| Clone Name | FLbaf75k11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | P33485:VNUA_PRVKA Probable nuclear antigen - Pseudorabies virus ... | 35 | 0.95 | 2 | P22807:SLOU_DROME Homeobox protein slou - Drosophila melanogaste... | 35 | 1.6 | 3 | Q10180:MU113_SCHPO Meiotically up-regulated gene 113 protein - S... | 33 | 6.2 | 4 | Q6BSP4:BBP_DEBHA Branchpoint-bridging protein - Debaryomyces han... | 33 | 6.2 |
|---|
>P33485:VNUA_PRVKA Probable nuclear antigen - Pseudorabies virus (strain Kaplan) (PRV)| Length = 1733 Score = 35.4 bits (80), Expect = 0.95 Identities = 44/137 (32%), Positives = 51/137 (37%), Gaps = 5/137 (3%) Frame = -3 Query: 862 GSISCLRSRKLPTISGQSSKKCWCFLGFVGVASPGRSEGKANT-RRQRPDGWHDRGALPG 686 G+ R R P G ++ L V A P G A RR RP G G+ P Sbjct: 1551 GAPGAKRPRIEPPRGGGLVEQGLAVLVMVTTAVPSGGGGAAAAGRRDRPGGGGGWGSGPP 1610 Query: 685 TAR-WRHRGAASWWSWTERERLLTAVCRRPTVIDSSHGTGGDGERRCRRAW-ARLGVVAG 512 R HR WW R R RRP + D GG R CR A A G G Sbjct: 1611 PCRRCGHRCWLCWWRRGPRPR------RRPGLTDRVPPRGGPSPRGCRGAGRAGGGGRGG 1664 Query: 511 LWEGHDQGSS--PILCR 467 G G++ P LCR Sbjct: 1665 CGGGRAPGAAGGPGLCR 1681
>P22807:SLOU_DROME Homeobox protein slou - Drosophila melanogaster (Fruit fly)| Length = 659 Score = 34.7 bits (78), Expect = 1.6 Identities = 21/65 (32%), Positives = 29/65 (44%) Frame = +1 Query: 139 PKVAPEPTILLHLQLVSSTVTPPPKIAPEPTS*VAEHHRRLLLLPATACHPAMHDESSCT 318 P P P+ + HL+ SS+ T PP A P S P T+ PAMH + + Sbjct: 228 PHPHPHPSAVFHLRAPSSSSTAPPSPATSPLS------------PPTS--PAMHSDQQMS 273 Query: 319 SPVHP 333 P+ P Sbjct: 274 PPIAP 278
>Q10180:MU113_SCHPO Meiotically up-regulated gene 113 protein - Schizosaccharomyces| pombe (Fission yeast) Length = 326 Score = 32.7 bits (73), Expect = 6.2 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 833 FPGPETRN*PCMLYVLISKLIHPQLNLYLIEKESFVC 943 FP P + PC + + +L+H +LN YL + F C Sbjct: 253 FPDPGKTSKPCQVSFKVERLVHKELNEYLSWMQPFTC 289
>Q6BSP4:BBP_DEBHA Branchpoint-bridging protein - Debaryomyces hansenii (Yeast)| (Torulaspora hansenii) Length = 518 Score = 32.7 bits (73), Expect = 6.2 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +2 Query: 626 PLSFSPAPPASCSTMTPPRSSRQCSPVVPA-IRPLSPGVGLSFTTPRTSN 772 P S +P PP S PP SS + P P+ I P P G++ P++ N Sbjct: 441 PSSLAPPPPPSSDIAPPPPSSDRAPPPPPSGIAPPPPPSGIAPPPPKSPN 490 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 357,895,871 Number of extensions: 7911751 Number of successful extensions: 23603 Number of sequences better than 10.0: 4 Number of HSP's gapped: 23524 Number of HSP's successfully gapped: 4 Length of query: 703 Length of database: 100,686,439 Length adjustment: 120 Effective length of query: 583 Effective length of database: 67,771,039 Effective search space: 39510515737 Effective search space used: 39510515737 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)