLRPT 602 S R R C+R C +WR PW +PS P+ Sbjct: 563 SGRARCCSRRCTASWRPPPWRRWAPSSAPS 652 Score = 23.5 bits (45), Expect(2) = 0.23 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 / +1 Query: 580 TARRSCTGCRSWSCRRRGP*RRTCA 506 TA R TG S +CR R TC+ Sbjct: 1678 TASRRATGASSAACRTRCSPCSTCS 1752
>LOC_Os12g34360:12012.t03125:unspliced-genomic expressed protein| Length = 2683 Score = 31.3 bits (62), Expect(2) = 0.26 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -1 / +1 Query: 818 LMESRRSFVNSSRLSWIHLLAWSSAAGPRYS 726 L+E R F S L W H WS AA R S Sbjct: 427 LVEGARIFSRSHELEWQHQATWSLAAAGRSS 519 Score = 23.1 bits (44), Expect(2) = 0.26 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 / +2 Query: 622 SPSLRPTPGPCA*ATARR 569 S + RP P P A A ARR Sbjct: 560 STTARPPPTPAAAAAARR 613
>LOC_Os12g29620:12012.t02671:unspliced-genomic conserved hypothetical protein| Length = 1535 Score = 33.6 bits (67), Expect(2) = 0.27 Identities = 18/48 (37%), Positives = 22/48 (45%) Frame = +3 / +2 Query: 501 APAHVRRQGPRRRHDQLLQPVQERRAVAQAQGPGVGRREGDLPVQGRP 644 AP RRQG RRR ++ P + R + G G G PVQ P Sbjct: 848 APETTRRQGQRRRRERRPPPRRRRGGQRRHHPVGGGALRGGHPVQA*P 991 Score = 24.9 bits (48), Expect(2) = 0.27 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 / +3 Query: 306 PLRLRPHGARRAPQDQERAGPVPHLPP 386 P R HGA R P+ R P PP Sbjct: 501 PPRCGVHGAVRPPRHAHRGEPAASPPP 581
>LOC_Os08g32420:12008.t02987:unspliced-genomic hypothetical protein| Length = 974 Score = 28.6 bits (56), Expect(2) = 0.28 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 / +3 Query: 763 CWHGAALRGRDTLLGSTSRTGRMWSSRRRGCTR 665 C H RG LLG R GR RRG R Sbjct: 291 CAHVPGARGHVDLLGGHGRAGRRGPRPRRGLPR 389 Score = 25.8 bits (50), Expect(2) = 0.28 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -2 / +2 Query: 655 RAWRGRPWTGRSPSLRPTPGPCA*ATARRSCT 560 RA PW RSP+ + C + + R CT Sbjct: 377 RAPARTPWRSRSPASPSSSSSCRSSPSPRCCT 472
>LOC_Os08g38520:12008.t03587:unspliced-genomic F-box domain containing protein| Length = 846 Score = 32.7 bits (65), Expect(2) = 0.28 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -2 / +2 Query: 721 GSTSRTGRMWSSRRRGCTRTC 659 GST+ T ++RRRGCTR+C Sbjct: 410 GSTTSTTASRTTRRRGCTRSC 472 Score = 24.9 bits (48), Expect(2) = 0.28 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -2 / +2 Query: 790 THHGCLGSTCWHGAALRGRDTLLGSTS 710 T G +TC GAA R R L TS Sbjct: 188 TAQGTCSTTCREGAAGRSRPPALSPTS 268
>LOC_Os11g03940:12011.t00284:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 12632 Score = 36.8 bits (74), Expect = 0.31 Identities = 18/39 (46%), Positives = 20/39 (51%) Frame = -2 / +1 Query: 646 RGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRR 530 RGR +G S S R P A + RR C GCR W RR Sbjct: 12274 RGRSGSGWSTSWRTPPTRSASSWRRRRCRGCRWW*TARR 12390
>LOC_Os10g17454:12010.t01303:unspliced-genomic RNA-binding protein precursor, putative, expressed| Length = 9572 Score = 36.8 bits (74), Expect = 0.31 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 / -1 Query: 995 HLVCFCSMVSTLTNNGWKRLAIPC 1066 H +C+C +NNGWKRL I C Sbjct: 6827 HWLCYCRWRPLYSNNGWKRLKIVC 6756
>LOC_Os08g01150:12008.t00015:unspliced-genomic lipopolysaccharide-modifying protein, putative, expressed| Length = 5254 Score = 36.8 bits (74), Expect = 0.31 Identities = 21/54 (38%), Positives = 24/54 (44%) Frame = -2 / -1 Query: 685 RRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP 524 RRR R C R+ P GR+P G C A RR+ S RRRGP Sbjct: 3961 RRRRAPRACRRS*T*GPGRGRAPGSGGAAGGCPTA*TRRASGTHAGTSPRRRGP 3800
>LOC_Os07g46970:12007.t04333:unspliced-genomic sex determination protein tasselseed-2, putative, expressed| Length = 1895 Score = 36.8 bits (74), Expect = 0.31 Identities = 18/48 (37%), Positives = 20/48 (41%) Frame = -2 / +1 Query: 682 RRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSC 539 R C R WR + W GR S RPT + AT S G R C Sbjct: 1723 RGRCRSWKGRRWRWKTWRGRPSSWRPTRPSSSPATTSSSTAGSRQARC 1866
>LOC_Os04g47000:12004.t04227:unspliced-genomic hypothetical protein| Length = 1815 Score = 36.8 bits (74), Expect = 0.31 Identities = 24/62 (38%), Positives = 27/62 (43%) Frame = -2 / +2 Query: 736 RDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTG 557 R T S R R W +RRR +R RGR W R G ATARR C+G Sbjct: 803 RTTSRRSIYRGERWWHTRRRHNSRKR*CQRRGRRWNKTERRSRRRNGRRRHATARRMCSG 982 Query: 556 CR 551 R Sbjct: 983 RR 988
>LOC_Os02g27300:12002.t02424:unspliced-genomic pathogenesis-related protein PRMS precursor, putative| Length = 831 Score = 36.8 bits (74), Expect = 0.31 Identities = 20/47 (42%), Positives = 21/47 (44%) Frame = -2 / -3 Query: 640 RPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRTCAGA 500 RP R PG +AR C GCRS RRR P R AGA Sbjct: 193 RPTRAARRRRRRGPGSVGRGSARYYCGGCRSRCRRRRRPRSRAAAGA 53
>LOC_Os01g72260:12001.t06514:unspliced-genomic cytochrome P450 86A2, putative, expressed| Length = 1828 Score = 36.8 bits (74), Expect = 0.31 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = -2 / +3 Query: 685 RRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRG 527 RR +C +W W GR+P P G + R+ +G + CRRRG Sbjct: 981 RRERSAGSCATSW*AS*WPGRTPPPPP*RGSSGSSPRTRAASGACTRRCRRRG 1139
>LOC_Os07g46940:12007.t04330:unspliced-genomic sex determination protein tasselseed-2, putative, expressed| Length = 1318 Score = 35.0 bits (70), Expect(2) = 0.31 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -2 / +2 Query: 682 RRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRS 548 R C R WR R W GR S RPT + AT S RS Sbjct: 917 RGTCRSWKGRRWRWRTWRGRPSSWRPTRPSSSPATTSSSMAASRS 1051 Score = 23.1 bits (44), Expect(2) = 0.31 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -3 / +3 Query: 759 GMEQRCGAEILF 724 G EQRC +++LF Sbjct: 198 GEEQRCSSDVLF 233
>LOC_Os01g55940:12001.t05003:unspliced-genomic indole-3-acetic acid-amido synthetase GH3.2, putative, expressed| Length = 3748 Score = 26.7 bits (52), Expect(3) = 0.33 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 / +1 Query: 655 RAWRGRPWTGRSPSLR 608 R WRGRPW S + R Sbjct: 142 RRWRGRPWRRASATRR 189 Score = 26.7 bits (52), Expect(3) = 0.33 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 / +2 Query: 604 TPGPCA*ATARRSCTGCRSWSCRRR 530 TP C A R SC RS C RR Sbjct: 2066 TPTTCTRARRRPSCAPTRSSPCTRR 2140 Score = 25.8 bits (50), Expect(3) = 0.33 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 / +2 Query: 256 PSGRSRRSWC 227 PSGRSR WC Sbjct: 3113 PSGRSRSGWC 3142
>LOC_Os01g71474:12001.t06443:unspliced-genomic lichenase-2 precursor, putative, expressed| Length = 3841 Score = 35.4 bits (71), Expect(2) = 0.34 Identities = 17/58 (29%), Positives = 22/58 (37%) Frame = -2 / +1 Query: 691 SSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*R 518 S+ R + + PW P RP RRSC+G SW+ R P R Sbjct: 2659 SAARASASSSARPTTTSPPWRTAGPPPRPPGSARTSRPTRRSCSGSSSWATRSPAPTR 2832 Score = 24.0 bits (46), Expect(2) = 0.34 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 / +1 Query: 983 TTFRHLHGGRPCSAHTQAPSCS 918 TT R CSA T +PSC+ Sbjct: 2560 TTCRRRARSPRCSARTASPSCA 2625
>LOC_Os04g54870:12004.t04960:unspliced-genomic RNA recognition motif containing protein, putative, expressed| Length = 4675 Score = 29.0 bits (57), Expect(2) = 0.34 Identities = 20/52 (38%), Positives = 23/52 (44%) Frame = -2 / +3 Query: 655 RAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRTCAGA 500 RA RGRP R + R TP +RR R+ RRR RR GA Sbjct: 4341 RAARGRPRRRRGSARRRTPAGARRTRSRRGRGAPRARP*RRRAWTRRARPGA 4496 Score = 24.9 bits (48), Expect(2) = 0.34 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -2 / +3 Query: 715 TSRTGRMWSSRRRGCTRTC 659 T RTGR R CTR C Sbjct: 4233 TGRTGRRRMRRTPPCTRAC 4289
>LOC_Os04g54860:12004.t04959:unspliced-genomic glutaredoxin family protein, expressed| Length = 2545 Score = 29.0 bits (57), Expect(2) = 0.35 Identities = 20/52 (38%), Positives = 23/52 (44%) Frame = -2 / -2 Query: 655 RAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRTCAGA 500 RA RGRP R + R TP +RR R+ RRR RR GA Sbjct: 1221 RAARGRPRRRRGSARRRTPAGARRTRSRRGRGAPRARP*RRRAWTRRARPGA 1066 Score = 24.9 bits (48), Expect(2) = 0.35 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -2 / -2 Query: 715 TSRTGRMWSSRRRGCTRTC 659 T RTGR R CTR C Sbjct: 1329 TGRTGRRRMRRTPPCTRAC 1273
>LOC_Os07g06860:12007.t00565:unspliced-genomic gibberellin receptor GID1L2, putative, expressed| Length = 1541 Score = 34.1 bits (68), Expect(2) = 0.36 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = -2 / -2 Query: 685 RRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTG 557 RRRG R WRG P SPS P+ P A AR TG Sbjct: 919 RRRGPGGARRRPWRGCPGRTGSPSGGPSWRPAAATAARTGRTG 791 Score = 24.0 bits (46), Expect(2) = 0.36 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 / -2 Query: 568 SCTGCRSWSCRRRGP 524 +C SW+CRRR P Sbjct: 283 TCGHGGSWACRRRPP 239
>LOC_Os06g29994:12006.t02702:unspliced-genomic transparent testa 12 protein, putative, expressed| Length = 12341 Score = 35.4 bits (71), Expect(2) = 0.38 Identities = 21/54 (38%), Positives = 25/54 (46%) Frame = +3 / +1 Query: 474 GGRCLHDLAAPAHVRRQGPRRRHDQLLQPVQERRAVAQAQGPGVGRREGDLPVQ 635 GGR P V GPRRR Q + ++RR V +G G REG VQ Sbjct: 10039 GGRRRGGAVPPGRVLGAGPRRRDGQPWRRPRQRRVVLDQRGRTGGVREGVEVVQ 10200 Score = 25.4 bits (49), Expect(2) = 0.38 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 / +2 Query: 814 INDEFKLYRCHTIKNCTHACPK 879 ++D + RCH +KN A PK Sbjct: 10619 VHDPLRPRRCHKVKNKLKAQPK 10684
>LOC_Os10g39160:12010.t03159:unspliced-genomic peroxidase 2 precursor, putative| Length = 1127 Score = 36.3 bits (73), Expect = 0.42 Identities = 17/37 (45%), Positives = 19/37 (51%) Frame = -2 / -3 Query: 685 RRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATA 575 R CTRTC R R+P RP GPC *+TA Sbjct: 804 RSSACTRTCRTWRRRACARRRAPPCRPRSGPCW*STA 694
>LOC_Os10g21590:12010.t01644:unspliced-genomic carbohydrate transporter/ sugar porter, putative, expressed| Length = 4710 Score = 36.3 bits (73), Expect = 0.42 Identities = 20/46 (43%), Positives = 23/46 (50%) Frame = -2 / -2 Query: 700 RMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSC 563 R W RRR TR RA R P +G + + R GPC ARR C Sbjct: 4064 RRWRRRRRR*TRWRWRARRPTPASGAAATAR*R*GPCRGRRARR*C 3927
>LOC_Os10g20500:12010.t01543:unspliced-genomic conserved hypothetical protein| Length = 1791 Score = 36.3 bits (73), Expect = 0.42 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = -2 / +2 Query: 640 RPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRTCA 506 R W S S PT + + R TG SW+ RRRG R+C+ Sbjct: 242 RRWPRWSTSPSPTSPSASSPASSRGATGSTSWARRRRGSWTRSCS 376
>LOC_Os10g20260:12010.t01519:unspliced-genomic CSLF7 - cellulose synthase-like family F; beta1,3;1,4 glucan| synthase, expressed Length = 7218 Score = 36.3 bits (73), Expect = 0.42 Identities = 20/61 (32%), Positives = 22/61 (36%) Frame = -2 / -3 Query: 712 SRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRR 533 +R R S R C W P R+PS RP P P T R W RR Sbjct: 6184 TRRARRRSRRSATLAGACRSPWPRPPSRCRTPSRRPCPTPSRPRTRTTRAHSPRQWRRRR 6005 Query: 532 R 530 R Sbjct: 6004 R 6002
>LOC_Os08g34900:12008.t03230:unspliced-genomic pectinesterase PPE8B precursor, putative, expressed| Length = 4290 Score = 36.3 bits (73), Expect = 0.42 Identities = 23/60 (38%), Positives = 28/60 (46%) Frame = -2 / -2 Query: 685 RRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRTCA 506 R G R R R RP +G + S P PC +RRS TG RS S R P +C+ Sbjct: 971 RSSGGRR*RSRPCRRRPASGSTSSS*CPPSPCTRPFSRRSRTGSRSPSAPRPRPRSPSCS 792
>LOC_Os08g27440:12008.t02508:unspliced-genomic hypothetical protein| Length = 1867 Score = 36.3 bits (73), Expect = 0.42 Identities = 19/48 (39%), Positives = 24/48 (50%) Frame = -2 / +2 Query: 739 GRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPG 596 G +++ + GRM RRRG RT A P +GR PSL PG Sbjct: 227 GLGSVVWRVAADGRMQRLRRRGGGRTAAAAAYSPPRSGRDPSLPSPPG 370
>LOC_Os04g59120:12004.t05370:unspliced-genomic mtN21 nodulin protein-like, putative, expressed| Length = 3302 Score = 36.3 bits (73), Expect = 0.42 Identities = 21/56 (37%), Positives = 24/56 (42%) Frame = -2 / -3 Query: 670 TRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRTCAG 503 +R + WR R G P R G CA ARR CT +W R R RR G Sbjct: 2328 SRGRYSRWRRRRRGGAPPGRRRGRGGCARG*ARRPCTR*AAWRRRPRAACRRPWPG 2161
>LOC_Os02g58020:12002.t05373:unspliced-genomic protein GCN20, putative, expressed| Length = 5828 Score = 36.3 bits (73), Expect = 0.42 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = -2 / -1 Query: 739 GRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA 587 GR R GR S RR C R W GRP R P+P PC+ Sbjct: 269 GRRARRRCRGRRGRRSRSPRRRGRWRCSR*WAGRPRRRRRSPAPPSPPPCS 117
>LOC_Os02g30450:12002.t02738:unspliced-genomic NHL25, putative| Length = 753 Score = 36.3 bits (73), Expect = 0.42 Identities = 21/59 (35%), Positives = 25/59 (42%) Frame = -2 / +2 Query: 691 SSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RR 515 S+R C W R W R+P LRP A A + RSC+ R R G RR Sbjct: 473 STRATATPGWCTSRWATRRWRARAPWLRPCSRLSAAAASCRSCSAARCRCG*RLGRSRR 649
>LOC_Os01g38110:12001.t03349:unspliced-genomic cytochrome P450 76C4, putative, expressed| Length = 1938 Score = 35.4 bits (71), Expect(2) = 0.45 Identities = 19/49 (38%), Positives = 23/49 (46%) Frame = +3 / +3 Query: 510 HVRRQGPRRRHDQLLQPVQERRAVAQAQGPGVGRREGDLPVQGRPRQAR 656 H + GP+RR D LLQ +E A P R G +P Q PR R Sbjct: 336 HDDQAGPQRRRDHLLQGRREGGVHAVRPPPRGARHPGHVPRQRLPRAVR 482 Score = 22.6 bits (43), Expect(2) = 0.45 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +1 / +2 Query: 691 STSCPSYW 714 S SCP+YW Sbjct: 1529 SASCPTYW 1552
>LOC_Os05g31730:12005.t02770:unspliced-genomic transporter, monovalent cation proton antiporter-2, putative,| expressed Length = 3958 Score = 28.6 bits (56), Expect(2) = 0.46 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 / +3 Query: 607 PTPGPCA*ATARRSCTGCRSWSCRRR 530 P P P A R S C W CR R Sbjct: 3327 PAPPPTPSACTRCSARSCSGWPCRGR 3404 Score = 24.9 bits (48), Expect(2) = 0.46 Identities = 12/43 (27%), Positives = 16/43 (37%) Frame = -2 / +3 Query: 715 TSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA 587 ++R+ R W + R T WR S P P P A Sbjct: 3225 SARSARSWRAWRAALAPTARATWRAPAPWRACSSPAPPPTPSA 3353
>LOC_Os01g18290:12001.t01624:unspliced-genomic basic helix-loop-helix dimerisation region bHLH, putative, expressed| Length = 3417 Score = 29.5 bits (58), Expect(2) = 0.47 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -2 / +2 Query: 625 RSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*R 518 R+P++R P A A++RRSC RR P R Sbjct: 1202 RAPTIRRPMSPRATASSRRSCRRRAGQGAHRRSPIR 1309 Score = 24.0 bits (46), Expect(2) = 0.47 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -2 / +2 Query: 652 AWRGRPWTGRSPSLRPT 602 +WRGR W R PT Sbjct: 1163 SWRGRRWRARRGRRAPT 1213
>LOC_Os03g13600:12003.t01154:unspliced-genomic zinc finger protein 7, putative, expressed| Length = 2775 Score = 27.2 bits (53), Expect(2) = 0.47 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -2 / -3 Query: 568 SCTGCRSWSCRRRGP*RRTCAG 503 SC RSW R P RRT +G Sbjct: 2329 SCPATRSWHPHRLPPARRTASG 2264 Score = 26.3 bits (51), Expect(2) = 0.47 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -2 / -3 Query: 685 RRRGCTRTCHRAWRGRPWTGRSPSLRPTPG 596 RRR R C R W R + R P R G Sbjct: 2449 RRRPARRRCRRGWSWRSRS*RRPGRRRRRG 2360
>LOC_Os08g40840:12008.t03814:unspliced-genomic exo70 exocyst complex subunit family protein| Length = 2595 Score = 30.4 bits (60), Expect(2) = 0.47 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 / -3 Query: 321 PHGARRAPQDQERAGPVPHLPPELP 395 P G R P+ + R GP P PP P Sbjct: 364 PRGRRTPPRPRRRPGPPPGAPPRPP 290 Score = 23.1 bits (44), Expect(2) = 0.47 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +3 / -1 Query: 507 AHVRRQGPRRRH 542 A R +GPRRRH Sbjct: 270 AERREEGPRRRH 235
>LOC_Os02g57810:12002.t05352:unspliced-genomic cytochrome P-450-like protein, putative| Length = 1596 Score = 28.1 bits (55), Expect(2) = 0.49 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -2 / -3 Query: 700 RMWSSRRRGCTRTCHRAWRGR 638 R W+ R G R C RA RGR Sbjct: 412 RTWACGRGGTRRACPRACRGR 350 Score = 25.4 bits (49), Expect(2) = 0.49 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = -2 / -3 Query: 646 RGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRR 533 +GR TG +P PC A G R CRR Sbjct: 325 QGRRRTGTAPCRASRRTPCRTPAATARSRGTRRRGCRR 212
>LOC_Os12g44030:12012.t04069:unspliced-genomic purple acid phosphatase precursor, putative, expressed| Length = 1320 Score = 27.6 bits (54), Expect(2) = 0.50 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = -2 / -3 Query: 646 RGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP 524 R R GR+P+ C * R SC R RRRGP Sbjct: 751 RRRAPGGRAPACTARR*CCT*CWRRGSCARRRGHGRRRRGP 629 Score = 25.8 bits (50), Expect(2) = 0.50 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -2 / -3 Query: 748 ALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGR 638 A RGR G+ SR SSRRR R W R Sbjct: 856 APRGRSCPPGTPSRAAAATSSRRRAPRCCRRRRWSRR 746
>LOC_Os01g74020:12001.t06682:unspliced-genomic ARR1 protein-like, putative, expressed| Length = 1309 Score = 29.5 bits (58), Expect(2) = 0.50 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 / +3 Query: 661 CHRAWRGRPWTGRSPSLRPTPGPCA*ATARR 569 C W R W RS S R C+ TARR Sbjct: 321 CRSRWCRRGWRRRSASRRSPGARCSTCTARR 413 Score = 24.0 bits (46), Expect(2) = 0.50 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 / +3 Query: 583 ATARRSCTGCRSWSCRRRGP*RRT 512 A RR C GC + RRR RR+ Sbjct: 405 ARRRRRCPGCGARRRRRRARSRRS 476
>LOC_Os06g10100:12006.t00888:unspliced-genomic expressed protein| Length = 1263 Score = 29.9 bits (59), Expect(2) = 0.50 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = -2 / +2 Query: 637 PWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*R 518 P R RP G A RR+ + C WS RRR P R Sbjct: 455 PRPARLRRSRPRRGRLRLARPRRASSECARWSRRRRHPCR 574 Score = 23.5 bits (45), Expect(2) = 0.50 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -3 / +3 Query: 720 VPPVGRAGCGAAGA 679 VP RAG GAAGA Sbjct: 306 VPGAARAGRGAAGA 347
>LOC_Os02g17534:12002.t01546:unspliced-genomic fucosyltransferase 8, putative, expressed| Length = 6984 Score = 31.8 bits (63), Expect(3) = 0.53 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 / -2 Query: 583 ATARRSCTGCRSWSCRRRGP*RRTCAGA 500 A ARRS T CR RRRG RT A A Sbjct: 5921 AAARRSRTACRGSRRRRRGGGTRTAAAA 5838 Score = 24.9 bits (48), Expect(3) = 0.53 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 / -3 Query: 449 ASPLSPSMFMAQLPQMPS 396 ASPLSP+ + LP +P+ Sbjct: 4621 ASPLSPTAGLLSLPSIPA 4568 Score = 23.5 bits (45), Expect(3) = 0.53 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -3 / -3 Query: 1065 HGIARRFHPLFVRVETMEQKQTKWQADYNFPTSPR 961 HG+ R HPL + E +++ + + PR Sbjct: 6043 HGVLLREHPLELATERRHEEEPRDEVAVRLHQQPR 5939
>LOC_Os03g13630:12003.t01157:unspliced-genomic FAE3, putative| Length = 435 Score = 29.5 bits (58), Expect(2) = 0.53 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -2 / -3 Query: 574 RRSCTGCRSWSCRRRGP*RRTC 509 RR+ T RSW RR P RR C Sbjct: 148 RRTTTARRSWRRGRRAPGRRAC 83 Score = 24.0 bits (46), Expect(2) = 0.53 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -2 / -3 Query: 721 GSTSRTGRMWSSRRRGCTRTC 659 G + R R W RR C R C Sbjct: 307 GGSRRR*RRWRLRRSPCQRDC 245
>LOC_Os01g10480:12001.t00922:unspliced-genomic early nodulin 20 precursor, putative| Length = 897 Score = 33.6 bits (67), Expect(2) = 0.54 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -2 / -1 Query: 712 SRTGRMWSSRRRGCTRTCHRAWRGRP 635 S + R W RRR C C WR RP Sbjct: 726 SPSRRRWRRRRRACRGRCWNGWRRRP 649 Score = 23.1 bits (44), Expect(2) = 0.54 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 / -3 Query: 565 CTGCRSWSCRRRGP*RRTCA 506 CT R WS RR RR+ A Sbjct: 148 CTARRGWSSTRRALPRRSRA 89
>LOC_Os12g37380:12012.t03418:unspliced-genomic RNA binding protein, putative, expressed| Length = 2732 Score = 35.9 bits (72), Expect = 0.58 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -2 / -3 Query: 709 RTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPG 596 RT R SRRR R RA RPWT RP PG Sbjct: 297 RTRRARRSRRRSAPRPSWRAGAPRPWTPPGREGRPGPG 184
>LOC_Os12g32170:12012.t02919:unspliced-genomic hypothetical protein| Length = 786 Score = 35.9 bits (72), Expect = 0.58 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +3 / -1 Query: 522 QGPRRRHDQLLQPVQERRAVAQAQGPGVGRREGDLPVQG 638 QG RRHD L +E R A+A+ GVG GDL + G Sbjct: 231 QGVDRRHDHLGDAGEEGRLRAEAEQVGVGVGGGDLHIAG 115 Score = 35.4 bits (71), Expect = 0.79 Identities = 18/40 (45%), Positives = 20/40 (50%) Frame = -2 / +2 Query: 625 RSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRTCA 506 RSP PTP A A +R S WSCRR P R + A Sbjct: 128 RSPPPTPTPTCSASARSRPSSPASPRWSCRRSTPWRSSSA 247
>LOC_Os11g13670:12011.t01201:unspliced-genomic gibberellin receptor GID1L2, putative, expressed| Length = 1541 Score = 35.9 bits (72), Expect = 0.58 Identities = 20/50 (40%), Positives = 23/50 (46%) Frame = -2 / +3 Query: 724 LGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATA 575 LG +R R W SRRR R R R P + R S P P A +TA Sbjct: 51 LGCPNREARPWRSRRRRGWRRRWRGGRASPSSPRGASPTPRAAPTAPSTA 200
>LOC_Os11g03410:12011.t00231:unspliced-genomic secondary cell wall-related glycosyltransferase family 47,| putative, expressed Length = 3629 Score = 35.9 bits (72), Expect = 0.58 Identities = 20/59 (33%), Positives = 25/59 (42%) Frame = -2 / +2 Query: 736 RDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCT 560 R +L +T T + RR TR C R W G W RS R P T R +C+ Sbjct: 635 RSSLPSATIATPGLCLRRR*AGTRDCRRGWSGI*WRSRSGRGRVAPTMSLSRTTRIACS 811
>LOC_Os10g23310:12010.t01808:unspliced-genomic agmatine coumaroyltransferase, putative, expressed| Length = 1964 Score = 35.9 bits (72), Expect = 0.58 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = +3 / +2 Query: 267 PVDEAPPQGLQGGPLRLRPHGARRAPQDQERAGPVPHLP 383 P+ PP G P R P G RR PQ R V H+P Sbjct: 1124 PLLRRPPAGEDAEPRRPLPAGVRRRPQGPRRRRAVQHVP 1240 Score = 24.9 bits (48), Expect(2) = 5.2 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -2 / -3 Query: 718 STSRTGRMWSSRRRGCTRTCHRAWR 644 +T T R + RRRG R R+WR Sbjct: 1497 TTGCTARRRAPRRRG*RRPRRRSWR 1423 Score = 24.9 bits (48), Expect(2) = 5.2 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = -2 / -3 Query: 640 RPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RR 515 RP +PS R P + +T TG + RRRGP* R Sbjct: 1320 RPSPACTPSARGRAPP*SSSTRAPGGTGTCCTARRRRGP*GR 1195
>LOC_Os08g05910:12008.t00483:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 8130 Score = 35.9 bits (72), Expect = 0.58 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 / -2 Query: 685 RRRGCTRTCHRAWRGR 638 RRR C R C RAWRGR Sbjct: 1673 RRRACRRRCRRAWRGR 1626
>LOC_Os07g38800:12007.t03544:unspliced-genomic lectin-like receptor kinase 7, putative, expressed| Length = 2626 Score = 35.9 bits (72), Expect = 0.58 Identities = 19/40 (47%), Positives = 21/40 (52%) Frame = -2 / +2 Query: 631 TGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRT 512 T R PS R + P T + TG RSWS RRR RRT Sbjct: 452 TWRGPSPRLSCSPSCPGTTA*ATTGSRSWSRRRRTSRRRT 571
>LOC_Os07g07070:12007.t00586:unspliced-genomic anthranilate phosphoribosyltransferase-like protein, putative,| expressed Length = 3892 Score = 35.9 bits (72), Expect = 0.58 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -2 / +1 Query: 772 GSTCWHGAALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWR 644 G W G GR R W RRRGC R+C A R Sbjct: 2911 GRRRWCGRGTTGRGWSARGCRRWSATWRRRRRGCRRSCRGATR 3039
>LOC_Os07g07060:12007.t00585:unspliced-genomic prolyl-tRNA synthetase, putative, expressed| Length = 3702 Score = 35.9 bits (72), Expect = 0.58 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -2 / -1 Query: 772 GSTCWHGAALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWR 644 G W G GR R W RRRGC R+C A R Sbjct: 3387 GRRRWCGRGTTGRGWSARGCRRWSATWRRRRRGCRRSCRGATR 3259
>LOC_Os04g57510:12004.t05217:unspliced-genomic exostosin-like, putative, expressed| Length = 5149 Score = 35.9 bits (72), Expect = 0.58 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +3 / +1 Query: 324 HGARRAPQDQERAGPVPHLPPELP 395 HGA RAP+ RA P+P LPP P Sbjct: 31 HGAPRAPRRPRRAPPLPLLPPPAP 102
>LOC_Os03g60810:12003.t05318:unspliced-genomic lectin-like receptor kinase 7, putative, expressed| Length = 3175 Score = 35.9 bits (72), Expect = 0.58 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = -2 / -1 Query: 628 GRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RR 515 GRS P+ P A +C GCRS RRR P RR Sbjct: 1585 GRSCRASPSSAPAARRRRTGACRGCRSPCSRRRAPARR 1472
>LOC_Os02g36890:12002.t03326:unspliced-genomic DNA binding protein, putative, expressed| Length = 2323 Score = 35.9 bits (72), Expect = 0.58 Identities = 18/39 (46%), Positives = 20/39 (51%) Frame = -2 / +2 Query: 655 RAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSC 539 RAWRGRP GRSP R A +T RR + R C Sbjct: 1538 RAWRGRPSCGRSPRRRRQRPR*AGSTRRRRLSASRRAHC 1654
>LOC_Os02g21330:12002.t01923:unspliced-genomic expressed protein| Length = 1031 Score = 35.9 bits (72), Expect = 0.58 Identities = 20/54 (37%), Positives = 24/54 (44%) Frame = -2 / -3 Query: 712 SRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCR 551 SR+ R +R GC R R R R WT + T G A A AR T C+ Sbjct: 249 SRSARRRGARGGGCPRRRRRTMRSRRWTA*AAMGGYTAGAAAAAAARWIATVCK 88
>LOC_Os01g59020:12001.t05294:unspliced-genomic cytochrome P450 94A2, putative, expressed| Length = 1758 Score = 35.9 bits (72), Expect = 0.58 Identities = 19/65 (29%), Positives = 25/65 (38%) Frame = -2 / +3 Query: 694 WSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RR 515 W + R RT + R WT R+ S R +T R C R W R P R Sbjct: 1335 WGAWRTSGARTARSSGRSGGWTRRARSGRRARSSTRCSTRGRGCA*ARRWPTYR*SPSWR 1514 Query: 514 TCAGA 500 C+ + Sbjct: 1515 ACSSS 1529
>LOC_Os01g39860:12001.t03512:unspliced-genomic 1-aminocyclopropane-1-carboxylate oxidase 1, putative, expressed| Length = 1980 Score = 35.9 bits (72), Expect = 0.58 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = -2 / -3 Query: 637 PWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRTCAGA 500 P + R+ + R T P + A +RR GCR+W GP RR GA Sbjct: 1279 PGSRRTCTARGTAPPPSPARSRRRARGCRTWRRTGGGPRRRRRRGA 1142
>LOC_Os01g19260:12001.t01716:unspliced-genomic cell Division Protein AAA ATPase family, putative, expressed| Length = 1998 Score = 35.9 bits (72), Expect = 0.58 Identities = 19/53 (35%), Positives = 24/53 (45%) Frame = -2 / -3 Query: 688 SRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRR 530 +RRR C WR WT R P+ R P + A R + CRS + R R Sbjct: 1051 ARRRRCRSRGSWPWRRSWWTCRCPAGRAAGSPASTACRRAGRSPCRSGTRRGR 893
>LOC_Os01g15229:12001.t01374:unspliced-genomic hypothetical protein| Length = 801 Score = 35.9 bits (72), Expect = 0.58 Identities = 20/51 (39%), Positives = 22/51 (43%) Frame = -2 / -3 Query: 709 RTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTG 557 RT + SS R R RP R P RP PC TARR C+G Sbjct: 640 RTRSVSSSSARAAAAAQPPPRRRRPPPPRQPRGRPGRSPCKGTTARRRCSG 488
>LOC_Os01g15139:12001.t01366:unspliced-genomic hypothetical protein| Length = 801 Score = 35.9 bits (72), Expect = 0.58 Identities = 20/51 (39%), Positives = 22/51 (43%) Frame = -2 / -3 Query: 709 RTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTG 557 RT + SS R R RP R P RP PC TARR C+G Sbjct: 640 RTRSVSSSSARAAAAAQPPPRRRRPPPPRQPRGRPGRSPCKGTTARRRCSG 488
>LOC_Os02g51080:12002.t04692:unspliced-genomic geranylgeranyl hydrogenase, putative, expressed| Length = 2594 Score = 32.7 bits (65), Expect(2) = 0.58 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -2 / -1 Query: 691 SSRRRGCTRTCHRAWRGRPWTGRSPS 614 SS R RT R RGR W+GR+PS Sbjct: 2087 SSSGRSRRRTSRRTPRGRRWSGRTPS 2010 Score = 25.4 bits (49), Expect(2) = 0.58 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -2 / -3 Query: 607 PTPGPCA*ATARRSCTGCR 551 P GPC A R+C CR Sbjct: 510 PRGGPCRCTRAARACRRCR 454
>LOC_Os06g22980:12006.t02111:unspliced-genomic CSLD5 - cellulose synthase-like family D, expressed| Length = 3669 Score = 32.7 bits (65), Expect(2) = 0.58 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -2 / -2 Query: 721 GSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGR 623 G+ R R R G + R WRGRPW GR Sbjct: 1541 GTGGRRPRRTPRRGAGS*SSPARCWRGRPWRGR 1443 Score = 25.8 bits (50), Expect(2) = 0.58 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -2 / -2 Query: 646 RGRPWTGRSPSLRPTPGPC 590 R P GR+P PTP C Sbjct: 734 RATPRRGRAPRTAPTPAAC 678
>LOC_Os03g15420:12003.t01328:unspliced-genomic GTP binding protein, putative, expressed| Length = 2418 Score = 30.4 bits (60), Expect(2) = 0.64 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -2 / -1 Query: 610 RPTPGPCA*ATARRSCTGCRSWSCRRRG 527 RP P P + R CT +W+ RRRG Sbjct: 483 RPRPWPPRWSPRGRCCTPAAAWASRRRG 400 Score = 22.6 bits (43), Expect(2) = 0.64 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 / -1 Query: 670 TRTCHRAWRGRPWTGR 623 +R R WR RPW R Sbjct: 507 SRPWRR*WRPRPWPPR 460
>LOC_Os12g41300:12012.t03807:unspliced-genomic F-box domain containing protein| Length = 1840 Score = 29.9 bits (59), Expect(2) = 0.65 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -2 / -1 Query: 703 GRMWSSRRRGCTRTCHRAWRGRPWTG 626 GR RRR C+ R WRG W+G Sbjct: 370 GRTIRRRRR*CSGRPRRRWRGCRWSG 293 Score = 23.1 bits (44), Expect(2) = 0.65 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -3 / -1 Query: 759 GMEQRCGAEILFWVPPVGRAGCGAA 685 G+ RC A W P RAG A+ Sbjct: 502 GVSARCAARRRPWPPRGRRAGAAAS 428
>LOC_Os05g09060:12005.t00783:unspliced-genomic collagen alpha-2, putative| Length = 1660 Score = 27.6 bits (54), Expect(2) = 0.66 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 / -2 Query: 778 CLGSTCWHGAALRGRDTLLGSTSRTGR 698 C S+C ++ R T GS+SRTGR Sbjct: 1464 CAASSCSSPSSSRRGSTRSGSSSRTGR 1384 Score = 25.4 bits (49), Expect(2) = 0.66 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 / -2 Query: 640 RPWTGRSPSLRPTPGPCA*ATAR 572 R + RS SLR P PC+ A +R Sbjct: 1299 RTTSSRSASLRRPPTPCSRAASR 1231
>LOC_Os09g34930:12009.t03020:unspliced-genomic acyltransferase, putative, expressed| Length = 1635 Score = 29.0 bits (57), Expect(2) = 0.66 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 / -3 Query: 574 RRSCTGCRSWSCRRRGP*RRTCA 506 RR+ RSW RR P RR CA Sbjct: 502 RRTTAARRSWRRGRRAPGRRACA 434 Score = 24.0 bits (46), Expect(2) = 0.66 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = -2 / -3 Query: 721 GSTSRTGRMWSSRRRGCTRTC 659 G R R W RR C R C Sbjct: 661 GGPRRRRRRWRPRRSPCRRGC 599
>LOC_Os05g43590:12005.t03849:unspliced-genomic protein Z, putative| Length = 939 Score = 28.6 bits (56), Expect(2) = 0.68 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 / +3 Query: 285 PQGLQGGPLRLRPHGARRAPQDQERAGPVPH 377 P+ + GG R HG R P Q A VPH Sbjct: 336 PRAIHGGEPPARLHGRRLPPGLQRPAHDVPH 428 Score = 24.4 bits (47), Expect(2) = 0.68 Identities = 17/62 (27%), Positives = 25/62 (40%) Frame = +3 / +3 Query: 453 PHQDLLGGGRCLHDLAAPAHVRRQGPRRRHDQLLQPVQERRAVAQAQGPGVGRREGDLPV 632 PH G+ + D+ P R+ P R LQP + +A GRR D + Sbjct: 423 PHGRRRRRGQDVRDVHLPPRRPRRPPGARAQARLQPGRVPAQDDRAGAACCGRRAQDPQI 602 Query: 633 QG 638 +G Sbjct: 603 RG 608
>LOC_Os04g24850:12004.t02195:unspliced-genomic cytokinin-O-glucosyltransferase 2, putative, expressed| Length = 1552 Score = 25.4 bits (49), Expect(3) = 0.70 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 / -2 Query: 703 GRMWSSRRRGCTRTCHRAWRGRP 635 G W SR G RTC R RP Sbjct: 624 G*SWGSRAAGRRRTCRGRRRRRP 556 Score = 25.4 bits (49), Expect(3) = 0.70 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -2 / -1 Query: 643 GRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSW 545 GR GR P+ PTP A A+ G SW Sbjct: 385 GRRRRGR*PAATPTPAH*ASTAAQGGGRGSSSW 287 Score = 24.9 bits (48), Expect(3) = 0.70 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 / -1 Query: 959 GRPCSAHTQAPSCSF 915 GR S+H++ PSCSF Sbjct: 901 GRWPSSHSRRPSCSF 857
>LOC_Os03g19990:12003.t01761:unspliced-genomic WD40-like Beta Propeller Repeat family protein, expressed| Length = 3278 Score = 29.5 bits (58), Expect(2) = 0.71 Identities = 15/45 (33%), Positives = 18/45 (40%) Frame = -2 / -3 Query: 637 PWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRTCAG 503 PW+ R P P+ P A R C+GC P RR G Sbjct: 1341 PWSRRWPPESPSRTPPASPGRSRRCSGCAGTRPSSCSPRRRPSCG 1207 Score = 28.6 bits (56), Expect(2) = 0.71 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 / -3 Query: 715 TSRTGRMWSSRRRGCTRTCHRAWRGR 638 T TGR RR G T RAWR R Sbjct: 2982 TGTTGRARPPRRGGSTARAGRAWRTR 2905
>LOC_Os06g11700:12006.t01047:unspliced-genomic phi-1-like phosphate-induced protein, putative, expressed| Length = 1265 Score = 31.3 bits (62), Expect(2) = 0.74 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -2 / +1 Query: 634 WTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*R 518 W RSP+ P P P ATA S T R RR P R Sbjct: 727 WWRRSPACWPAP*PTRSATATTSATRTRRSRRARRAPAR 843 Score = 25.4 bits (49), Expect(2) = 0.74 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 / +2 Query: 736 RDTLLGSTSRTGRMWSSRRRGCTR 665 R L G + GR +RRRGC R Sbjct: 419 RGVLPGEVADAGRGVPARRRGCPR 490
>LOC_Os02g49520:12002.t04536:unspliced-genomic ubiquitin-protein ligase, putative, expressed| Length = 5176 Score = 32.2 bits (64), Expect(2) = 0.79 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -2 / +2 Query: 625 RSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRG 527 R+ + R T C A RR C G R W RRG Sbjct: 4082 RTGTSRSTWPSCRRAPCRRYCAGSRRWGAARRG 4180 Score = 26.3 bits (51), Expect(2) = 0.79 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 / +2 Query: 700 RMWSSRRRGCTRTCHRAW 647 R +S RRGC+ C R W Sbjct: 3896 RRSASPRRGCSSPCPRTW 3949
>LOC_Os12g41200:12012.t03797:unspliced-genomic expressed protein| Length = 8826 Score = 35.4 bits (71), Expect = 0.79 Identities = 21/57 (36%), Positives = 24/57 (42%) Frame = -2 / -1 Query: 685 RRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RR 515 RRRG R R R + SP+ P + AR SC GC RRR RR Sbjct: 8337 RRRGGWRAPPRGGAARAGSAASPARAARSSPTSCGHARGSCAGCGCGGRRRRRRRRR 8167
>LOC_Os12g38090:12012.t03490:unspliced-genomic F-box domain containing protein| Length = 1398 Score = 35.4 bits (71), Expect = 0.79 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -2 / -3 Query: 646 RGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRG 527 RGR W R+ S RP P RRS C RRRG Sbjct: 268 RGRGWRRRAASRRPPPTRTGGGGRRRSAPSCGGGGGRRRG 149
>LOC_Os10g03110:12010.t00200:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4941 Score = 35.4 bits (71), Expect = 0.79 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 / -1 Query: 694 WSSRRRGCTRTCHRAWRGRPWTGRSPSLRP 605 W S R T C RAW RPW RP Sbjct: 3915 WRSSRNQATVGCRRAWHSRPWVLAGVRTRP 3826
>LOC_Os09g04710:12009.t00367:unspliced-genomic anther-specific proline-rich protein APG precursor, putative,| expressed Length = 2752 Score = 35.4 bits (71), Expect = 0.79 Identities = 20/49 (40%), Positives = 24/49 (48%) Frame = -2 / +2 Query: 676 GCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRR 530 G TR + RGR RS + R T G A T+ R+ T CRS C R Sbjct: 578 GSTRRG*GSPRGRLKPARSSARRSTSGASAPTTSSRTTTTCRSGGCSTR 724
>LOC_Os07g33740:12007.t03052:unspliced-genomic vrga1, putative, expressed| Length = 3289 Score = 35.4 bits (71), Expect = 0.79 Identities = 18/45 (40%), Positives = 22/45 (48%) Frame = -2 / +1 Query: 664 TCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRR 530 TC AWR R S S RP+ GP + R C+ R+ S R R Sbjct: 214 TCCTAWRPRSPGSGSSSRRPSAGPSPGPASPRGCSSSRTPSPRPR 348
>LOC_Os07g25450:12007.t02241:unspliced-genomic histone-lysine N-methyltransferase, H3 lysine-9, H3 lysine-27,| H4lysine-20 and cytosine specific SUVH2, putative, expressed Length = 6965 Score = 35.4 bits (71), Expect = 0.79 Identities = 24/66 (36%), Positives = 28/66 (42%) Frame = -2 / +2 Query: 700 RMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP* 521 R ++ RRRG R R RP GR S P + RRS GC +CR R Sbjct: 632 RRYTCRRRGRPA*SCRRRRRRPPRGRWRSPGRGPARRSGGRGRRSWCGCPR*ACRTRSTS 811 Query: 520 RRTCAG 503 CAG Sbjct: 812 GTWCAG 829
>LOC_Os06g48240:12006.t04510:unspliced-genomic ATPase protein, putative, expressed| Length = 1708 Score = 35.4 bits (71), Expect = 0.79 Identities = 21/56 (37%), Positives = 27/56 (48%) Frame = -2 / +3 Query: 715 TSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRS 548 +S + R S RR CT T A R R+P+ R TP + RRS TG R+ Sbjct: 270 SSTSARAASPRRPRCTSTRRTARRPPWRRCRAPTPRATPSAASACCGRRSSTGTRA 437
>LOC_Os06g23530:12006.t02165:unspliced-genomic pre-mRNA-splicing factor ATP-dependent RNA helicase, putative,| expressed Length = 3517 Score = 35.4 bits (71), Expect = 0.79 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = -2 / -2 Query: 646 RGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RR 515 RG P T P L P P PC C G + + R RG RR Sbjct: 435 RGTPGTAPDPHLSPAPPPCPSRKPLHRCHGRQGFGGRGRGRRRR 304
>LOC_Os05g48520:12005.t04286:unspliced-genomic glyoxal oxidase, putative, expressed| Length = 2734 Score = 35.4 bits (71), Expect = 0.79 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -2 / +2 Query: 772 GSTCWHGAALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPT 602 GS W RG T SRT R WS RT AW R G S S R T Sbjct: 1667 GSGRWRRRRWRGCTTPPAPCSRTPRCWSPAGTRTRRTTSAAWTSRRRCGWSGSRRRT 1837
>LOC_Os05g16360:12005.t01406:unspliced-genomic protein kinase domain containing protein, expressed| Length = 1078 Score = 35.4 bits (71), Expect = 0.79 Identities = 18/43 (41%), Positives = 21/43 (48%) Frame = -2 / +3 Query: 769 STCWHGAALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRG 641 +TC + GR T S T +SRRR TRTC R RG Sbjct: 726 ATCTASGSACGRSTAARCRSWTSAWPTSRRRSSTRTCGRRSRG 854
>LOC_Os05g03174:12005.t00214:unspliced-genomic glycosyltransferase, putative, expressed| Length = 6714 Score = 35.4 bits (71), Expect = 0.79 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +3 / -3 Query: 288 QGLQGGPLRLRPHGARRAPQDQERAGPVPHLPP 386 +GL P RPH +R Q Q+ A P P LPP Sbjct: 1075 RGLHHHPHHRRPHQPQRVRQPQQLAAPPPPLPP 977
>LOC_Os03g60340:12003.t05272:unspliced-genomic expressed protein| Length = 3720 Score = 35.4 bits (71), Expect = 0.79 Identities = 19/50 (38%), Positives = 21/50 (42%) Frame = -2 / -2 Query: 718 STSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARR 569 ++SR R RRG T C R PS PT PC A ARR Sbjct: 3242 ASSRAARSTRRGRRGGTSGCSRRSSSGRRRAAPPSASPTAAPCTPACARR 3093
>LOC_Os03g52940:12003.t04617:unspliced-genomic expressed protein| Length = 805 Score = 35.4 bits (71), Expect = 0.79 Identities = 16/30 (53%), Positives = 20/30 (66%) Frame = +3 / +3 Query: 525 GPRRRHDQLLQPVQERRAVAQAQGPGVGRR 614 G RRR ++ PVQ RRA A+ +G G GRR Sbjct: 153 GGRRRRRVVVVPVQRRRAGARGRGGGGGRR 242
>LOC_Os03g15100:12003.t01296:unspliced-genomic conserved hypothetical protein| Length = 849 Score = 35.4 bits (71), Expect = 0.79 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -2 / -3 Query: 631 TGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRR 530 T SPS P P P ++A + CR + CRRR Sbjct: 493 TSLSPSAAPPPSPPPASSADAAAANCRDYHCRRR 392
>LOC_Os03g04650:12003.t00342:unspliced-genomic cytochrome P450 86A2, putative, expressed| Length = 1879 Score = 35.4 bits (71), Expect = 0.79 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 / +2 Query: 649 WRGRPWTGRSPSLRPTPG 596 WRG PWTG SP+ P+ G Sbjct: 776 WRGEPWTGSSPTRSPSGG 829
>LOC_Os02g45750:12002.t04162:unspliced-genomic protein kinase, putative, expressed| Length = 3602 Score = 35.4 bits (71), Expect = 0.79 Identities = 20/62 (32%), Positives = 22/62 (35%) Frame = -2 / -2 Query: 685 RRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRTCA 506 RR R C R+WRGR W R C+* C RG R C Sbjct: 2950 RRCAW*RRCGRSWRGRSWRSWRACGRRAGRCCS*CPCAPRAARCARGCTASRGRGRGRCG 2771 Query: 505 GA 500 GA Sbjct: 2770 GA 2765
>LOC_Os01g24030:12001.t02126:unspliced-genomic AMP binding protein, putative, expressed| Length = 2197 Score = 35.4 bits (71), Expect = 0.79 Identities = 18/49 (36%), Positives = 20/49 (40%) Frame = -2 / +2 Query: 679 RGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRR 533 R R R R WTG S P A + RR C+G R W RR Sbjct: 1535 RATWRCGRRTGTSRSWTGPRTSSSPAGRTSARSRWRRRCSGTRRWRRRR 1681
>LOC_Os01g12740:12001.t01140:unspliced-genomic cytochrome P450 71A1, putative, expressed| Length = 2605 Score = 35.4 bits (71), Expect = 0.79 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -2 / +2 Query: 718 STSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRS 620 ++S + WS RR GCTR C + R W RS Sbjct: 1772 ASSGSSGPWSRRRSGCTRRCRCSCPARRWRTRS 1870
>LOC_Os07g08040:12007.t00681:unspliced-genomic expressed protein| Length = 5329 Score = 28.6 bits (56), Expect(2) = 0.82 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 / -1 Query: 637 PWTGRSPSLRPTPGPCA*ATARR 569 P TGRSPS P P P *A R Sbjct: 184 PGTGRSPSTNPPPPPRR*APPAR 116 Score = 24.0 bits (46), Expect(2) = 0.82 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 / -1 Query: 685 RRRGCTRTCHRAWRGRPWTGRSP 617 RRRG R RG P +GRSP Sbjct: 352 RRRGRGSGRGRRARGGPGSGRSP 284
>LOC_Os08g41120:12008.t03841:unspliced-genomic TD and POZ domain-containing protein 4, putative| Length = 1026 Score = 31.3 bits (62), Expect(2) = 0.82 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 / +3 Query: 297 QGGPLRLRPHGARRAPQDQERAGPVPHLP 383 +GG R+R RRA + + R G +PHLP Sbjct: 129 RGGQWRVRLPAHRRAGEIEHRQGHLPHLP 215 Score = 24.9 bits (48), Expect(2) = 0.82 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 / +3 Query: 513 VRRQGPRRRHDQLLQPVQERRAVAQAQG 596 +RR RRR D P + RRA+A QG Sbjct: 510 LRRVVLRRRRDVPRAPRRARRALAGVQG 593
>LOC_Os08g14180:12008.t01294:unspliced-genomic flavonol 4-sulfotransferase, putative, expressed| Length = 4598 Score = 28.6 bits (56), Expect(2) = 0.83 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -2 / +2 Query: 718 STSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLR 608 +TS + S RRG R+ +WRGR R+P+ R Sbjct: 308 ATSSSPASPSRGRRGSRRSRSPSWRGRRTRRRAPTTR 418 Score = 24.0 bits (46), Expect(2) = 0.83 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 / +2 Query: 550 SWSCRRRGP*RRTC 509 S SCRRRG RTC Sbjct: 491 STSCRRRG*CARTC 532
>LOC_Os03g55020:12003.t04766:unspliced-genomic cytokinin-N-glucosyltransferase 1, putative, expressed| Length = 1487 Score = 34.1 bits (68), Expect(2) = 0.86 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = -2 / +1 Query: 649 WRGRPWTGRSPSLRPTPGPCA*ATARRSCTG 557 WR RP SP+ TP A ATA RSC G Sbjct: 1114 WRTRPRRASSPTAAGTPSWKASATACRSCAG 1206 Score = 22.6 bits (43), Expect(2) = 0.86 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -2 / +1 Query: 775 LGSTCWHGAALRGRDTLLGSTSRTG 701 LGS W G A R G +R+G Sbjct: 541 LGSLSW*GMAFLTRAACRGGAARSG 615
>LOC_Os05g44250:12005.t03914:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2426 Score = 29.9 bits (59), Expect(2) = 0.86 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 / -2 Query: 700 RMWSSRRRGCTRTC 659 R W SRRR CTR C Sbjct: 1315 RRWQSRRRWCTRRC 1274 Score = 22.6 bits (43), Expect(2) = 0.86 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -2 / -1 Query: 658 HRAWRGRPWTGRSPSLRPT 602 HR +G P G LRPT Sbjct: 1199 HRLLQGNPTRGPRTRLRPT 1143
>LOC_Os09g24820:12009.t02163:unspliced-genomic ZF-HD homeobox protein, putative, expressed| Length = 1985 Score = 30.4 bits (60), Expect(2) = 0.88 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -2 / +3 Query: 670 TRTCHRAWRGRPWTGRSPSLR 608 +RT RAW G WTG S R Sbjct: 594 SRTTRRAWAGTRWTGAGSSCR 656 Score = 22.1 bits (42), Expect(2) = 0.88 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = -2 / +3 Query: 625 RSPSLRPTPGPCA*ATARRSCTGCRSWSCRRR 530 R+P R G A S GCR RRR Sbjct: 666 RTPPTRRRSGAPRAAATATSTAGCRRGPPRRR 761
>LOC_Os08g44850:12008.t04208:unspliced-genomic SRC2, putative, expressed| Length = 1973 Score = 27.2 bits (53), Expect(2) = 0.88 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +3 / +2 Query: 504 PAHVRRQGPRRRHDQLLQPVQERRAVAQAQGPGVGRREGDLPVQGRPRQAR 656 P H PR R Q R VA AQ RR+G GR R Sbjct: 638 PEHATPMAPRLRPTAPAQAGSTRTVVATAQAGTRRRRQGTRAPTGRRHSQR 790 Score = 25.4 bits (49), Expect(2) = 0.88 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 / +3 Query: 312 RLRPHGARRAPQDQERAGPVPHLPP 386 RLRP A R P+ + R P LPP Sbjct: 450 RLRPPPAPRRPRRRRRRRPRLPLPP 524
>LOC_Os09g20970:12009.t01831:unspliced-genomic receptor kinase, putative| Length = 2475 Score = 25.8 bits (50), Expect(3) = 0.88 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 / +2 Query: 706 TGRMWSSRRRGCTRTCHRAWR 644 +G WS+ R TR C R WR Sbjct: 1292 SGGGWSASGRRGTRPCCRRWR 1354 Score = 25.8 bits (50), Expect(3) = 0.88 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = -2 / +2 Query: 637 PWTGRSPSLRPTPGPCA*ATARRSC 563 PWTGR S P P A + C Sbjct: 1865 PWTGRRASTSPPRSPTAWRSCTAPC 1939 Score = 24.9 bits (48), Expect(3) = 0.88 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 / +2 Query: 562 TGCRSWSCRRRGP*RRT 512 T C WSC R P +RT Sbjct: 2162 TACCCWSCSRGRPRQRT 2212
>LOC_Os11g45720:12011.t04099:unspliced-genomic pectinesterase precursor, putative, expressed| Length = 2159 Score = 35.0 bits (70), Expect(2) = 0.89 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -2 / -3 Query: 685 RRRGCTRTCHRAWRGRPWTGRSPSLRPTPG 596 RRR C+R C RA R PW S R PG Sbjct: 588 RRRWCSRRCRRACRPCPWWQPCRSRRSPPG 499 Score = 22.1 bits (42), Expect(2) = 0.89 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 / -2 Query: 485 APAASEEILVRQASPLSPSMFMA 417 A +A+E + P+SP+ FMA Sbjct: 301 ASSAAERLASMVFPPMSPAAFMA 233
>LOC_Os03g04850:12003.t00361:unspliced-genomic hypothetical protein| Length = 1119 Score = 34.5 bits (69), Expect(2) = 0.89 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = -2 / +2 Query: 655 RAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRR 533 R+W W+G S S PT G +A T S SCRR Sbjct: 488 RSWSPSSWSGSSGSRSPTKGTATGTSAASRTT*STSTSCRR 610 Score = 21.7 bits (41), Expect(2) = 0.89 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 / +3 Query: 876 GAGMRAVLDGVAAVQLEL 823 GAG + DGVAA +EL Sbjct: 132 GAGAGLLPDGVAAPAVEL 185
>LOC_Os01g49320:12001.t04371:unspliced-genomic acidic endochitinase precursor, putative, expressed| Length = 1339 Score = 28.6 bits (56), Expect(2) = 0.90 Identities = 17/56 (30%), Positives = 21/56 (37%) Frame = -2 / +3 Query: 715 TSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRS 548 T+ T W SRR R C R R + + R PG A + TG S Sbjct: 540 TTTTSWRWPSRRNATARACSRRRRSARTRTPTSTRRSRPGCSATFGCSSTTTGSAS 707 Score = 24.0 bits (46), Expect(2) = 0.90 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 / +3 Query: 550 SWSCRRRGP*RR 515 SW+CRRR P R Sbjct: 786 SWACRRRRPLHR 821
>LOC_Os02g58610:12002.t05431:unspliced-genomic serine/threonine-protein kinase NAK, putative, expressed| Length = 1269 Score = 29.9 bits (59), Expect(2) = 0.90 Identities = 17/45 (37%), Positives = 21/45 (46%) Frame = -2 / -2 Query: 649 WRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RR 515 W RP + R+P G A + R + GCR RRRG RR Sbjct: 494 WPRRPRS*RAPPTPAPAGAPAASCRRGARRGCRVAGTRRRGGARR 360 Score = 22.6 bits (43), Expect(2) = 0.90 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 / -2 Query: 679 RGCTRTCHRAWRGR 638 RGC R AWRG+ Sbjct: 644 RGCRRRRGPAWRGQ 603
>LOC_Os09g37120:12009.t03187:unspliced-genomic ornithine decarboxylase, putative, expressed| Length = 1227 Score = 29.5 bits (58), Expect(2) = 0.90 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -2 / -3 Query: 709 RTGRMWSSRRRGCTRTCHRAWRGRPWTGR 623 R+ R W SR R R RAWR R T R Sbjct: 304 RSRRGWRSRSRRRARRARRAWRRRGCT*R 218 Score = 23.1 bits (44), Expect(2) = 0.90 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -1 / -2 Query: 806 RRSFVNSSRLSWIHLLAWSSAAGPRYSSGFH 714 RR+ SS S + L +SAA R +SG H Sbjct: 449 RRTLATSSSES*VVRLTPTSAAYSRCASGLH 357
>LOC_Os11g31060:12011.t02706:unspliced-genomic BAG domain containing protein, expressed| Length = 1617 Score = 29.0 bits (57), Expect(2) = 0.92 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -2 / -3 Query: 742 RGRDTLLGSTSRTGRMWSSRRRGCTR 665 RGR G SR GR SS RRG +R Sbjct: 169 RGRGCSTGRRSRRGRRCSSSRRGRSR 92 Score = 27.6 bits (54), Expect(2) = 0.92 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 / -1 Query: 1086 VAIIHSLHGIARRFHPLFVRVE 1021 VA++H HG +R HPL R + Sbjct: 1380 VALLHPPHGALQRVHPLRQRAD 1315
>LOC_Os01g38670:12001.t03401:unspliced-genomic sugar carrier protein C, putative, expressed| Length = 2267 Score = 33.1 bits (66), Expect(2) = 0.93 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +3 / +1 Query: 507 AHVRRQGPRRRHDQLLQPVQERRAVAQAQGPGVGRREGDL 626 AHVRR R+H + L+ + RR Q P GRR DL Sbjct: 1408 AHVRRHHRPRQHVRHLRLHRHRRPPRPPQAPPSGRRPNDL 1527 Score = 24.0 bits (46), Expect(2) = 0.93 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +1 / +1 Query: 673 ILCACCSTSCPSYWWNPEEYLGPAAL 750 +LC C S ++ W P +L P+ + Sbjct: 1699 VLCICVFVSAFAWSWGPLGWLVPSEI 1776
>LOC_Os12g36210:12012.t03306:unspliced-genomic subtilisin-chymotrypsin inhibitor CI-1B, putative, expressed| Length = 566 Score = 29.9 bits (59), Expect(2) = 0.95 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = -2 / -3 Query: 721 GSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSP 617 G R W RR C R C R W G + +P Sbjct: 396 GRQMREASRWWGCRRRCQRRCGRGWSGSRGSPATP 292 Score = 22.6 bits (43), Expect(2) = 0.95 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -2 / -3 Query: 643 GRPWTGRSPSLRPTPGPCA*ATARRSCT 560 G P + P+ P P + A RR CT Sbjct: 252 GSPSSPPPPTAPPPPATTSSAPPRRRCT 169
>LOC_Os12g03970:12012.t00288:unspliced-genomic calcium-dependent protein kinase, isoform 2, putative, expressed| Length = 2356 Score = 30.4 bits (60), Expect(2) = 0.96 Identities = 17/50 (34%), Positives = 21/50 (42%) Frame = -2 / +2 Query: 661 CHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRT 512 C P T R R + P + A SC+ S +CR GP RRT Sbjct: 719 CSATSSAAPTTSRRRCSRGSTAPRPTSGASASCSTSSSPACRPSGPSRRT 868 Score = 26.7 bits (52), Expect(2) = 0.96 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -2 / +3 Query: 760 WHGAALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAW 647 W R L G R R + RRR R HRAW Sbjct: 417 WPAQHRRPPRRLRGQAQRPPRDGALRRRRALRPHHRAW 530
>LOC_Os01g61370:12001.t05516:unspliced-genomic expressed protein| Length = 1704 Score = 32.7 bits (65), Expect(2) = 0.97 Identities = 18/59 (30%), Positives = 26/59 (44%) Frame = -2 / -3 Query: 700 RMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP 524 R + RRR C+R R G + S + A*+ A +CT C SW+ + P Sbjct: 562 RRTTHRRRRCSRRSSCRSRTSCCRGTASSAQAAASAAA*SPAPCACTRCSSWAPQGSSP 386 Score = 24.0 bits (46), Expect(2) = 0.97 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -2 / -3 Query: 763 CWHGAALRGRDTLLGSTSRTGRMWSSRRR 677 CW R GS +R R W SR R Sbjct: 991 CWRRREGTARTAPAGS*TRKRRAWRSRGR 905
>LOC_Os06g13830:12006.t01258:unspliced-genomic endoglucanase precursor, putative, expressed| Length = 3524 Score = 35.0 bits (70), Expect(2) = 1.0 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = -2 / +1 Query: 706 TGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCT 560 TG W R + TC RAW G R+P+ P C + +C+ Sbjct: 2602 TGGRWRGTGRRRSTTCARAWGGTRPAARTPTWSGAPAGCCTCGSGTTCS 2748 Score = 22.6 bits (43), Expect(2) = 1.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 / +1 Query: 577 ARRSCTGCRSWSCRRR 530 +RR CT R SCR R Sbjct: 2965 SRRGCTTGRRRSCRTR 3012 Score = 29.5 bits (58), Expect(2) = 8.0 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = -2 / -2 Query: 655 RAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RR 515 R WR RPW RS R PG S + C + G RR Sbjct: 1423 RRWRRRPWRRRSRRRRRIPGGGGPPCTPASTSSCPPAAASSSGRCRR 1283 Score = 24.9 bits (48), Expect(2) = 8.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 / -2 Query: 700 RMWSSRRRGCTRTCHRAWRGR 638 R W SR R R C R RGR Sbjct: 2290 R*WPSRCRRTRRRCRRRSRGR 2228
>LOC_Os12g34210:12012.t03110:unspliced-genomic Transposable element protein, putative, MuDR| Length = 11267 Score = 29.9 bits (59), Expect(2) = 1.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 / +1 Query: 682 RRGCTRTCHRAWRGRPWT 629 RRGC R R WRG W+ Sbjct: 8920 RRGCRRRGWRRWRGTAWS 8973 Score = 22.1 bits (42), Expect(2) = 1.0 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 / +1 Query: 622 SPSLRPTPGPCA 587 +P+ RPT PCA Sbjct: 9049 APTTRPTSPPCA 9084
>LOC_Os11g20310:12011.t01800:unspliced-genomic expressed protein| Length = 3248 Score = 28.1 bits (55), Expect(3) = 1.1 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -1 / +1 Query: 407 QMPSRQLRRKVRDGSCSFLILRSASSTM 324 ++P + K+RD + SF++ RSA S+M Sbjct: 2368 KLPDQMHDLKIRDDNVSFIMTRSAISSM 2451 Score = 26.3 bits (51), Expect(3) = 1.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 / +3 Query: 981 NFPTSPRGKTLLCSHSGSELQLLYCVDL 898 + P S R L + GSE+QL +CV L Sbjct: 828 DLPFSLRFFACLMATDGSEIQLYFCVTL 911 Score = 22.6 bits (43), Expect(3) = 1.1 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -2 / +2 Query: 790 THHGCLGSTCWHGA 749 +HH CL WH A Sbjct: 1052 SHHCCLPELTWHVA 1093
>LOC_Os12g37980:12012.t03479:unspliced-genomic senescence-induced receptor-like serine/threonine-protein kinase| precursor, putative, expressed Length = 6946 Score = 27.2 bits (53), Expect(2) = 1.1 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 / -1 Query: 685 RRRGCTRTCHRAWRGRPWTGRSPSL 611 RRRG R R+ R R W R SL Sbjct: 430 RRRGAWRWRRRSCRSRRWPSRGTSL 356 Score = 24.9 bits (48), Expect(2) = 1.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -2 / -1 Query: 586 *ATARRSCTGCRSWSCRRRGP*RR 515 * + RR CR+ CRR GP RR Sbjct: 277 *GSGRRGRGRCRAG*CRR*GPRRR 206
>LOC_Os02g55110:12002.t05087:unspliced-genomic expressed protein| Length = 6545 Score = 29.5 bits (58), Expect(2) = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 / -2 Query: 634 WTGRSPSLRPTPGPCA*ATARRSCTGCRSWS 542 WTG S P P P T R S TG S S Sbjct: 235 WTGTSSPATPRPPPPPPTTDRHSATGASSAS 143 Score = 22.6 bits (43), Expect(2) = 1.1 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = -2 / -3 Query: 703 GRMWSSRRRGCTRTCHRAWRGRP 635 GR RRR R R W G P Sbjct: 372 GRAGGRRRRAGRRGRRRGWGGDP 304
>LOC_Os10g28770:12010.t02226:unspliced-genomic speckle-type POZ protein, putative| Length = 1119 Score = 35.0 bits (70), Expect = 1.1 Identities = 19/36 (52%), Positives = 20/36 (55%) Frame = -2 / -3 Query: 622 SPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RR 515 SPS P ATA R CTG R+ RRRG *RR Sbjct: 694 SPSSGRRAPP*TPATAPRECTGARARPRRRRGT*RR 587 Score = 33.1 bits (66), Expect = 3.9 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 / +3 Query: 516 RRQGPRRRHDQLLQPVQERRAVAQAQGPGVGRREGD 623 RR PRRR + PV R AVA QG + EG+ Sbjct: 588 RRHVPRRRRGRARAPVHSRGAVAGVQGGALRPDEGE 695
>LOC_Os08g39590:12008.t03691:unspliced-genomic ATP binding protein, putative, expressed| Length = 2661 Score = 35.0 bits (70), Expect = 1.1 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = -2 / +1 Query: 721 GSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTP 599 G++ R R S RRGC R+ R R W+ R S R TP Sbjct: 1915 GASRRRARAGWSWRRGCAAPSRRSGRCRRWSTRRCSARCTP 2037
>LOC_Os08g27210:12008.t02485:unspliced-genomic expressed protein| Length = 799 Score = 35.0 bits (70), Expect = 1.1 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = -2 / +2 Query: 622 SPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP 524 SP+ R PC + RRSC RS S RRR P Sbjct: 74 SPTRRAACAPCRGS*GRRSCRRARSSSTRRRSP 172
>LOC_Os08g01430:12008.t00042:unspliced-genomic F-box domain containing protein, expressed| Length = 3342 Score = 35.0 bits (70), Expect = 1.1 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -2 / -2 Query: 646 RGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRR 530 R +PW R+P++ P+ C+* R + SCRRR Sbjct: 1025 RTQPWNWRTPTVSPSAAGCS*QNRRPPRRSSAAASCRRR 909
>LOC_Os07g48490:12007.t04481:unspliced-genomic expressed protein| Length = 2036 Score = 35.0 bits (70), Expect = 1.1 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = -2 / -3 Query: 709 RTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRR 530 R GR RRR C R R R P R S PC ARR C R RR Sbjct: 870 RRGRCGRGRRRWCRRWRRRGRRSEPRGPRGGSSSSGCRPCTTPRARRWCRRGRRRGPCRR 691 Query: 529 G 527 G Sbjct: 690 G 688
>LOC_Os06g04020:12006.t00293:unspliced-genomic histone H1, putative, expressed| Length = 1587 Score = 35.0 bits (70), Expect = 1.1 Identities = 18/60 (30%), Positives = 24/60 (40%) Frame = -2 / -3 Query: 709 RTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRR 530 R+G +W++ R +WRG G PS P + RR SW RRR Sbjct: 844 RSGWIWAAASASRGRPSSPSWRGLGGRGEPPSSPPPTTRASWRRRRRGAGSSSSWRRRRR 665
>LOC_Os05g31770:12005.t02774:unspliced-genomic mitochondria fission 1 protein, putative, expressed| Length = 3230 Score = 35.0 bits (70), Expect = 1.1 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = -2 / +2 Query: 670 TRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCR 536 T TC R R PW P P+P PC A RS + C+ Sbjct: 3083 TPTCRRGRRR*PWCCT*PCTPPSPSPCPPPPATRSLSSASPRRCQ 3217
>LOC_Os05g31760:12005.t02773:unspliced-genomic annexin-like protein RJ4, putative, expressed| Length = 2423 Score = 35.0 bits (70), Expect = 1.1 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = -2 / -3 Query: 670 TRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCR 536 T TC R R PW P P+P PC A RS + C+ Sbjct: 2118 TPTCRRGRRR*PWCCT*PCTPPSPSPCPPPPATRSLSSASPRRCQ 1984
>LOC_Os05g19000:12005.t01667:unspliced-genomic expressed protein| Length = 2449 Score = 35.0 bits (70), Expect = 1.1 Identities = 23/72 (31%), Positives = 25/72 (34%) Frame = -2 / -2 Query: 763 CWHGAALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA* 584 C G RGR R +R TR R R TG P+ PG Sbjct: 1029 CCRGPPRRGRTCRTARRGGAARWRPARCGCGTRAAGSCSRRRRGTGTCPAGTGAPGGRCP 850 Query: 583 ATARRSCTGCRS 548 RR C GCRS Sbjct: 849 GRWRRRCPGCRS 814 Score = 27.6 bits (54), Expect(2) = 2.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 / -3 Query: 565 CTGCRSWSCRRRGP*RRT 512 CT R W CRRR RR+ Sbjct: 1733 CTASRPWRCRRRTGGRRS 1680 Score = 23.5 bits (45), Expect(2) = 2.1 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -2 / -3 Query: 694 WSSRRRGCTRTCHRAWRGRPWTGR 623 W++RRR +R R R TGR Sbjct: 1916 WAARRRARSRGSSTCGRRRTGTGR 1845
>LOC_Os05g02110:12005.t00110:unspliced-genomic protein phosphatase 2C containing protein, expressed| Length = 2799 Score = 35.0 bits (70), Expect = 1.1 Identities = 18/58 (31%), Positives = 24/58 (41%) Frame = -2 / +2 Query: 706 TGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRR 533 +GR R GCT C R+ G + S+ PTP + T R C + RR Sbjct: 683 SGRAARPGRTGCTWWCRRSTGGCSSASTTASMAPTPPTTSPTTCTRPCAASSTACSRR 856
>LOC_Os04g44030:12004.t03943:unspliced-genomic expressed protein| Length = 3126 Score = 35.0 bits (70), Expect = 1.1 Identities = 21/55 (38%), Positives = 24/55 (43%) Frame = -2 / -1 Query: 679 RGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RR 515 RG +R C R R PW R+ P GP R G R + RR P*RR Sbjct: 678 RGESRRCPRRARRWPWCARTGPAPPARGPPRGTWRRGGS*GRRRPAPRRTSP*RR 514
>LOC_Os04g38920:12004.t03462:unspliced-genomic expressed protein| Length = 1396 Score = 35.0 bits (70), Expect = 1.1 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -2 / +2 Query: 640 RPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRR 530 RPW G S + P CA A + C G R W RR+ Sbjct: 458 RPWRGSSGTRTPRCRHCASAASSAPCAGRRYWP*RRK 568
>LOC_Os04g37460:12004.t03316:unspliced-genomic glutamate decarboxylase, putative, expressed| Length = 2362 Score = 35.0 bits (70), Expect = 1.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 / -1 Query: 655 RAWRGRPWTGRSPSLRPTPG 596 R WR R W R PS RP+PG Sbjct: 820 RGWRRRRWCSRRPSPRPSPG 761
>LOC_Os04g34440:12004.t03119:unspliced-genomic expressed protein| Length = 6316 Score = 35.0 bits (70), Expect = 1.1 Identities = 20/48 (41%), Positives = 21/48 (43%) Frame = -2 / -1 Query: 643 GRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRTCAGA 500 G P P RP PGP A RR R + RRR P* R GA Sbjct: 304 GPPSPPPPPPWRPPPGPAAAEPPRRGRGRPRGAAYRRRPP*ARAACGA 161
>LOC_Os04g12710:12004.t01095:unspliced-genomic indole-3-acetate beta-glucosyltransferase, putative| Length = 618 Score = 35.0 bits (70), Expect = 1.1 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -2 / +2 Query: 640 RPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRTC 509 R W G S R GP ++ + GCR+W P RR+C Sbjct: 284 RRWRGSSTPRRARGGPRPCSSTTPTWRGCRAWRAPPASPRRRSC 415
>LOC_Os03g41100:12003.t03527:unspliced-genomic cyclin-A2, putative, expressed| Length = 1863 Score = 35.0 bits (70), Expect = 1.1 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = +3 / +3 Query: 516 RRQGPRRRHDQLLQPVQERRAVAQAQGPGVGRREGDLP 629 RRQ RR + VQ++R AQA GR+EG LP Sbjct: 141 RRQAQARRAQRAPHAVQQQRRGAQAAAGAQGRQEGRLP 254
>LOC_Os02g39600:12002.t03598:unspliced-genomic outer envelope protein, putative, expressed| Length = 4170 Score = 35.0 bits (70), Expect = 1.1 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -2 / -3 Query: 721 GSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPS 614 G + T W +R R CT C R W R T SPS Sbjct: 403 GRSGTTAAAWRARPRPCTTPCARTWPPRCRTPWSPS 296
>LOC_Os02g11130:12002.t00961:unspliced-genomic cytokinin-O-glucosyltransferase 3, putative, expressed| Length = 1640 Score = 35.0 bits (70), Expect = 1.1 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = -2 / +1 Query: 700 RMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*AT 578 R WSSR R + C R R + R+ S RP PCA +T Sbjct: 244 RSWSSRSRRPWQACRRTARTPTSSRRTRSSRPFSSPCAPST 366
>LOC_Os02g11110:12002.t00959:unspliced-genomic flavonol-3-O-glycoside-7-O-glucosyltransferase 1, putative,| expressed Length = 2303 Score = 35.0 bits (70), Expect = 1.1 Identities = 17/41 (41%), Positives = 20/41 (48%) Frame = -2 / +3 Query: 700 RMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*AT 578 R WSSR R C R R + R+ S RP PCA +T Sbjct: 273 RSWSSRSRRPWPACRRTTRAPTSSRRTSSSRPLSKPCAAST 395
>LOC_Os01g70890:12001.t06387:unspliced-genomic nuclear transcription factor Y subunit B-5, putative, expressed| Length = 640 Score = 35.0 bits (70), Expect = 1.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 / -2 Query: 679 CACCSTSCPSYWWNP 723 C+CC CPS WW P Sbjct: 165 CSCCCRRCPSAWWPP 121
>LOC_Os01g65680:12001.t05930:unspliced-genomic 4,5-DOPA dioxygenase extradiol, putative, expressed| Length = 3623 Score = 35.0 bits (70), Expect = 1.1 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -2 / +2 Query: 691 SSRRRGCTRTCHRAWRGRPWTGRSPSLRPT 602 S RR +R C R WR R GRS S R T Sbjct: 326 SRRRDSSSRGCRRRWRARSCRGRSSSCRAT 415
>LOC_Os01g58970:12001.t05289:unspliced-genomic cytochrome P450 94A2, putative, expressed| Length = 1924 Score = 35.0 bits (70), Expect = 1.1 Identities = 18/65 (27%), Positives = 24/65 (36%) Frame = -2 / +1 Query: 694 WSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RR 515 W R RT + R WT R+ S R +T + C R W R P R Sbjct: 1306 WDVWRTSGARTARSSGRSGGWTRRARSGRTARSSTPSSTPDQGCVSARRWHTYR*SPSWR 1485 Query: 514 TCAGA 500 C+ + Sbjct: 1486 ACSSS 1500 Score = 34.5 bits (69), Expect = 1.5 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = -2 / -2 Query: 718 STSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA 587 S +R WS RR G R HR R + R RP PCA Sbjct: 1005 SRARR*GSWSPRRGGSRRCAHRPRRSATGSHRCAPARPPLSPCA 874
>LOC_Os01g50410:12001.t04476:unspliced-genomic mitogen-activated protein kinase kinase kinase 1, putative,| expressed Length = 1957 Score = 35.0 bits (70), Expect = 1.1 Identities = 18/45 (40%), Positives = 23/45 (51%) Frame = -2 / +2 Query: 706 TGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATAR 572 +G S RRG + R+WR R GRS RP GP A ++R Sbjct: 434 SGARGSWTRRGRSAARRRSWRRRWRAGRSRGRRPMSGPSAAPSSR 568
>LOC_Os01g19290:12001.t01719:unspliced-genomic nodulin-like protein, putative, expressed| Length = 3500 Score = 35.0 bits (70), Expect = 1.1 Identities = 22/54 (40%), Positives = 23/54 (42%) Frame = -2 / -1 Query: 709 RTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRS 548 RT S RRR C R R R G S P+P P A TARR RS Sbjct: 3056 RTPARSSRRRRPCRSAPPRRRRRRRRRGPMASPSPSPSPTAPCTARRRSARTRS 2895
>LOC_Os01g12030:12001.t01072:unspliced-genomic endoglucanase 1 precursor, putative, expressed| Length = 2633 Score = 35.0 bits (70), Expect = 1.1 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = -2 / +3 Query: 751 AALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHR 653 AA R R + S SRT R SRRR T TC R Sbjct: 2289 AARRSRSSTSASASRTARCGGSRRRRGTATCSR 2387
>LOC_Os01g12020:12001.t01071:unspliced-genomic nonspecific lipid-transfer protein precursor, putative, expressed| Length = 2072 Score = 35.0 bits (70), Expect = 1.1 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = -2 / -1 Query: 751 AALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHR 653 AA R R + S SRT R SRRR T TC R Sbjct: 1169 AARRSRSSTSASASRTARCGGSRRRRGTATCSR 1071
>LOC_Os02g02400:12002.t00139:unspliced-genomic catalase isozyme A, putative, expressed| Length = 2795 Score = 29.5 bits (58), Expect(2) = 1.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -2 / -1 Query: 625 RSPSLRPTPGPCA*ATARRSCTGCRSWSCRR 533 RSP+ + P A RR+ T C + SCRR Sbjct: 1547 RSPAASGSLAPACSAACRRTRTPCTAASCRR 1455 Score = 27.6 bits (54), Expect(2) = 1.1 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 / -3 Query: 559 GCRSWSCRRRGP*RRTCAGA 500 G W CRRR RR C G+ Sbjct: 963 GGNRWGCRRRRRGRRRCGGS 904
>LOC_Os06g41980:12006.t03890:unspliced-genomic protein kinase, putative, expressed| Length = 2004 Score = 34.5 bits (69), Expect(2) = 1.1 Identities = 18/54 (33%), Positives = 23/54 (42%) Frame = -2 / +2 Query: 730 TLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARR 569 T ST+R W + R +R R+WR T S S R + PC A R Sbjct: 374 TSSSSTTRPTSSWRTTRTRGSRRARRSWRRTRRTTASTSTRESDSPCRCAARAR 535 Score = 22.1 bits (42), Expect(2) = 1.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -2 / +2 Query: 592 CA*ATARRSCTGCRSWSCRRRGP*RRTCAG 503 CA R CT SWS R G R +G Sbjct: 1058 CAMPWDRWPCTSTASWSG*RPGSRRSGASG 1147
>LOC_Os02g48210:12002.t04405:unspliced-genomic lectin-like protein kinase, putative, expressed| Length = 3776 Score = 26.7 bits (52), Expect(2) = 1.1 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -2 / -3 Query: 754 GAALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRG 641 GA+ R T S +RT R W+ R R WRG Sbjct: 1002 GASRRSCST*ARS*ARTSRRWTPRSRSSPCCRGGRWRG 889 Score = 25.4 bits (49), Expect(2) = 1.1 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = -2 / -3 Query: 625 RSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRTC 509 R P+ R PG A CT R+ +C P R +C Sbjct: 894 RGPAARRAPGSRAFWCRSWPCTPTRAATCHCSRPRRSSC 778
>LOC_Os01g32574:12001.t02832:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2827 Score = 28.6 bits (56), Expect(2) = 1.2 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 / -3 Query: 700 RMWSSRRRGCTRTC 659 R W SRRR CTR C Sbjct: 1004 RRWWSRRRWCTRRC 963 Score = 23.5 bits (45), Expect(2) = 1.2 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -1 / -3 Query: 806 RRSFVNSSRLSWIHLLAW 753 RRS+ S R SW L W Sbjct: 1124 RRSWCRSLRRSWCRSLRW 1071
>LOC_Os05g47820:12005.t04217:unspliced-genomic expressed protein| Length = 2122 Score = 29.9 bits (59), Expect(2) = 1.2 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = -1 / -2 Query: 464 ILVRQASPLSPSMFMAQLPQMPSRQLRRKVRDGSCSFLILRSASSTMG 321 +L R + + P++ + Q+P +P LRR+ R S + RS T+G Sbjct: 594 VLQRVLAAVPPALPIPQVPLLPRSFLRRRRRHRSVASFGRRSGGVTLG 451 Score = 22.1 bits (42), Expect(2) = 1.2 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = -2 / -1 Query: 688 SRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARR 569 SRRR + RG PW R R P A +A R Sbjct: 700 SRRRSPGASAPPRTRGSPWRRRRRRRRRLPCSRASCSAAR 581
>LOC_Os04g34140:12004.t03089:unspliced-genomic photoperiod responsive protein, putative, expressed| Length = 1769 Score = 27.6 bits (54), Expect(2) = 1.2 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -2 / -2 Query: 784 HGCLGSTCWHGAALRGRDTLLGSTSRTGRMWSSRRRGCTR 665 +G LG GAAL D L R G RRRG R Sbjct: 1141 YGLLGVLAERGAALGAADGGLEDPERPGGRGRVRRRGAQR 1022 Score = 24.4 bits (47), Expect(2) = 1.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 / -1 Query: 682 RRGCTRTCHRAWRGRPWTGR 623 RRG +R R GR W GR Sbjct: 998 RRGPSRRARRGATGRWWRGR 939
>LOC_Os04g46980:12004.t04225:unspliced-genomic cis-zeatin O-glucosyltransferase 1, putative, expressed| Length = 1733 Score = 28.1 bits (55), Expect(2) = 1.2 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = -2 / -2 Query: 754 GAALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTG 626 G A R R + ++ TGR S R TR R RG W+G Sbjct: 358 GRAPRRRSSPAWASGGTGRAGRSGRGAGTRRRGRRGRGSGWSG 230 Score = 24.0 bits (46), Expect(2) = 1.2 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -2 / -2 Query: 652 AWRGRPWTGRSPSLRPTPGPC 590 A G P GR+P RP PC Sbjct: 115 AGSGGPAPGRAPRRRPPIPPC 53
>LOC_Os02g52830:12002.t04863:unspliced-genomic triacylglycerol lipase, putative, expressed| Length = 4209 Score = 32.7 bits (65), Expect(2) = 1.2 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = -2 / -3 Query: 766 TCWHGAALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRP 635 TC A + +R+GR W +RRRGC R G P Sbjct: 2146 TCTRRGASPACPPRRAAPARSGRGWRARRRGCARRPRTGRAGSP 2015 Score = 24.9 bits (48), Expect(2) = 1.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 / -3 Query: 574 RRSCTGCRSWSCRRRGP*R 518 RR+ CR+ SCRR P R Sbjct: 1828 RRTTAPCRTASCRRTPPRR 1772
>LOC_Os01g52750:12001.t04701:unspliced-genomic subtilisin-like protease precursor, putative, expressed| Length = 4937 Score = 26.3 bits (51), Expect(3) = 1.2 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 / +1 Query: 739 GRDTLLGSTSRTGRMWSSRRRGCTRTCHRA 650 GR ++ G+TSR R ++R TRT RA Sbjct: 2524 GRSSVRGTTSRRTRPGTAR*TPRTRTARRA 2613 Score = 26.3 bits (51), Expect(3) = 1.2 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -2 / +1 Query: 598 GPCA*ATARRSCTGCRSWSCRRRGP*RRTCA 506 GP A RR + RRRGP RR CA Sbjct: 3499 GPGGEAGGRRGHYPRQPAGVRRRGPRRRACA 3591 Score = 25.4 bits (49), Expect(3) = 1.2 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -2 / +1 Query: 661 CHRAWRGRPWTGRSPSLRPTPGP 593 C RG T R+P+LRPT P Sbjct: 2749 CAGPSRGPTPTSRTPALRPTCSP 2817
>LOC_Os11g04590:12011.t00352:unspliced-genomic scarecrow-like 3, putative| Length = 1383 Score = 27.2 bits (53), Expect(2) = 1.2 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -2 / +2 Query: 715 TSRTGRMWSSRRRGCTRTCHRAWRGRPWT 629 TSR R W + R C R R+W R T Sbjct: 806 TSRRRRRWRASCRRCARCPRRSWWWRSRT 892 Score = 24.9 bits (48), Expect(2) = 1.2 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -2 / +2 Query: 640 RPWTGRSPSLRPTPGPCA*ATARRSCT 560 R W RS + T P A+ARRS T Sbjct: 866 RSWWWRSRTRTTTASPSGSASARRSTT 946
>LOC_Os02g26090:12002.t02303:unspliced-genomic anther-specific proline-rich protein APG, putative| Length = 1087 Score = 28.1 bits (55), Expect(2) = 1.2 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -2 / -3 Query: 709 RTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPT 602 R+G + RR R+C A R RPW R R T Sbjct: 1013 RSGAARRAGRRRARRSCRGARR*RPWPRRCTPRRRT 906 Score = 24.0 bits (46), Expect(2) = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 / -3 Query: 544 SCRRRGP*RRTCA 506 S RRR P*RR CA Sbjct: 875 SPRRRAP*RRPCA 837
>LOC_Os02g03810:12002.t00280:unspliced-genomic F-box domain containing protein| Length = 1087 Score = 26.7 bits (52), Expect(2) = 1.2 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -2 / -3 Query: 625 RSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRG 527 R S RP + + R+ CR+W RRRG Sbjct: 809 RRRSRRPCTARSTSSPSPRARRACRTWGPRRRG 711 Score = 25.4 bits (49), Expect(2) = 1.2 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 / -3 Query: 700 RMWSSRRRGCTRTCHRAWRGRPWTGRSPSLR 608 R SS R R HR GRP+ R S R Sbjct: 968 RTGSSGSRSWRRAAHRRRPGRPYHSRGASPR 876
>LOC_Os05g03972:12005.t00294:unspliced-genomic expressed protein| Length = 6147 Score = 34.1 bits (68), Expect(2) = 1.2 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -2 / +1 Query: 604 TPGPCA*ATARRSCTGCRSWSCRRRGP*RRTCA 506 T G + +T+ SC G SC RRG RR+CA Sbjct: 4534 TTGASSSSTSTTSCRGTTRRSCTRRGGRRRSCA 4632 Score = 24.0 bits (46), Expect(2) = 1.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -3 / +1 Query: 984 YNFPTSPRG 958 YN PTSPRG Sbjct: 2866 YNVPTSPRG 2892
>LOC_Os12g30570:12012.t02764:unspliced-genomic ATMRK1, putative| Length = 1155 Score = 31.8 bits (63), Expect(2) = 1.2 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -2 / -3 Query: 718 STSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTP 599 STS TGR S RR C T R P T PS R +P Sbjct: 838 STSPTGRCRSCTRRTCGCTASRRAPPAPCTPPCPSRRSSP 719 Score = 24.0 bits (46), Expect(2) = 1.2 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 / -3 Query: 607 PTPGPCA*ATARRSCTGCRSWSCRRR 530 P PC A +RR C R RRR Sbjct: 472 PRSTPCPPAASRRCCAARRRRRRRRR 395
>LOC_Os08g40910:12008.t03821:unspliced-genomic expressed protein| Length = 936 Score = 29.5 bits (58), Expect(2) = 1.2 Identities = 19/52 (36%), Positives = 23/52 (44%) Frame = -2 / +1 Query: 685 RRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRR 530 RRR R RA R R + + + P P P A G RS +CRRR Sbjct: 628 RRRRRRRRTARAQRRRWRSRKRARISPAPVPRPAAARGTCSGGGRSTACRRR 783 Score = 22.6 bits (43), Expect(2) = 1.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -2 / +1 Query: 553 RSWSCRRRGP*RRTCAG 503 RS SCRR G R C G Sbjct: 781 RSSSCRRSGRRAR*CGG 831
>LOC_Os02g01690:12002.t00069:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3253 Score = 29.5 bits (58), Expect(2) = 1.3 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = -2 / +1 Query: 694 WSSRRRGCTRTCHRAWRGRPWTG 626 W RGC +R W R W G Sbjct: 547 WGKSERGCR*CLNRGWGNRTWPG 615 Score = 27.6 bits (54), Expect(2) = 1.3 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -2 / +1 Query: 610 RPTPGPCA*ATARRSCTGCRSWSCRRRGP 524 R + G + A +CTG W CR GP Sbjct: 3097 RSSRGAHSGAARGHTCTGRTGWPCRTPGP 3183
>LOC_Os10g33540:12010.t02655:unspliced-genomic alcohol oxidase, putative, expressed| Length = 2411 Score = 29.9 bits (59), Expect(2) = 1.3 Identities = 19/53 (35%), Positives = 22/53 (41%) Frame = -2 / -3 Query: 754 GAALRGRDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPG 596 G+ GR T R GR + R C RT A R T R+P R PG Sbjct: 1734 GSGRSGRGPRRRRTRRRGRAPARTRAPCARTGASAPSCRGRTPRAPGRRRRPG 1576 Score = 26.7 bits (52), Expect(2) = 1.3 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 / -3 Query: 583 ATARRSCTGCRSWSCRRRGP*RRTC 509 A RR T CR SCRR G +C Sbjct: 1194 ARRRRRATSCRCPSCRRWGTRSCSC 1120
>LOC_Os08g34790:12008.t03219:unspliced-genomic 4-coumarate--CoA ligase 2, putative, expressed| Length = 2438 Score = 29.5 bits (58), Expect(2) = 1.3 Identities = 20/50 (40%), Positives = 23/50 (46%) Frame = +3 / +1 Query: 507 AHVRRQGPRRRHDQLLQPVQERRAVAQAQGPGVGRREGDLPVQGRPRQAR 656 A VRRQG R R + RR V +GP RR G + R RQ R Sbjct: 493 AGVRRQGERPRGRDRRRHRGRRREVRVVRGPRRRRRLGAAGGRHRRRQRR 642 Score = 27.2 bits (53), Expect(2) = 1.3 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 / +2 Query: 826 FKLYRCHTIKNCTHACPKGLNPAKQIDTIKKLQL 927 F +Y H+I C + K+ DT+K LQL Sbjct: 800 FHVYSLHSILLCGMRAGAAIVVMKRFDTVKMLQL 901
>LOC_Os03g08850:12003.t00740:unspliced-genomic transport inhibitor response 1 protein, putative, expressed| Length = 2507 Score = 32.2 bits (64), Expect(2) = 1.4 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -2 / -2 Query: 688 SRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGP 593 +RR GC R R WR RP + P GP Sbjct: 223 TRRGGCGRRRRRGWRTRPGSTSGTPATPRTGP 128 Score = 24.4 bits (47), Expect(2) = 1.4 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -3 / -3 Query: 999 KWQADYNFPTSPRGKTLLCSHSGSE 925 KW P SP G++L+ S S E Sbjct: 1812 KWCIPERRPASPNGQSLISSFSSFE 1738
>LOC_Os03g24440:12003.t02139:unspliced-genomic adenylate isopentenyltransferase, putative, expressed| Length = 987 Score = 30.9 bits (61), Expect(2) = 1.4 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -2 / +2 Query: 721 GSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSP 617 G TSR +RRR T C W RP G +P Sbjct: 422 GPTSRRTCCGGTRRRAWTTWCGAGWWARPAPGSTP 526 Score = 24.4 bits (47), Expect(2) = 1.4 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 / +2 Query: 595 PCA*ATARRSCTGCRSW 545 PCA + RS + CR W Sbjct: 659 PCARSRTTRSASPCRRW 709
>LOC_Os07g01214:12007.t00021:unspliced-genomic potassium transporter 16, putative, expressed| Length = 5776 Score = 28.6 bits (56), Expect(2) = 1.5 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = -2 / -1 Query: 661 CHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP 524 C RA P S + P+P P ++ R+CT R+ S P Sbjct: 4384 CRRAPHRAPSAAPSETQAPSPSPSTPSSPSRTCTS*RARSATPPSP 4247 Score = 23.1 bits (44), Expect(2) = 1.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -2 / -3 Query: 769 STCWHGAALRGRDTLLGSTSRTGRMWSSRRR 677 S C G+ R R GST TGR + +R Sbjct: 4550 SLCSCGSTWRKRKRSEGSTCGTGRCLTETKR 4458
>LOC_Os01g35254:12001.t03080:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5735 Score = 29.5 bits (58), Expect(2) = 1.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 / -1 Query: 700 RMWSSRRRGCTRTC 659 R W SRRR CTR C Sbjct: 1022 RRWRSRRRWCTRRC 981 Score = 22.1 bits (42), Expect(2) = 1.5 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -2 / -3 Query: 658 HRAWRGRPWTGRSPSLRPT 602 HR +G P G LRPT Sbjct: 906 HRLLQGNPARGPRTRLRPT 850
>LOC_Os01g20190:12001.t01806:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4844 Score = 29.5 bits (58), Expect(2) = 1.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 / -1 Query: 700 RMWSSRRRGCTRTC 659 R W SRRR CTR C Sbjct: 3131 RRWRSRRRWCTRRC 3090 Score = 22.1 bits (42), Expect(2) = 1.5 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -2 / -3 Query: 658 HRAWRGRPWTGRSPSLRPT 602 HR +G P G LRPT Sbjct: 3015 HRLLQGNPARGPRTRLRPT 2959
>LOC_Os07g17950:12007.t01654:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4725 Score = 29.5 bits (58), Expect(2) = 1.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 / -1 Query: 700 RMWSSRRRGCTRTC 659 R W SRRR CTR C Sbjct: 2781 RRWRSRRRWCTRRC 2740 Score = 22.1 bits (42), Expect(2) = 1.5 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -2 / -3 Query: 658 HRAWRGRPWTGRSPSLRPT 602 HR +G P G LRPT Sbjct: 2665 HRLLQGNPARGPRTRLRPT 2609
>LOC_Os12g32640:12012.t02959:unspliced-genomic haemolysin-III related family protein, expressed| Length = 3650 Score = 34.5 bits (69), Expect = 1.5 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -2 / -2 Query: 709 RTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPC 590 RT R ++R RA R RPW R+ P P PC Sbjct: 3088 RTARGTTARAHARRTRQRRARRARPWRPRTAPTSPPPAPC 2969
>LOC_Os12g03690:12012.t00261:unspliced-genomic D-mannose binding lectin family protein| Length = 2487 Score = 34.5 bits (69), Expect = 1.5 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -2 / -3 Query: 700 RMWSSRRRGCTRTCHRAWRGRPWTG 626 R W +RRR RTC A GR W G Sbjct: 205 RRWETRRRSRRRTCRPASAGRRWRG 131
>LOC_Os12g03650:12012.t00257:unspliced-genomic D-mannose binding lectin family protein, expressed| Length = 2508 Score = 34.5 bits (69), Expect = 1.5 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -2 / -3 Query: 700 RMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPC 590 R W+ RRRG R C GR W G R G C Sbjct: 214 RRWARRRRGRRRRCRPGRAGRRWRGPRRRWRRPGGGC 104
>LOC_Os11g19240:12011.t01693:unspliced-genomic amino acid permease, putative| Length = 1693 Score = 34.5 bits (69), Expect = 1.5 Identities = 17/40 (42%), Positives = 20/40 (50%) Frame = -2 / -1 Query: 625 RSPSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP*RRTCA 506 R P RP+ P RR+CT CR R+R P RR A Sbjct: 232 RPPQPRPSRQPRPPYVPRRTCTACRPRRRRKRRPRRRRSA 113
>LOC_Os11g14410:12011.t01272:unspliced-genomic polygalacturonase precursor, putative, expressed| Length = 2072 Score = 34.5 bits (69), Expect = 1.5 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -2 / -2 Query: 727 LLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTG 626 L+GS R RR C R C R WRGR +G Sbjct: 427 LVGSGGRRRPCTPRRRGRCHRACRRGWRGRGRSG 326
>LOC_Os11g03880:12011.t00278:unspliced-genomic D-mannose binding lectin family protein, expressed| Length = 2659 Score = 34.5 bits (69), Expect = 1.5 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -2 / -1 Query: 700 RMWSSRRRGCTRTCHRAWRGRPWTG 626 R W++RRR RTC A GR W G Sbjct: 205 RRWATRRRSRRRTCRPASGGRRWRG 131
>LOC_Os10g30140:12010.t02348:unspliced-genomic laccase, putative| Length = 1852 Score = 34.5 bits (69), Expect = 1.5 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -2 / -2 Query: 619 PSLRPTPGPCA*ATARRSCTGCRSWSCRRRGP 524 P P P P A+ R+C CR W RR P Sbjct: 1410 PCRTPPPSPWCRASLARACRRCRRWG*RRHSP 1315
>LOC_Os09g36060:12009.t03083:unspliced-genomic endoglucanase 1 precursor, putative, expressed| Length = 4370 Score = 34.5 bits (69), Expect = 1.5 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = -2 / +1 Query: 682 RRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGC 554 +RG T R RGR W GR P C+ T RR+ GC Sbjct: 664 QRGRCTTSARRGRGRTWPGRRRRRWPRRRWCSATTTRRTPRGC 792
>LOC_Os08g29669:12008.t004314:unspliced-genomic cytochrome b5, putative, expressed| Length = 3371 Score = 34.5 bits (69), Expect = 1.5 Identities = 19/47 (40%), Positives = 23/47 (48%) Frame = -2 / -3 Query: 670 TRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRR 530 T TC R+ R P R P+ P P +*ATA S C + S RR Sbjct: 2937 TATCRRSCRRSPP*RRPPTTPPWTPPTS*ATASTSTRRCTAASSARR 2797
>LOC_Os08g29660:12008.t02720:unspliced-genomic OsWRKY69 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 2368 Score = 34.5 bits (69), Expect = 1.5 Identities = 19/47 (40%), Positives = 23/47 (48%) Frame = -2 / +3 Query: 670 TRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTGCRSWSCRRR 530 T TC R+ R P R P+ P P +*ATA S C + S RR Sbjct: 1038 TATCRRSCRRSPP*RRPPTTPPWTPPTS*ATASTSTRRCTAASSARR 1178
>LOC_Os08g12600:12008.t01139:unspliced-genomic expressed protein| Length = 1039 Score = 34.5 bits (69), Expect = 1.5 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -2 / -1 Query: 673 CTRTCHRAWRGRPWTGRSPSLRPTPGPCA 587 C+R HR R +G P RP PGPCA Sbjct: 403 CSRWWHR*SHRRRPSGSGPPCRPRPGPCA 317
>LOC_Os07g41820:12007.t03837:unspliced-genomic expressed protein| Length = 2460 Score = 34.5 bits (69), Expect = 1.5 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -2 / +2 Query: 619 PSLRPTPGPCA*ATARRSCTGCRSWSCRRR 530 P P P PC + RRS T C S S RRR Sbjct: 521 PPPAPPPPPCRPPSPRRSSTSCSSRSARRR 610
>LOC_Os07g39240:12007.t03585:unspliced-genomic expressed protein| Length = 3658 Score = 34.5 bits (69), Expect = 1.5 Identities = 20/67 (29%), Positives = 26/67 (38%) Frame = -2 / +1 Query: 736 RDTLLGSTSRTGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARRSCTG 557 R S SR +S R C+R C + R W SP+ A + R S G Sbjct: 2974 RGASTASPSRGASTSASPPRACSRACTTSCAPRRWRTCSPTTSTRQRQRAPSAGRASSPG 3153 Query: 556 CRSWSCR 536 +W CR Sbjct: 3154 PATW*CR 3174
>LOC_Os07g12100:12007.t01082:unspliced-genomic expressed protein| Length = 6907 Score = 34.5 bits (69), Expect = 1.5 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -2 / -1 Query: 673 CTRTCHRAWRGRPWTGRSPSLRPTPGP 593 CT T RA GR T RSP+ RPT P Sbjct: 3205 CTGTSRRAGSGRR*TSRSPACRPTSRP 3125
>LOC_Os06g47620:12006.t04448:unspliced-genomic IAA-amino acid hydrolase ILR1-like 6 precursor, putative, expressed| Length = 5540 Score = 34.5 bits (69), Expect = 1.5 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = -2 / -1 Query: 706 TGRMWSSRRRGCTRTCHRAWRGRPWTGRSPSLRPTPGPCA*ATARR 569 +GR SR C R C R RGRP + R RP+ ++ RR Sbjct: 4898 SGRCGRSRASRCARRCSRIRRGRPGSRRRSPRRPSSAARRGSSRRR 4761 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 401,053,096 Number of extensions: 7405399 Number of successful extensions: 74740 Number of sequences better than 10.0: 758 Length of query: 398 Length of database: 55,613,886 Length adjustment: 50 Effective length of query: 348 Effective length of database: 52,799,986 Effective search space: 18374395128 Effective search space used: 18374395128 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
