ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf123a07 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os06g38320:12006.t03527:unspliced-genomic expressed protein| Length = 6038 Score = 92.3 bits (195), Expect(9) = 1e-90 Identities = 37/45 (82%), Positives = 43/45 (95%) Frame = +1 / +2 Query: 37 ATMAAAGALVVYRAVFAALGCLMVGTLVYTCITDGSPFRIELLTP 171 A+MAAAG++ VYRAVFAALG LM+GTLVYTC+TDGSPFR+ELLTP Sbjct: 326 ASMAAAGSIGVYRAVFAALGALMLGTLVYTCVTDGSPFRLELLTP 460 Score = 81.7 bits (172), Expect(9) = 1e-90 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = +3 / +3 Query: 384 QAR*STRKEVFFCCHRENYFQHFGHTHGCTCHVYCHYRWTAFQEGFVDTV 533 QAR S RK+V FC + ENYFQHFG GC+ ++YCH+ WT FQEG VD V Sbjct: 2610 QARRSIRKKVLFCHNWENYFQHFGGNDGCSRNLYCHH*WTTFQEGLVDPV 2759 Score = 69.3 bits (145), Expect(9) = 1e-90 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +1 / +1 Query: 655 SITTCGYIVVQLLQVSYQDPVYHLLLNSHSK 747 SITTCGYIV+QL QVSY+DP+YH+LLNSH+K Sbjct: 5062 SITTCGYIVIQLFQVSYRDPIYHVLLNSHNK 5154 Score = 61.1 bits (127), Expect(9) = 1e-90 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = +1 / +2 Query: 568 VFAISVWVVHRESTWISAVIWICLLICFGSIT 663 V + VWV H+ES WIS IWICLLICFG T Sbjct: 4304 VICLQVWVAHKESNWISTAIWICLLICFGRYT 4399 Score = 58.3 bits (121), Expect(9) = 1e-90 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = +1 / +3 Query: 217 ISTWVVYKEGNWISSIFWVVLLICFG 294 + TWV+YKE NWISS FWVVLL CFG Sbjct: 1818 LQTWVIYKEVNWISSFFWVVLLYCFG 1895 Score = 45.1 bits (92), Expect(9) = 1e-90 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +1 / +3 Query: 532 WMAATLIDFYINVFAISV 585 WMAATLIDFYINVFAISV Sbjct: 3666 WMAATLIDFYINVFAISV 3719 Score = 38.6 bits (78), Expect(9) = 1e-90 Identities = 19/34 (55%), Positives = 24/34 (70%) Frame = +2 / +2 Query: 287 VSAVLLHVLILLASYLR*HLQGFPKIRLIFCCSG 388 + +VLLHVL+LL S+L+* L KI LIF SG Sbjct: 2003 IFSVLLHVLMLL*SFLK*KLPDLHKIHLIFYSSG 2104 Score = 36.8 bits (74), Expect(9) = 1e-90 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +1 / +3 Query: 163 LTPWIVTTLVDFYVNIAAIS 222 L W+V TL+DFYVN+ AIS Sbjct: 948 LCRWLVATLIDFYVNVTAIS 1007 Score = 23.5 bits (45), Expect(9) = 1e-90 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +3 / +3 Query: 774 MFLVHNNVTYVHNGSS 821 +FLV+NN+T ++ SS Sbjct: 5304 LFLVYNNITSINGVSS 5351 Score = 86.8 bits (183), Expect(8) = 5e-79 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -3 / -3 Query: 173 HGVSSSMRNGEPSVMQVYTRVPTMRQPSAANTALYTTRAPAAAMVA 36 HGVSSS RNGEPSV QVYTRVP+MR PSAANTALYT PAAAM A Sbjct: 462 HGVSSSRRNGEPSVTQVYTRVPSMRAPSAANTALYTPMDPAAAMDA 325 Score = 84.5 bits (178), Expect(8) = 5e-79 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = -3 / -1 Query: 533 HGVNKSFLKGSPSVMTVYVTSAAMSMPKMLKIVLPMTTKEHFLSGRLSCL 384 +GVNKSFLKGSPSVMTV +T+AA+ PKMLKI+LP+ TKE FLS R CL Sbjct: 2759 YGVNKSFLKGSPSVMTV*ITTAAIIAPKMLKIILPIMTKEDFLSDRSPCL 2610 Score = 54.7 bits (113), Expect(8) = 5e-79 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = -2 / -3 Query: 750 LLAMGVQ*QMVDWVLVRHLEKLNHNVATCCDA 655 +L M VQ* M+DWV VRHLEKL NVATC DA Sbjct: 5157 ILVMRVQ*HMIDWVSVRHLEKLYDNVATCRDA 5062 Score = 51.0 bits (105), Expect(8) = 5e-79 Identities = 20/28 (71%), Positives = 22/28 (78%) Frame = -3 / -3 Query: 665 VVMLPKHINKHIHMTAEIQVDSL*TTHT 582 +V LPKHINKHI M +IQ DSL* THT Sbjct: 4401 IVYLPKHINKHIQMAVDIQFDSL*ATHT 4318 Score = 48.7 bits (100), Expect(8) = 5e-79 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -2 / -1 Query: 600 PVNNPYRYCKDIYIEVN*GCSHP 532 P N YRYC+DIYIEVN*GC HP Sbjct: 3734 PKNVIYRYCEDIYIEVN*GCRHP 3666 Score = 46.0 bits (94), Expect(8) = 5e-79 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -2 / -1 Query: 294 AETNQQYYPEDRTNPISFLVDNPS 223 A+T QQ YP++RTNPI FLVDNPS Sbjct: 1895 AKTVQQNYPKERTNPIYFLVDNPS 1824 Score = 39.6 bits (80), Expect(8) = 5e-79 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -2 / -1 Query: 222 RNRCYIYIKINQCCHDPRSQQ 160 RNR +I IKINQCCH P +Q+ Sbjct: 1007 RNRSHIDIKINQCCHQPPTQR 945 Score = 37.3 bits (75), Expect(8) = 5e-79 Identities = 18/33 (54%), Positives = 20/33 (60%) Frame = -3 / -1 Query: 386 LSNKRSSGFWESPEDVISNNLLTI*AHVVALPK 288 L NKRSSG E PE IS + T *AHV L + Sbjct: 2102 LRNKRSSGSCEGPEVFISKSFTTT*AHVAILKR 2004 Score = 86.3 bits (182), Expect(6) = 2e-64 Identities = 38/56 (67%), Positives = 44/56 (78%) Frame = +1 / +1 Query: 403 ERKCSFVVIGRTIFSILGILMAALVTYTVITDGLPFRKDLLTPWMAATLIDFYINV 570 ERK SFV+IGR IFSILG +MAA+V YTVITDGLPFRKDLLTP + D+ N+ Sbjct: 2629 ERKSSFVIIGRIIFSILGAMMAAVVIYTVITDGLPFRKDLLTP*VNHICSDYLRNL 2796 Score = 83.5 bits (176), Expect(6) = 2e-64 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +2 / +3 Query: 44 WQRQEPWSCTGRCSPRSAASWWAPWCTPASPMARRFASSC 163 W+R++P +CTGRCS R A S WAPWCTPASP ARRFASSC Sbjct: 333 WRRRDP*ACTGRCSRRWALSCWAPWCTPASPTARRFASSC 452 Score = 58.3 bits (121), Expect(6) = 2e-64 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = +3 / +1 Query: 582 GMGCSQGVDLDLSSHMDMLVDMLWKHHNMWL 674 GMGCSQGV LD+ H+DMLV+MLWK HN L Sbjct: 4318 GMGCSQGVKLDIYCHLDMLVNMLWKVHNFLL 4410 Score = 54.2 bits (112), Expect(6) = 2e-64 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = +2 / +2 Query: 656 ASQHVATLWFNFSKCRTKTQSTICY*TPI 742 AS+HVATL +NFSKCRT+TQS +CY*T I Sbjct: 5063 ASRHVATLSYNFSKCRTETQSIMCY*TLI 5149 Score = 41.8 bits (85), Expect(6) = 2e-64 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = +3 / +2 Query: 222 DLGCLQGRKLD*FYLLGSTVDLFRQ 296 DLG LQG KLD*F+LLGS+V LF Q Sbjct: 1823 DLGYLQGSKLD*FFLLGSSVVLFWQ 1897 Score = 35.4 bits (71), Expect(6) = 2e-64 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +3 / +3 Query: 294 QCYYMCLYC*QVI*DNIFRAFPKSA*SFVAQAR 392 Q YMCL C + *+ FR F +S *SF+ Q + Sbjct: 2010 QYCYMCLCCCEAF*NKNFRTFTRST*SFIPQVQ 2108 Score = 82.6 bits (174), Expect(7) = 3e-59 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -2 / -2 Query: 171 RSQQLDAKRRAIGDAGVHQGAHHEAAERGEHRPVHDQGSCRCHGRA 34 R +QL+AKRRA+GDAGVHQGA HE+A+R EHRPVH GS R HG A Sbjct: 460 RGEQLEAKRRAVGDAGVHQGAQHESAQRREHRPVHAYGSRRRHGCA 323 Score = 73.5 bits (154), Expect(7) = 3e-59 Identities = 33/54 (61%), Positives = 40/54 (74%) Frame = -2 / -3 Query: 537 HPRCQQILPERQSICNDSIRDKCSHEYAQNAENSSPDDNKRTLPFG*IILPEQQ 376 H R QQ+LPER SI +DSI CSH QNAEN+SP+ +KR L FG*I LPE++ Sbjct: 2763 HLRGQQVLPER*SISDDSINYDCSHHCPQNAENNSPNYDKRGLSFG*ISLPEKK 2602 Score = 53.8 bits (111), Expect(7) = 3e-59 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = -1 / -2 Query: 748 SCYGSSVADGRLGLGTTLGEVEPQCSHML*C 656 +CY SS+A RLGLGTTLG+V QCSHM *C Sbjct: 5155 TCYESSIAHDRLGLGTTLGKVV*QCSHMS*C 5063 Score = 43.2 bits (88), Expect(7) = 3e-59 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -1 / -3 Query: 295 CRNKSTVLPRR*N*SNFLPCRQPKS 221 C+N +T LP+R N*SN LPCR PKS Sbjct: 1896 CQNSTTELPKRKN*SNLLPCR*PKS 1822 Score = 41.4 bits (84), Expect(7) = 3e-59 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -1 / -3 Query: 586 IPILQRHLYRSQLRLQPST 530 +PIL+RHLYRSQLRL PST Sbjct: 3720 LPILRRHLYRSQLRLPPST 3664 Score = 36.8 bits (74), Expect(7) = 3e-59 Identities = 18/32 (56%), Positives = 22/32 (68%) Frame = -2 / -3 Query: 390 LPEQQKIKRILGKP*RCYLK*LANNISTCSST 295 +PE+ KIK IL + Y K L NNISTCS+T Sbjct: 2106 VPEE*KIKWIL*RSGSFYFKKLHNNISTCSNT 2011 Score = 29.9 bits (59), Expect(7) = 3e-59 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -2 / -2 Query: 663 CDASKAYQQAYPYDC*DPSRLPVNNPY 583 C SKAY QAYP P L V+NPY Sbjct: 4399 CVPSKAY*QAYPDGSRYPV*LLVSNPY 4319 Score = 61.6 bits (128), Expect(8) = 3e-36 Identities = 32/50 (64%), Positives = 38/50 (76%) Frame = -1 / -2 Query: 532 TVSTNPS*KAVHL**QYT*QVQP*VCPKC*K*FSR*QQKNTSFRVDYLA* 383 T ST+PS*K VH **QY ++QP + PKC*K*FS+ QK T FR+D LA* Sbjct: 2758 TGSTSPS*KVVHQ**QYKLRLQPSLPPKC*K*FSQL*QKRTFFRIDLLA* 2609 Score = 47.8 bits (98), Expect(8) = 3e-36 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = -3 / -1 Query: 749 FLLWEFSSRW*TGSWYDTWRS*TTM*PHVVML 654 +LL EF+S * GS YDTW+S TM*PHVVML Sbjct: 5156 YLL*EFNST**IGSRYDTWKSCMTM*PHVVML 5061 Score = 42.8 bits (87), Expect(8) = 3e-36 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -3 / -2 Query: 296 LPKQINSTTQKIELIQFPSL*TTQV 222 LPKQ N TTQK ELIQF SL* TQV Sbjct: 1897 LPKQYNRTTQKKELIQFTSL*ITQV 1823 Score = 40.5 bits (82), Expect(8) = 3e-36 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 / -2 Query: 584 TDIAKTFI*KSIKVAAIH 531 TDIAKTFI*KSIKVAAIH Sbjct: 3718 TDIAKTFI*KSIKVAAIH 3665 Score = 33.6 bits (67), Expect(8) = 3e-36 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -1 / -1 Query: 91 ARRTPPCTRPGLLPLPWSRARSLTARRRV 5 A RTPPCTR + P PW R + RV Sbjct: 380 APRTPPCTRLWIPPPPWMRPLAAARSPRV 294 Score = 26.7 bits (52), Expect(8) = 3e-36 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -1 / -2 Query: 376 KDQADFGKALKMLSQITC*QYKHM* 302 KDQ D K K L Q Q+KHM* Sbjct: 2092 KDQVDLVKVRKFLFQKASQQHKHM* 2018 Score = 23.5 bits (45), Expect(8) = 3e-36 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -3 / -2 Query: 221 EIAAIFT*KSTNVVTIHGVSSSMRNGEPSVMQVYTRVPTMRQ 96 EIA T*KS +V T H ++ +++ + +PT+ Q Sbjct: 1006 EIAVTLT*KSISVATNHLHREKLQLQVKALLDNSSDLPTLMQ 881 Score = 23.1 bits (44), Expect(8) = 3e-36 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 / -1 Query: 601 PCEQPIP 581 PCEQPIP Sbjct: 4337 PCEQPIP 4317 Score = 62.5 bits (130), Expect(7) = 5e-33 Identities = 32/50 (64%), Positives = 32/50 (64%) Frame = +2 / +2 Query: 383 SGKIIYPKGSVLLLSSGELFSAFWAYSWLHLSRILSLQMDCLSGRIC*HR 532 SGK IYPK S LL GELFSAFW WL ILS MD LSGR C* R Sbjct: 2609 SGKEIYPKESPLLS*LGELFSAFWGQ*WLQS*FILSSLMDYLSGRTC*PR 2758 Score = 39.1 bits (79), Expect(7) = 5e-33 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = +2 / +3 Query: 581 RYGLFTGSRLGSQQSYGYAC*YALEASQ 664 RYGL T S+ G GYAC*YALE +Q Sbjct: 4317 RYGLLTRSQTGYLLPSGYAC*YALEGTQ 4400 Score = 38.2 bits (77), Expect(7) = 5e-33 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +2 / +1 Query: 221 RLGLSTRKEIGLVLSSG*YC 280 RLGLSTRK IGLVLS G*+C Sbjct: 1822 RLGLSTRK*IGLVLSFG*FC 1881 Score = 35.4 bits (71), Expect(7) = 5e-33 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = +2 / +1 Query: 533 GWLQP*LTSI*MSLQYRYGLFTG 601 GW QP*LTSI*MS QYR F G Sbjct: 3667 GWRQP*LTSI*MSSQYR*ITFFG 3735 Score = 33.6 bits (67), Expect(7) = 5e-33 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = +3 / +1 Query: 36 RDHGSGRSPGRVQGGVRRARXXXXXXXXXXXXXRWLAVSHRAADSV 173 R HG G RVQGGVR A R LAVS RAA V Sbjct: 325 RIHGGGGIHRRVQGGVRGAGRSHAGHPGVHLRHRRLAVSPRAAHPV 462 Score = 33.6 bits (67), Expect(7) = 5e-33 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +1 / +1 Query: 295 SATTCAYIVSKLFEITSSG 351 S TCAY+V KLFEI +SG Sbjct: 2011 SIATCAYVVVKLFEIKTSG 2067 Score = 27.6 bits (54), Expect(7) = 5e-33 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +3 / +3 Query: 657 HHNMWLHC 680 HH+MWLHC Sbjct: 5064 HHDMWLHC 5087 Score = 47.8 bits (98), Expect(4) = 5e-17 Identities = 18/33 (54%), Positives = 23/33 (69%) Frame = +1 / +2 Query: 433 RTIFSILGILMAALVTYTVITDGLPFRKDLLTP 531 R +F+ LG LM + YT +TDG PFR +LLTP Sbjct: 362 RAVFAALGALMLGTLVYTCVTDGSPFRLELLTP 460 Score = 42.8 bits (87), Expect(4) = 5e-17 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +1 / +3 Query: 577 ISVWVVHRESTWISAVIWICLLICFG 654 + WV+++E WIS+ W+ LL CFG Sbjct: 1818 LQTWVIYKEVNWISSFFWVVLLYCFG 1895 Score = 38.2 bits (77), Expect(4) = 5e-17 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +1 / +3 Query: 523 LTPWMAATLIDFYINVFAISV 585 L W+ ATLIDFY+NV AISV Sbjct: 948 LCRWLVATLIDFYVNVTAISV 1010 Score = 27.6 bits (54), Expect(4) = 5e-17 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 / +1 Query: 655 SITTCGYIVVQLLQVSYQDP 714 SI TC Y+VV+L ++ P Sbjct: 2011 SIATCAYVVVKLFEIKTSGP 2070 Score = 52.4 bits (108), Expect(3) = 3e-15 Identities = 20/50 (40%), Positives = 32/50 (64%) Frame = +1 / +1 Query: 61 LVVYRAVFAALGCLMVGTLVYTCITDGSPFRIELLTPWIVTTLVDFYVNI 210 +++ R +F+ LG +M ++YT ITDG PFR +LLTP + D+ N+ Sbjct: 2647 VIIGRIIFSILGAMMAAVVIYTVITDGLPFRKDLLTP*VNHICSDYLRNL 2796 Score = 50.6 bits (104), Expect(3) = 3e-15 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +1 / +2 Query: 208 IAAISTWVVYKEGNWISSIFWVVLLICFGSAT 303 + + WV +KE NWIS+ W+ LLICFG T Sbjct: 4304 VICLQVWVAHKESNWISTAIWICLLICFGRYT 4399 Score = 26.7 bits (52), Expect(3) = 3e-15 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +1 / +1 Query: 295 SATTCAYIVSKLFEIT 342 S TTC YIV +LF+++ Sbjct: 5062 SITTCGYIVIQLFQVS 5109 Score = 32.7 bits (65), Expect(2) = 3.8 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 / +3 Query: 172 WIVTTLVDFYVNIAAIS 222 W+ TL+DFY+N+ AIS Sbjct: 3666 WMAATLIDFYINVFAIS 3716 Score = 23.1 bits (44), Expect(2) = 3.8 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = +1 / +1 Query: 547 LIDFYINVFAISVWVVHRESTWISAVIWI 633 L++ V + ++ S WIS IW+ Sbjct: 4372 LVNMLWKVHNFLLRIIKETSHWISTAIWV 4458
>LOC_Os04g58800:12004.t05341:unspliced-genomic ubiquitin-conjugating enzyme spm2, putative, expressed| Length = 2128 Score = 39.6 bits (80), Expect = 0.038 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +2 / -2 Query: 68 CTGRCSPRSAASWWAPWCTPASPM 139 C R SP SAAS ++PWCTP++ + Sbjct: 1731 CAARPSPSSAASGYSPWCTPSASL 1660
>LOC_Os10g22710:12010.t01750:unspliced-genomic expressed protein| Length = 2038 Score = 38.6 bits (78), Expect(2) = 0.041 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +2 / +3 Query: 50 RQEPWSCTGRCSPRSAASWWAPWCTPASPMARRFASSC 163 R PW+ + R R+ S W+PW +PA P R C Sbjct: 1392 RGAPWAPSARPRTRTRRSRWSPWASPARPETPRTTRRC 1505 Score = 22.6 bits (43), Expect(2) = 0.041 Identities = 6/18 (33%), Positives = 12/18 (66%) Frame = +1 / +3 Query: 592 VHRESTWISAVIWICLLI 645 V R S+WI + W+ +++ Sbjct: 1959 VQRTSSWILGLSWVVVVV 2012
>LOC_Os09g23084:12009.t01992:unspliced-genomic endoglucanase 1 precursor, putative, expressed| Length = 9170 Score = 39.1 bits (79), Expect = 0.052 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +2 / -3 Query: 44 WQRQEPWSCTGRCSPRSAASWWAPWCTPASPMARR 148 W+R+ PW RC PRSA SW T ARR Sbjct: 8733 WRRRRPWGRCCRCRPRSACSWRGRRGTRRGGWARR 8629
>LOC_Os01g72020:12001.t06492:unspliced-genomic BOP2, putative, expressed| Length = 3054 Score = 39.1 bits (79), Expect = 0.052 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +2 / +3 Query: 65 SCTGRCSPRSAASWWAPWCTPASPMARRFASS 160 S TGR S S ++W A WCTP + + R ASS Sbjct: 357 SSTGRRSATSRSAWRAAWCTPTAASSPRAASS 452
>LOC_Os03g17350:12003.t01512:unspliced-genomic ATPase, coupled to transmembrane movement of substances, putative,| expressed Length = 2727 Score = 30.4 bits (60), Expect(2) = 0.090 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 / +2 Query: 104 WWAPWCTPASPMARRFASS 160 W +PWC+P SP + A+S Sbjct: 1967 WGSPWCSPRSPTSSSSAAS 2023 Score = 25.4 bits (49), Expect(2) = 0.090 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 / +2 Query: 44 WQRQEPWSCTGRCSPRSAASW 106 WQ P S G SPRS+ +W Sbjct: 1889 WQSCWPPSGRGAASPRSSPAW 1951
>LOC_Os02g39480:12002.t03586:unspliced-genomic protein phosphatase 2C containing protein| Length = 4870 Score = 38.2 bits (77), Expect = 0.098 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +3 / +2 Query: 396 STRKEVFFCCHRENYFQHFGHTHGCTCHVYCHYRWTAFQEGFVDTV 533 +TR FF CH F H+ CH +C +TAF F+ + Sbjct: 2198 TTRIMFFFICHYTGLIMSFVHSFFYECHFFC*SHFTAFYSLFISRI 2335
>LOC_Os08g07500:12008.t00639:unspliced-genomic plant-specific domain TIGR01570 family protein, expressed| Length = 1457 Score = 32.2 bits (64), Expect(2) = 0.13 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -2 / -2 Query: 174 PRSQQLDAKRRAIGDAGVHQGAHHEAAERGEHRPV 70 P ++L +RR G H GAH + A+R +HR V Sbjct: 862 PLLRRLRRRRRRPVGGGEHAGAHGDGAQRLQHREV 758 Score = 23.1 bits (44), Expect(2) = 0.13 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 / -2 Query: 88 RRTPPCTRPGLLPLPWSRARSLTARRR 8 RR PP PGL P+ R +RR Sbjct: 751 RRLPPHREPGLPPVAEHGPRRHVQQRR 671
>LOC_Os03g43440:12003.t03739:unspliced-genomic CBL-interacting serine/threonine-protein kinase 15, putative,| expressed Length = 1707 Score = 37.7 bits (76), Expect = 0.14 Identities = 17/38 (44%), Positives = 21/38 (55%) Frame = +2 / +3 Query: 47 QRQEPWSCTGRCSPRSAASWWAPWCTPASPMARRFASS 160 +R WS + R +P SA SWWA + A P A ASS Sbjct: 1098 RRSGRWSGSARRAPSSATSWWARRASNACPWAASRASS 1211
>LOC_Os09g27220:12009.t02401:unspliced-genomic water channel, putative, expressed| Length = 2064 Score = 37.3 bits (75), Expect = 0.19 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +2 / -3 Query: 44 WQRQEPWSCTGRCSPRSAASWWAPWCTPASPMA 142 W R EP + +G P WW WC +P A Sbjct: 904 WNRSEPEAASGSPKPPPPPRWWYGWCRREAPAA 806
>LOC_Os02g39280:12002.t03566:unspliced-genomic C2 domain containing protein| Length = 5744 Score = 32.2 bits (64), Expect(2) = 0.34 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +2 / +1 Query: 416 LLLSSGELFSAFWAYSWLHLSRILSLQ 496 L L SGE+F A WAY L ++ +L LQ Sbjct: 2662 LFLCSGEVFPAPWAYVHLLMASVLPLQ 2742 Score = 27.2 bits (53), Expect(2) = 0.34 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 / +3 Query: 62 WSCTGRCSPRSAASWWAPWCTPASPMARRFAS 157 WSC+ + + AP TP+SP A R AS Sbjct: 516 WSCSVPSTSSAPT*TGAPILTPSSPAASRDAS 611
>LOC_Os03g58204:12003.t005751:unspliced-genomic 60S ribosomal protein L4, putative, expressed| Length = 2456 Score = 36.3 bits (73), Expect = 0.35 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 / +3 Query: 44 WQRQEPWSCTGRCSPRSAASWWAPWCTPASPMARRFASSC 163 W+R P S RCS R +A W+P T +SP + C Sbjct: 117 WRRTRPASRCRRCSARRSAPTWSPSPTSSSPATAASRTPC 236
>LOC_Os09g28120:12009.t02490:unspliced-genomic F-box domain containing protein, expressed| Length = 2349 Score = 30.9 bits (61), Expect(2) = 0.40 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -2 / -1 Query: 174 PRSQQLDAKRRAIGDAGVHQGAHHEAAERGEHR 76 PR ++ R A+ A H GA A+ EHR Sbjct: 603 PREEERRQVRHALAPAAAHAGARRHVADVAEHR 505 Score = 22.6 bits (43), Expect(2) = 0.40 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -1 / -3 Query: 88 RRTPPCTRPGLLPL 47 RR PPC R PL Sbjct: 451 RRRPPCARRNASPL 410
>LOC_Os07g40290:12007.t03690:unspliced-genomic indole-3-acetic acid-amido synthetase GH3.8, putative, expressed| Length = 2431 Score = 35.4 bits (71), Expect = 0.66 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +2 / +1 Query: 59 PWSCTGRCSPRSAASWWAPWCTPASPMARRFASS 160 PWS RCS R+A WW+ A +R SS Sbjct: 1636 PWSARRRCSARTARPWWSTPAKRAPSASRATTSS 1737
>LOC_Os07g21990:12007.t01903:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2455 Score = 35.4 bits (71), Expect = 0.66 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 / -3 Query: 71 TGRCSPRSAASWWAPWCTPASPMARR 148 TG C R+ A+W APW P SP +R+ Sbjct: 302 TGGCRRRAPAAWSAPWGEPPSP*SRQ 225
>LOC_Os06g19130:12006.t01736:unspliced-genomic conserved hypothetical protein| Length = 8545 Score = 35.4 bits (71), Expect = 0.66 Identities = 16/57 (28%), Positives = 22/57 (38%) Frame = -2 / -2 Query: 225 SRNRCYIYIKINQCCHDPRSQQLDAKRRAIGDAGVHQGAHHEAAERGEHRPVHDQGS 55 SR++C ++CC P R H HH A+ G HR + GS Sbjct: 4515 SRSQCSSRSTRSRCCRMPIWSHCRLSRPPRAQTHCHSSCHHGRADTGRHRAISPLGS 4345
>LOC_Os02g49700:12002.t04554:unspliced-genomic homeodomain leucine zipper protein CPHB-5, putative, expressed| Length = 2359 Score = 35.4 bits (71), Expect = 0.66 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 / +1 Query: 62 WSCTGRCSPRSAASWWAPWCTPASPMARR 148 WS T R + + + WAPW TP +RR Sbjct: 1657 WSRTSRAATSTTTA*WAPWTTPRGASSRR 1743
>LOC_Os02g42150:12002.t03802:unspliced-genomic OsWAK14 - OsWAK receptor-like protein kinase, expressed| Length = 3522 Score = 35.4 bits (71), Expect = 0.66 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 / -3 Query: 543 CSHPRCQQILPERQSICND 487 CSHPRC L R++ CND Sbjct: 1678 CSHPRCMGFLQNRENTCND 1622
>LOC_Os09g30380:12009.t02716:unspliced-genomic expressed protein| Length = 3401 Score = 35.0 bits (70), Expect = 0.91 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 / -2 Query: 50 RQEPWSCTGRCSPRSAASWWAPWCTPASP 136 R P RC RS+ +WW W TP P Sbjct: 547 RPRPRRHGSRCRRRSSGAWWWTWATPPCP 461 Score = 32.7 bits (65), Expect = 4.5 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +2 / +2 Query: 50 RQEPWSCTGRCSPRSAASWWAPWCTPASPMARRFASSC*LRGS 178 R+ S TG + +ASWW+PW ++ A R + S RG+ Sbjct: 647 RRATRSQTGSSAR*PSASWWSPWPASSTRSASRRSGSLLRRGT 775
>LOC_Os01g17214:12001.t01567:unspliced-genomic carbohydrate transporter/ sugar porter/ transporter, putative,| expressed Length = 13191 Score = 35.0 bits (70), Expect = 0.91 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 / -3 Query: 368 LIFCCSGKIIYPKGSVLLLSSGELFSAFWAYSWLH 472 L F C+ +I K LLSSG+ F+ W+ +W+H Sbjct: 1735 LSFVCTLQIFSQKPIFSLLSSGKNFALIWSGNWMH 1631
>LOC_Os06g01934:12006.t00089:unspliced-genomic BEL1-related homeotic protein 14, putative, expressed| Length = 6998 Score = 34.5 bits (69), Expect = 1.3 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +2 / +2 Query: 62 WSCTGRCSPRSAASWWAPWCTPAS 133 W+ RCSP SAAS PW P+S Sbjct: 482 WAL*RRCSPSSAASTLRPWMAPSS 553
>LOC_Os02g57720:12002.t05343:unspliced-genomic aquaporin PIP 1.3, putative, expressed| Length = 1768 Score = 34.1 bits (68), Expect(2) = 1.3 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 / -2 Query: 74 GRCSPRSAASWWAPWCTPASPMARRFASSC 163 GR PRS PWCTP S RR S C Sbjct: 717 GRRCPRSPPRARPPWCTPGSRRWRRRRSPC 628 Score = 21.7 bits (41), Expect(2) = 1.3 Identities = 6/12 (50%), Positives = 6/12 (50%) Frame = +2 / -2 Query: 44 WQRQEPWSCTGR 79 W R PW C R Sbjct: 780 WGRGSPWRCAWR 745
>LOC_Os01g10090:12001.t00884:unspliced-genomic pentatricopeptide repeat protein PPR868-14, putative| Length = 1710 Score = 32.7 bits (65), Expect(2) = 1.7 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 / +2 Query: 62 WSCTGRCSPRSAASWWAPW 118 WSC+G CS + W PW Sbjct: 812 WSCSGECSSNGSRRTW*PW 868 Score = 22.6 bits (43), Expect(2) = 1.7 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +2 / +2 Query: 428 SGELFSAFWAYSWLHLS 478 S L S +W Y W+ S Sbjct: 875 SSPLASTYWRYGWVESS 925
>LOC_Os11g45720:12011.t04099:unspliced-genomic pectinesterase precursor, putative, expressed| Length = 2159 Score = 34.1 bits (68), Expect = 1.7 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 / -3 Query: 68 CTGRCSPRSAASWWAPWCTPASP 136 C+ R R+ WW WC PASP Sbjct: 396 CSPRGPSRAPPRWW*RWCRPASP 328
>LOC_Os09g34090:12009.t02985:unspliced-genomic sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating,| putative, expressed Length = 4294 Score = 34.1 bits (68), Expect = 1.7 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 / +3 Query: 59 PWSCTGRCSPRSAASWWAPWCTPASP 136 PW G SP +A + WCTPA P Sbjct: 402 PWRARGGSSPPAAGAASGRWCTPARP 479
>LOC_Os05g30430:12005.t02642:unspliced-genomic expressed protein| Length = 3536 Score = 34.1 bits (68), Expect = 1.7 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +2 / -1 Query: 50 RQEPWSCTGRCSPRSAASWWAPWCTPASPMARRFASS 160 R +P + R SPR A +W + W A PMA R +S+ Sbjct: 254 RSKPRISSPRVSPRHALAWRSSWRRRAVPMAARCSSA 144
>LOC_Os01g58150:12001.t05213:unspliced-genomic expressed protein| Length = 1462 Score = 34.1 bits (68), Expect = 1.7 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -2 / +3 Query: 168 SQQLDAKRRAIGDAGVHQGAHHEAAERGEH 79 ++++ +RR +G AGV G H A ERG H Sbjct: 873 ARRVVGRRRRVGAAGVGGGRHRAAEERGSH 962
>LOC_Os05g05354:12005.t00425:unspliced-genomic expressed protein| Length = 10206 Score = 27.6 bits (54), Expect(3) = 1.9 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -1 / +2 Query: 88 RRTPPCTRPGLLPLPWSRARSLTARR 11 R PPCT P L P R L RR Sbjct: 4634 RHLPPCTAPSALYGPTRRGPDLARRR 4711 Score = 25.8 bits (50), Expect(3) = 1.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 / +1 Query: 164 SSSMRNGEPSVMQVYTRVPT 105 SS + EPS M+ +T+VPT Sbjct: 3646 SSRLIANEPSSMRAFTKVPT 3705 Score = 24.9 bits (48), Expect(3) = 1.9 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -3 / +2 Query: 437 VLPMTTKEHFLSGRLSCLSNK 375 +LP KEH + +C+S+K Sbjct: 1607 ILPKVKKEHAIEDDATCISHK 1669
>LOC_Os02g30850:12002.t02778:unspliced-genomic OsGrx_C8 - glutaredoxin subgroup III, expressed| Length = 1065 Score = 30.9 bits (61), Expect(2) = 2.0 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +2 / +1 Query: 68 CTGRCSPRSAASWWAPW 118 CT S R+AASW APW Sbjct: 364 CTSWTSTRAAASWSAPW 414 Score = 23.5 bits (45), Expect(2) = 2.0 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +3 / +1 Query: 228 GCLQGRKLD*FYLLGSTVDLFRQCYYMC 311 GCL R LD L+ + + YY C Sbjct: 934 GCLLARALDLLALMLHAIASY*NYYYQC 1017
>LOC_Os01g02020:12001.t00097:unspliced-genomic acetyl-CoA acetyltransferase, cytosolic 2, putative, expressed| Length = 4177 Score = 27.6 bits (54), Expect(2) = 2.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 / +1 Query: 62 WSCTGRCSPRSAASWWA 112 W+ TGRC + ASW++ Sbjct: 2491 WTLTGRCFSQPEASWYS 2541 Score = 23.1 bits (44), Expect(2) = 2.3 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +2 / +3 Query: 92 SAASWWAPWCTPASPMAR 145 S S+W WC S AR Sbjct: 2661 SGPSYWLQWCENHSHFAR 2714
>LOC_Os06g44880:12006.t04175:unspliced-genomic type II intron maturase family protein| Length = 3897 Score = 33.6 bits (67), Expect = 2.4 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = -1 / +3 Query: 88 RRTPPCTRPGLLPLPWSRARSLTARRR 8 R PP RP L PLP +RA S +RRR Sbjct: 195 RAPPPPPRPPLAPLPTTRAPSSRSRRR 275
>LOC_Os05g03140:12005.t00211:unspliced-genomic senescence-associated protein, putative, expressed| Length = 4251 Score = 33.6 bits (67), Expect = 2.4 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +2 / +1 Query: 65 SCTGRCSPRSAASWWAP 115 SC+GR SP + SWW P Sbjct: 358 SCSGRSSPSGSPSWWCP 408
>LOC_Os01g70680:12001.t06367:unspliced-genomic gamma-thionins family protein, expressed| Length = 630 Score = 33.6 bits (67), Expect = 2.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 / -3 Query: 50 RQEPWSCTGRCSPRSAASWWAPWC 121 R+ PWS + RC+PR SW + C Sbjct: 343 RRRPWSSSRRCTPRGRRSWRSFCC 272
>LOC_Os01g68589:12001.t06774:unspliced-genomic protease inhibitor/seed storage/LTP family protein, expressed| Length = 1231 Score = 33.6 bits (67), Expect = 2.4 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 / -2 Query: 85 RTPPCTRPGLLPLPWSRARSLTARRR 8 R+PPC+ G P P R R+ TAR R Sbjct: 645 RSPPCSTTGTAPRPTGRRRTSTARPR 568
>LOC_Os05g04060:12005.t00303:unspliced-genomic expressed protein| Length = 1785 Score = 28.1 bits (55), Expect(2) = 2.4 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 / +2 Query: 88 RRTPPCTRPGLLPLPWSRARS 26 RR+PPC+ P P +R+RS Sbjct: 569 RRSPPCSSPSTSSSPRTRSRS 631 Score = 22.6 bits (43), Expect(2) = 2.4 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -2 / +3 Query: 132 DAGVHQGAHHEAAERGEHR 76 DAG + HH A + HR Sbjct: 486 DAGARRLLHHRAPRQRRHR 542
>LOC_Os07g01530:12007.t00052:unspliced-genomic expressed protein| Length = 1670 Score = 28.6 bits (56), Expect(2) = 3.0 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 / +2 Query: 83 SPRSAASWWAPWCTPASPMARRFASS 160 SP + S PWC PA+ RR + S Sbjct: 1085 SPAARRSTPGPWCAPAASSTRRSSPS 1162 Score = 25.8 bits (50), Expect(2) = 3.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 / +3 Query: 18 AVKLLARDHGSGRSPGRVQGGVRRA 92 A+++ R HG G P R +G RRA Sbjct: 534 AIRVGRRGHGGGGRPRRPRGRRRRA 608
>LOC_Os11g04830:12011.t00376:unspliced-genomic cadmium tolerance factor, putative, expressed| Length = 2977 Score = 28.1 bits (55), Expect(2) = 3.2 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = +2 / +2 Query: 44 WQRQEPWSCTGRCSPRSAASWWAPWCT 124 W P + P +++ WWAP C+ Sbjct: 899 WAPSPPAAAAASRRPSTSSRWWAPSCS 979 Score = 22.1 bits (42), Expect(2) = 3.2 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +2 / +2 Query: 113 PWCTPASP 136 PWC+ ASP Sbjct: 995 PWCSSASP 1018
>LOC_Os03g14700:12003.t01257:unspliced-genomic lipid binding protein, putative| Length = 4816 Score = 33.1 bits (66), Expect = 3.2 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -3 / -2 Query: 815 TIMNIGDIIVYQEHTPSMSFQIFLLWEFSSRW*TGSWY 702 + +NI D ++ HT +S +F+LWE W S Y Sbjct: 2472 SFLNIKDAMMINRHTKRVSLHLFILWE*HPFWEIFSTY 2359
>LOC_Os11g47780:12011.t04272:unspliced-genomic pollen signalling protein with adenylyl cyclase activity, putative,| expressed Length = 3984 Score = 33.1 bits (66), Expect = 3.2 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 / +2 Query: 101 SWWAPWCTPASPMARRFASSC 163 SWW PW PA RR+ C Sbjct: 608 SWWLPWWAPAGSARRRWRRRC 670
>LOC_Os11g45730:12011.t04100:unspliced-genomic pectinesterase precursor, putative, expressed| Length = 2199 Score = 33.1 bits (66), Expect = 3.2 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 / -2 Query: 65 SCTGRCSPRSAASWWAPWCTPASPMAR 145 SC+ R + WW WC PASP R Sbjct: 500 SCSPRGPSPAPP*WW*RWCRPASPWGR 420
>LOC_Os08g06390:12008.t00529:unspliced-genomic hypothetical protein| Length = 459 Score = 33.1 bits (66), Expect = 3.2 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 / +2 Query: 83 SPRSAASWWAPWCTPASPMARR 148 SP S A WW+P +PA+ ARR Sbjct: 203 SPSSPARWWSPQSSPAACSARR 268
>LOC_Os05g39600:12005.t03501:unspliced-genomic ATCHX15, putative, expressed| Length = 3273 Score = 33.1 bits (66), Expect = 3.2 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 / -2 Query: 147 RRAIGDAGVHQGAHHEAAERGEHR 76 RR D GAHHE ERGEHR Sbjct: 1193 RRRALDHPQRDGAHHEQYERGEHR 1122
>LOC_Os05g10700:12005.t00903:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5189 Score = 33.1 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 / +1 Query: 73 CTRPGLLPLPWSRARSLTARRR 8 C R LLPLPW R R+ RRR Sbjct: 673 CYRLWLLPLPWGRCRTRLMRRR 738
>LOC_Os04g58680:12004.t05329:unspliced-genomic nuclear transcription factor Y subunit C-9, putative, expressed| Length = 378 Score = 33.1 bits (66), Expect = 3.2 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -1 / -3 Query: 88 RRTPPCTRPGLLPLPWSRARSLTARR 11 RR PPC + G P W R +ARR Sbjct: 292 RRRPPCAQSGACPRAWRPRRGASARR 215
>LOC_Os04g32300:12004.t02909:unspliced-genomic OsGrx_C9 - glutaredoxin subgroup III| Length = 408 Score = 33.1 bits (66), Expect = 3.2 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 / +2 Query: 68 CTGRCSPRSAASWWAPWCTPASPMA 142 CT S R+AA+W APW ++P A Sbjct: 203 CTSWTSTRAAATWSAPWRASSAPAA 277
>LOC_Os03g63260:12003.t05543:unspliced-genomic methyltransferase small domain, putative, expressed| Length = 6383 Score = 33.1 bits (66), Expect = 3.2 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 / +3 Query: 574 AISVWVVHRESTWISAVIWICLLICFGSITTCG 672 AIS W VH +S ++W+ +L C G G Sbjct: 3342 AISTWPVHC*LKCLSRILWLAMLFCIGMSGVAG 3440
>LOC_Os03g24760:12003.t02168:unspliced-genomic terpene synthase 7, putative, expressed| Length = 2946 Score = 33.1 bits (66), Expect = 3.2 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 / -1 Query: 88 RRTPPCTRPGLLPLPWSRARSLTARRR 8 RR PPC+ P P P +RS RRR Sbjct: 2442 RRAPPCSTPPCSPCPCRSSRSCRRRRR 2362
>LOC_Os01g15580:12001.t01409:unspliced-genomic disease resistance protein RGA2, putative, expressed| Length = 4377 Score = 33.1 bits (66), Expect = 3.2 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 / +3 Query: 80 CSPRSAASWWAPWCTPASPMARRFASS 160 C P SA+ W+ CTP+SP R A+S Sbjct: 750 CPPASASPRWSRPCTPSSPRPARGATS 830
>LOC_Os01g46169:12001.t04066:unspliced-genomic carboxylic ester hydrolase/ hydrolase, acting on ester bonds, putative,| expressed Length = 24799 Score = 31.3 bits (62), Expect(2) = 3.8 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 / -1 Query: 77 RCSPRSAASWWAPWCTPASPMAR 145 RC PR+ A W W P S AR Sbjct: 11521 RCKPRARAEWPTAWSPPPSASAR 11453 Score = 26.3 bits (51), Expect(2) = 3.8 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +2 / -3 Query: 44 WQRQEPWSCTGRCSPRSAAS 103 W WSC GR PR+A + Sbjct: 21179 WHSFPRWSCDGRGVPRTAGN 21120
>LOC_Os03g63950:12003.t05661:unspliced-genomic plastid-specific 30S ribosomal protein 1, chloroplast precursor,| putative, expressed Length = 2596 Score = 27.2 bits (53), Expect(2) = 4.3 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 / -3 Query: 59 PWSCTGRCSPRSA 97 P SCTGR SPRS+ Sbjct: 2186 PSSCTGRSSPRSS 2148 Score = 22.6 bits (43), Expect(2) = 4.3 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 / -3 Query: 86 PRSAASWWAPWCTP 127 P +AA+ PWC P Sbjct: 2090 PPTAAASRTPWCAP 2049
>LOC_Os03g47530:12003.t04111:unspliced-genomic transferase, transferring glycosyl groups, putative, expressed| Length = 1578 Score = 32.7 bits (65), Expect = 4.4 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +3 / -1 Query: 18 AVKLLARDHGSGRSPGRVQGGVRRA 92 A + R GSGR+PGR +GG RRA Sbjct: 342 ATRRRRRGSGSGRTPGRRRGGGRRA 268
>LOC_Os10g40610:12010.t03301:unspliced-genomic disulfide oxidoreductase/ monooxygenase, putative, expressed| Length = 2323 Score = 32.7 bits (65), Expect = 4.5 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 / +2 Query: 71 TGRCSPRSAASWWAPWCTPASPMARRFAS 157 TGRCSP S S W+P AS A R+++ Sbjct: 68 TGRCSPSSMPSPWSPASPAASGSAPRWSA 154
>LOC_Os10g18150:12010.t01367:unspliced-genomic protein crooked neck, putative, expressed| Length = 2396 Score = 32.7 bits (65), Expect = 4.5 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +2 / +2 Query: 65 SCTGRCSPRSAASWWAPWCTPASPMARRFASS 160 S G CSP A + P C+P SP +R A S Sbjct: 941 STPGACSPPPATTTTPPCCSPRSPTSRSGAGS 1036
>LOC_Os10g06010:12010.t00473:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3755 Score = 32.7 bits (65), Expect = 4.5 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 / +2 Query: 273 YPEDRTNPISFLVDNPSRNRCYIYIKINQCCH 178 +PE TNP+ F N C +I +N+ CH Sbjct: 905 HPEWLTNPVMFRKANDK*RMCVDFIDLNKACH 1000
>LOC_Os08g22354:12008.t02014:unspliced-genomic polyadenylate-binding protein 2, putative, expressed| Length = 7457 Score = 32.7 bits (65), Expect = 4.5 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +2 / +2 Query: 80 CSPRSAASWWAPWCTPASPMARRFASSC*LRGS*QHWL 193 CS + S W PWC P + + +S C* G+ H L Sbjct: 2780 CSSYAHVSPWCPWCRPTAVLWPATSSFC*PSGTSVHEL 2893
>LOC_Os07g01060:12007.t00006:unspliced-genomic expressed protein| Length = 6182 Score = 32.7 bits (65), Expect = 4.5 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 / -2 Query: 634 CLLICFGSITTCGYIVVQLLQVSYQDPVYH 723 C IC TCGYI ++ + ++ P+YH Sbjct: 6112 CPYICMVYNATCGYIRHLIIHIWFKTPIYH 6023
>LOC_Os06g44240:12006.t04112:unspliced-genomic gp165, putative| Length = 1926 Score = 32.7 bits (65), Expect = 4.5 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +2 / -3 Query: 44 WQRQEPWSCTGRCSPRSAASWWAPWCTPASPMA 142 W R+ WS C+ + W A C+P P A Sbjct: 898 WTRRGGWSGRSTCTAKGTICWRARGCSPCRPRA 800
>LOC_Os06g14420:12006.t01317:unspliced-genomic nudix hydrolase 4, putative, expressed| Length = 1454 Score = 32.7 bits (65), Expect = 4.5 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 / +1 Query: 47 QRQEPWSCTGRCSPRSAASWWAPW 118 +R+ P T CSPR+ SW +PW Sbjct: 319 RRRAPPPATW*CSPRAGGSWTSPW 390
>LOC_Os06g13650:12006.t01240:unspliced-genomic alpha-mannosidase 2, putative, expressed| Length = 7366 Score = 32.7 bits (65), Expect = 4.5 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +1 / -3 Query: 145 PFRIELLTPWIVTTLVDFYVNIAAISTW 228 PFR E TPW+ ++++ +N +++TW Sbjct: 4775 PFRSE*KTPWLSISVLNLTINSLSLNTW 4692 Score = 32.7 bits (65), Expect = 4.5 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = +1 / -3 Query: 505 PFRKDLLTPWMAATLIDFYINVFAISVW 588 PFR + TPW++ ++++ IN +++ W Sbjct: 4775 PFRSE*KTPWLSISVLNLTINSLSLNTW 4692
>LOC_Os05g16200:12005.t01390:unspliced-genomic blight resistance protein T118, putative| Length = 3635 Score = 32.7 bits (65), Expect = 4.5 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +2 / +2 Query: 104 WWAPWCTPASPMARRFASSC 163 WW+PW PA RR+ C Sbjct: 605 WWSPWWAPAGSARRRWRKRC 664
>LOC_Os03g46720:12003.t04038:unspliced-genomic F-box domain containing protein| Length = 1864 Score = 32.7 bits (65), Expect = 4.5 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +2 / +2 Query: 47 QRQEPWSCTGRCSPRSAASWWAPWCTPASPMARRFAS 157 +R+ SCT CS RS+A+W A+ ARR A+ Sbjct: 68 RRRRRCSCTATCSGRSSAAWRRAGSRRAAASARRGAT 178
>LOC_Os03g20680:12003.t01824:unspliced-genomic embryonic protein DC-8, putative, expressed| Length = 1411 Score = 32.7 bits (65), Expect = 4.5 Identities = 18/50 (36%), Positives = 20/50 (40%) Frame = -1 / +1 Query: 160 ARCETASHXXXXXXXXXXXXXXRARRTPPCTRPGLLPLPWSRARSLTARR 11 AR TAS + RT P TRPG PW R R+ RR Sbjct: 463 ARPTTASRGRRTRRRTPPVTSSASTRTTPPTRPGRPRTPWRRRRATPPRR 612
>LOC_Os02g03200:12002.t00220:unspliced-genomic FAD binding domain containing protein, putative, expressed| Length = 2597 Score = 32.7 bits (65), Expect = 4.5 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +2 / +3 Query: 44 WQRQEPWSCTGRCSPRSAASWWAPWCTPASPMARRFASS 160 W+R W C + R+ A P T SP R ASS Sbjct: 2052 WRRSSRWRCASTAASRTGARTGTPPSTAPSPSTRSPASS 2168
>LOC_Os01g65030:12001.t05869:unspliced-genomic S-locus-specific glycoprotein S13 precursor, putative, expressed| Length = 3079 Score = 32.7 bits (65), Expect = 4.5 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -1 / +3 Query: 736 SSVADGRLGLGTTLGEVEPQCSHML*CFQ 650 S+V DGR+G+ +GEVE C C Q Sbjct: 2589 SAVVDGRVGVNADMGEVERACRVACWCIQ 2675
>LOC_Os01g21034:12001.t01840:unspliced-genomic pectinesterase-2 precursor, putative, expressed| Length = 9328 Score = 32.7 bits (65), Expect = 4.5 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -2 / +3 Query: 120 HQGAHHEAAERGEHRPVHDQGSCRCHGRALGA*LRG 13 H G H+ A R +PVH R GR GA L G Sbjct: 522 HHGPRHDGALRRHDQPVHLPRRLRLQGRGEGASLHG 629
>LOC_Os01g70000:12001.t06302:unspliced-genomic expressed protein| Length = 2022 Score = 30.9 bits (61), Expect(2) = 4.8 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 / +3 Query: 812 WFFNKGYTRVAIEVFSSWN 868 W+FN Y + I++F SWN Sbjct: 1488 WYFNHVYNFLCIQIFLSWN 1544 Score = 23.1 bits (44), Expect(2) = 4.8 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 / +3 Query: 577 ISVWVVHRE 603 IS+WV HRE Sbjct: 1203 ISIWVAHRE 1229
>LOC_Os04g43760:12004.t03916:unspliced-genomic phenylalanine ammonia-lyase, putative, expressed| Length = 3224 Score = 29.0 bits (57), Expect(2) = 5.3 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 / +1 Query: 86 PRSAASWWAPWCTPASPMARRFAS 157 PR+ +WW+ W +P +R AS Sbjct: 295 PRTPPAWWSSWTRRPAPASRPAAS 366 Score = 25.4 bits (49), Expect(2) = 5.3 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 / +2 Query: 442 FSILGILMAALVTYTVITDGLPFRKDLLTPWMAA 543 FS L +L +++ I +P+R PW+AA Sbjct: 3044 FSFLSLLYLSVL*SCEIAAAMPWRLQRSWPWLAA 3145
>LOC_Os11g14410:12011.t01272:unspliced-genomic polygalacturonase precursor, putative, expressed| Length = 2072 Score = 26.7 bits (52), Expect(2) = 5.9 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 / +3 Query: 51 GRSPGRVQGGVRRAR 95 G PGRV GGVRR R Sbjct: 129 GGVPGRVGGGVRRRR 173 Score = 22.6 bits (43), Expect(2) = 5.9 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 / +2 Query: 110 APWCTPASPMARRFASSC*LRGS 178 A WC+P++ + R S RGS Sbjct: 254 AAWCSPSTAPSSRRRPSATRRGS 322
>LOC_Os12g38460:12012.t03527:unspliced-genomic RNA recognition motif family protein| Length = 4942 Score = 32.2 bits (64), Expect = 6.1 Identities = 16/51 (31%), Positives = 21/51 (41%) Frame = -2 / +3 Query: 180 HDPRSQQLDAKRRAIGDAGVHQGAHHEAAERGEHRPVHDQGSCRCHGRALG 28 H+ +L A+RRA+ A A H RG P H + ALG Sbjct: 198 HEAAPPRLQARRRAVRQAPPRGRARHHGVARGRQGPAHADAAPGRRRGALG 350
>LOC_Os11g44920:12011.t04020:unspliced-genomic calmodulin binding protein, putative, expressed| Length = 2000 Score = 32.2 bits (64), Expect = 6.1 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -1 / -3 Query: 88 RRTPPCTRPGLLPLPWSRARSLTARRR 8 RR+PP P P P SRAR +RRR Sbjct: 1113 RRSPPAPPPRCCPSPSSRARRRRSRRR 1033
>LOC_Os09g24730:12009.t02154:unspliced-genomic hypothetical protein| Length = 1933 Score = 32.2 bits (64), Expect = 6.1 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 / -1 Query: 65 SCTGRCSPRSAASWWAPWCTPASPMA 142 S RC PR+ A W W P SP A Sbjct: 382 SRAARCFPRARAEWPTAWSPPPSPSA 305
>LOC_Os08g25490:12008.t02316:unspliced-genomic reticuline oxidase precursor, putative| Length = 1690 Score = 32.2 bits (64), Expect = 6.1 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 / -3 Query: 80 CSPRSAASWWAPWCTPASPMARR 148 CS RSA+SW W P S ARR Sbjct: 1175 CSWRSASSWRRGWSAPPSSSARR 1107
>LOC_Os06g11820:12006.t01059:unspliced-genomic hypothetical protein| Length = 998 Score = 32.2 bits (64), Expect = 6.1 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +2 / +2 Query: 65 SCTGRCSPRSAASWWAPWCTPAS 133 SC GR SP S A+WW+ C+ +S Sbjct: 500 SCHGRRSPGSWAAWWS*SCSSSS 568
>LOC_Os04g12120:12004.t01036:unspliced-genomic transposon protein, putative, unclassified| Length = 3837 Score = 32.2 bits (64), Expect = 6.1 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 / -1 Query: 65 SCTGRCSPRSAASWWAPWCTPASPMA 142 S RC PR+ A W W P SP A Sbjct: 387 SRAARCFPRARAEWPTAWSPPPSPSA 310
>LOC_Os04g03870:12004.t00276:unspliced-genomic cytochrome P450 89A2, putative, expressed| Length = 1443 Score = 32.2 bits (64), Expect = 6.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 / +2 Query: 89 RSAASWWAPWCTPASPMARRF 151 R+ ASWW WC S + RR+ Sbjct: 1280 RTPASWWRRWCASLSGLRRRW 1342
>LOC_Os03g60340:12003.t05272:unspliced-genomic expressed protein| Length = 3720 Score = 32.2 bits (64), Expect = 6.1 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 / -2 Query: 77 RCSPRSAASWWAPWCTPASPMARRFASSC 163 RC P +A+ AP CTP P + R SC Sbjct: 2870 RCPPATASPGAAPACTPPPPPSPRCPCSC 2784
>LOC_Os03g01340:12003.t00032:unspliced-genomic hypothetical protein| Length = 1643 Score = 32.2 bits (64), Expect = 6.1 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +2 / -1 Query: 50 RQEPWSCTGRCSPRSAASWWAPWCTPASPMA 142 R+ + RC PR+ A W W P SP A Sbjct: 398 RERARADAARCFPRARAEWPTAWSPPPSPSA 306
>LOC_Os06g30980:12006.t02800:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2722 Score = 29.5 bits (58), Expect(2) = 6.2 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 / +3 Query: 70 TRPGLLPLPWSRARSLTAR 14 +RP LLP PW R +SL +R Sbjct: 2193 SRPKLLPRPWYRPQSLPSR 2249 Score = 24.4 bits (47), Expect(2) = 6.2 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -2 / +3 Query: 291 ETNQQYYPEDRTNPISFLVDNP 226 ETN +P+ R+NP ++ P Sbjct: 2136 ETNNLLWPKRRSNPSKLVLSRP 2201
>LOC_Os09g10054:12009.t00796:unspliced-genomic disease resistance protein RPS2, putative, expressed| Length = 19511 Score = 26.3 bits (51), Expect(2) = 6.5 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 / +3 Query: 83 SPRSAASWWAPWCTPA 130 +PR+ + W PW TPA Sbjct: 11643 TPRTLCAQW*PWWTPA 11690 Score = 22.6 bits (43), Expect(2) = 6.5 Identities = 6/15 (40%), Positives = 7/15 (46%) Frame = +2 / +1 Query: 44 WQRQEPWSCTGRCSP 88 W+R PW C P Sbjct: 11593 WRRSPPWRCRPGVDP 11637
>LOC_Os03g08150:12003.t00673:unspliced-genomic germin-like protein subfamily 1 member 1 precursor, putative,| expressed Length = 892 Score = 26.7 bits (52), Expect(2) = 7.5 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +2 / +1 Query: 80 CSPRSAASWWAPWCTPASPMARRFASSC 163 C+P + PWCT + R+ SC Sbjct: 505 CAPARRSCSRGPWCTSCTTWTRQRRPSC 588 Score = 25.4 bits (49), Expect(2) = 7.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 / +2 Query: 940 PNLIAWQMIDTRFFP 984 P W MID+RF+P Sbjct: 719 PKTPRWTMIDSRFYP 763
>LOC_Os10g01560:12010.t00052:unspliced-genomic BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor,| putative, expressed Length = 3466 Score = 29.0 bits (57), Expect(2) = 7.6 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 / -2 Query: 91 ARRTPPCTRPGLLPLP 44 +RR PPCTR LP P Sbjct: 2043 SRRAPPCTRTRTLPAP 1996 Score = 24.9 bits (48), Expect(2) = 7.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -1 / -3 Query: 64 PGLLPLPWSRARSLTARR 11 P LPL W R RS RR Sbjct: 1532 PAALPLRWRRRRSRRLRR 1479
>LOC_Os02g50880:12002.t04672:unspliced-genomic protease Do-like 9, putative, expressed| Length = 5027 Score = 27.6 bits (54), Expect(2) = 7.7 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +3 / +3 Query: 417 FCCHRENYFQHFGHTHGCTCHVYCHYRWTAFQEG 518 F C ++YF HF ++ H+ + A Q G Sbjct: 4323 FSCVLQSYFLHFNSCQNHVFLLFLHFFYPAIQRG 4424 Score = 26.7 bits (52), Expect(2) = 7.7 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 / +3 Query: 47 QRQEPWSCTGRCSPRSAASWWAPW 118 Q PWS T R S RSAA + W Sbjct: 471 QTPTPWSTTPRSSLRSAAPTPSTW 542
>LOC_Os03g57050:12003.t04974:unspliced-genomic expressed protein| Length = 1651 Score = 26.7 bits (52), Expect(3) = 7.9 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +2 / +3 Query: 83 SPRSAASWWAP 115 +PRS ASWW P Sbjct: 669 TPRSVASWWNP 701 Score = 22.6 bits (43), Expect(3) = 7.9 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = +2 / +3 Query: 410 SVLLLSSGELFSAFWAYSWL 469 SV ++ S FW + WL Sbjct: 1278 SVYSAQEADILSLFWLWMWL 1337 Score = 21.7 bits (41), Expect(3) = 7.9 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +1 / +1 Query: 562 INVFAISVWVVHRESTWISAVIWICLLICF 651 I++ + VW + R + A + +L+CF Sbjct: 1432 IDLLGVFVWNLGRRCC*MQAPVMELVLVCF 1521
>LOC_Os02g08140:12002.t00710:unspliced-genomic CIPK-like protein 1, putative, expressed| Length = 3525 Score = 31.8 bits (63), Expect = 8.4 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 / -1 Query: 149 NGEPSVMQVYTRVPTMRQPSAANTALYTTRAPA 51 +G+P Q + P+ R P + N + +TTRAP+ Sbjct: 228 SGQPCTSQCSPQTPSRRLPLSPNLSNHTTRAPS 130
>LOC_Os11g46010:12011.t04126:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2973 Score = 31.8 bits (63), Expect = 8.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 / -2 Query: 77 RCSPRSAASWWAPWCTPASPMA 142 RC PR+ A W W P SP A Sbjct: 371 RCFPRARAEWPTAWSPPPSPSA 306
>LOC_Os11g34120:12011.t02965:unspliced-genomic expressed protein| Length = 12727 Score = 31.8 bits (63), Expect = 8.4 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 / +2 Query: 59 PWSCTGRCSPRSAASWWAPWCTPASPMARR 148 P S + RCS R W P C P P A R Sbjct: 104 PTSGSSRCSGRRRRGGWRPRCWPRRPRATR 193
>LOC_Os10g10540:12010.t00860:unspliced-genomic CRK10, putative, expressed| Length = 6923 Score = 31.8 bits (63), Expect = 8.4 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +2 / +3 Query: 65 SCTGRCSPRSAASWWAPWCTPASPMARR 148 S G C P A + W PW + P +RR Sbjct: 1380 SAPGTCRPTRARAAWTPWRPTSRPRSRR 1463
>LOC_Os09g24850:12009.t02166:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6306 Score = 31.8 bits (63), Expect = 8.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 / -1 Query: 50 RQEPWSCTGRCSPRSAASWWAPW 118 R++PW G SPR W PW Sbjct: 4134 REDPWVSEGAASPRRLEFWRHPW 4066
>LOC_Os09g04410:12009.t00337:unspliced-genomic retrotransposon, putative, centromere-specific| Length = 2546 Score = 31.8 bits (63), Expect = 8.4 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +2 / -3 Query: 59 PWSCTGRCSPRSAASWWAPWCTPASPMARRFA 154 P + RC PR+ A W W P+S A A Sbjct: 132 PSAAPSRCEPRARAEWPTAWSPPSSAPAASVA 37
>LOC_Os08g41940:12008.t03923:unspliced-genomic teosinte glume architecture 1, putative, expressed| Length = 5052 Score = 31.8 bits (63), Expect = 8.4 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +2 / +1 Query: 47 QRQEPWSCTGRCSPRSAASWWAPWCTPASPMARR 148 +R+ PWS RC R A S W T A+ + RR Sbjct: 43 RRRRPWSGISRCRRRRAGS*PTSWRTAAAGVYRR 144
>LOC_Os08g26840:12008.t02448:unspliced-genomic expressed protein| Length = 2221 Score = 31.8 bits (63), Expect = 8.4 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +1 / +1 Query: 592 VHRESTWISAVIWICLLI 645 V++ +WIS+ IWICL+I Sbjct: 229 VNKTLSWISSTIWICLII 282
>LOC_Os07g48650:12007.t04495:unspliced-genomic xylem serine proteinase 1 precursor, putative, expressed| Length = 2601 Score = 31.8 bits (63), Expect = 8.4 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -2 / +2 Query: 144 RAIGDAGVHQGAHHEAAERGEHRPVHDQGS 55 R GDAGV QG E R R VH+ G+ Sbjct: 2135 RVAGDAGVLQGRGEEDVRRDGEREVHEGGA 2224
>LOC_Os07g25890:12007.t02285:unspliced-genomic sumoylation ligase E3, putative| Length = 1456 Score = 31.8 bits (63), Expect = 8.4 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -1 / -2 Query: 91 ARRTPPCTRPGLLPLPWSRARSLTARRR 8 A PPC RP LPL W R + RR Sbjct: 129 AGAAPPCRRPSALPLRWRRPSAPPLCRR 46
>LOC_Os07g23120:12007.t02013:unspliced-genomic expressed protein| Length = 1117 Score = 31.8 bits (63), Expect = 8.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 / -2 Query: 65 SCTGRCSPRSAASWWAPW 118 SC G S R SWW PW Sbjct: 585 SCAGTPSARRRPSWWPPW 532
>LOC_Os06g01510:12006.t00049:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3085 Score = 31.8 bits (63), Expect = 8.4 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 / +2 Query: 65 SCTGRCSPRSAASWWAPWCTPASPMA 142 S RC PR+ A W W P SP A Sbjct: 1532 SRAARCFPRARAEWPTAWSPPPSPPA 1609
>LOC_Os04g44900:12004.t04027:unspliced-genomic lectin-like receptor kinase 7, putative, expressed| Length = 2540 Score = 31.8 bits (63), Expect = 8.4 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 / +1 Query: 68 CTGRCSPRSAASWWAPWCT 124 CT R+ +WWAPW T Sbjct: 1792 CTTTAPTRTRRTWWAPWAT 1848
>LOC_Os04g42950:12004.t03841:unspliced-genomic DNA binding protein, putative, expressed| Length = 2756 Score = 31.8 bits (63), Expect = 8.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 / -1 Query: 183 CHDPRSQQLDAKRRAIGDAGVHQGAHHEAAER 88 C RS +RR G G H GAHHE R Sbjct: 2150 CRRRRSADARRRRRRGG*GGRHGGAHHEVVHR 2055
>LOC_Os03g08710:12003.t00727:unspliced-genomic expressed protein| Length = 869 Score = 31.8 bits (63), Expect = 8.4 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 / +2 Query: 62 WSCTGRCSPRSAASWW 109 W+ GRCSPR + WW Sbjct: 272 WTRGGRCSPRRSRRWW 319
>LOC_Os02g46500:12002.t04237:unspliced-genomic ubiquitin-protein ligase, putative, expressed| Length = 1490 Score = 31.8 bits (63), Expect = 8.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 / +1 Query: 62 WSCTGRCSPRSAASWW 109 W C G SPR+ +WW Sbjct: 454 WQCRGSSSPRAGCAWW 501
>LOC_Os02g45950:12002.t04182:unspliced-genomic expressed protein| Length = 3533 Score = 31.8 bits (63), Expect = 8.4 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +1 / +1 Query: 613 ISAVIWICLLICFGSITTCGYIVVQLLQVSYQDPV 717 I +I L CFG IT+C +++QLL++ ++ + Sbjct: 1873 IPKCFFIQSLYCFGPITSCEVVLLQLLELDPEEVI 1977
>LOC_Os01g68020:12001.t06159:unspliced-genomic protein binding protein, putative, expressed| Length = 4395 Score = 31.8 bits (63), Expect = 8.4 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 / -2 Query: 71 TGRCSPRSAASWWAPWCTPASPMARRFA 154 T R SPR W A WC+ + ARR A Sbjct: 2546 TPRSSPRP*TPWRAAWCSAGAAAARRTA 2463
>LOC_Os01g61044:12001.t05484:unspliced-genomic amino acid-polyamine transporter, putative, expressed| Length = 6384 Score = 31.8 bits (63), Expect = 8.4 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 / +3 Query: 92 SAASWWAPWCTPASPMARRFASSC 163 S +S WA CTP+SP RR C Sbjct: 5028 SCSSAWASRCTPSSPAQRRCRGCC 5099
>LOC_Os01g54420:12001.t04859:unspliced-genomic ATP binding protein, putative, expressed| Length = 4671 Score = 31.8 bits (63), Expect = 8.4 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 / +1 Query: 571 FAISVWVVHRESTWISAVIWICLLICFGS 657 F+ISV ++HR S +S +W L CF S Sbjct: 4432 FSISVKMIHRSSW*VSTAVWHFLAQCFCS 4518
>LOC_Os01g18500:12001.t01643:unspliced-genomic hypothetical protein| Length = 3102 Score = 31.8 bits (63), Expect = 8.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 / -1 Query: 77 RCSPRSAASWWAPWCTPASPMAR 145 RC PR+ A W W P+S AR Sbjct: 1395 RCKPRARAEWPTTWSPPSSAPAR 1327
>LOC_Os01g01160:12001.t00016:unspliced-genomic chaperone protein dnaJ 20, chloroplast precursor, putative,| expressed Length = 1875 Score = 31.8 bits (63), Expect = 8.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -1 / +1 Query: 88 RRTPPCTRPGLLPLPWSR 35 RR PC RP LP PW R Sbjct: 112 RRRRPCLRPRCLPAPWPR 165
>LOC_Os01g08750:12001.t00753:unspliced-genomic expressed protein| Length = 19934 Score = 25.4 bits (49), Expect(2) = 8.6 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 / +3 Query: 468 CTCHVYCHYRWTAFQEGFV 524 C H Y H+ W + E FV Sbjct: 7689 CHAHAYAHFSWESQFEYFV 7745 Score = 23.1 bits (44), Expect(2) = 8.6 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 / +1 Query: 612 DLSSHMDMLVDMLWKHHNMW 671 +LS ++ +L+ M WK N W Sbjct: 7723 NLSLNILLLIMMCWKSANSW 7782
>LOC_Os03g10640:12003.t00865:unspliced-genomic calcium-transporting ATPase 2, plasma membrane-type, putative,| expressed Length = 6422 Score = 29.0 bits (57), Expect(2) = 9.6 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -2 / +3 Query: 177 DPRSQQLDAKRRAIGDAGVHQGAHHEAAERGEH 79 DPR +L RR GV QG A RG+H Sbjct: 2571 DPRGVRLLLPRRRHRHRGVAQGRARRARHRGQH 2669 Score = 25.4 bits (49), Expect(2) = 9.6 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -3 / +1 Query: 329 NLLTI*AHVVALPKQINSTTQKI 261 +LL + A V +LPK+ TTQK+ Sbjct: 88 SLLLLLASVRSLPKKTQETTQKL 156
>LOC_Os08g04490:12008.t00343:unspliced-genomic conserved hypothetical protein| Length = 4577 Score = 25.8 bits (50), Expect(2) = 9.9 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 / +1 Query: 83 SPRSAASWWAPWCTPAS 133 S R +S W PWC+ +S Sbjct: 2422 SGRETSSCWLPWCSYSS 2472 Score = 22.6 bits (43), Expect(2) = 9.9 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +1 / +3 Query: 109 GTLVYTCITDGSPFRIELLTP 171 GT+ Y C T F E TP Sbjct: 2475 GTIKYACRTSALMFTAEQTTP 2537 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 417,850,191 Number of extensions: 6889043 Number of successful extensions: 40263 Number of sequences better than 10.0: 108 Length of query: 341 Length of database: 55,613,886 Length adjustment: 50 Effective length of query: 291 Effective length of database: 52,799,986 Effective search space: 15364795926 Effective search space used: 15364795926 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
