| Clone Name | FLbaf46h22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q9UPA5:BSN_HUMAN Protein bassoon - Homo sapiens (Human) | 34 | 0.84 | 2 | P25059:POL_BLVAU Pol polyprotein [Contains: Reverse transcriptas... | 33 | 2.4 | 3 | P92208:JNK_DROME Stress-activated protein kinase JNK - Drosophil... | 32 | 5.4 | 4 | Q5UQV1:YR354_MIMIV Uncharacterized protein R354 - Mimivirus | 31 | 9.3 |
|---|
>Q9UPA5:BSN_HUMAN Protein bassoon - Homo sapiens (Human)| Length = 3926 Score = 34.3 bits (77), Expect = 0.84 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 7/46 (15%) Frame = +2 Query: 554 PGPALQRGVDPAGP-------GRDGVRRRRAQHMAPHRQALPGPAP 670 PGP+ G PAGP G G + Q AP Q PGP P Sbjct: 3823 PGPSTATGPQPAGPPRAEQTNGSKGTAKAPQQGRAPQAQPTPGPGP 3868
>P25059:POL_BLVAU Pol polyprotein [Contains: Reverse transcriptase/ribonuclease H -| Bovine leukemia virus (isolate Australian) (BLV) Length = 852 Score = 32.7 bits (73), Expect = 2.4 Identities = 20/71 (28%), Positives = 40/71 (56%), Gaps = 2/71 (2%) Frame = -3 Query: 997 TKKQTLRIRLLFTRNIKTCNFKVS*RSSYEQRETKQTAPPVGGGAHGQLVNSKTLPT--I 824 T++Q L+ +++ F+V+ S + R+T P +G H ++V ++LPT I Sbjct: 171 TEEQRLQCYQTMAAHLRDLGFQVA---SEKTRQTPSPVPFLGQMVHERMVTYQSLPTLQI 227 Query: 823 SSPVGICQMKS 791 SSP+ + Q+++ Sbjct: 228 SSPISLHQLQT 238
>P92208:JNK_DROME Stress-activated protein kinase JNK - Drosophila melanogaster| (Fruit fly) Length = 372 Score = 31.6 bits (70), Expect = 5.4 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 5/39 (12%) Frame = +3 Query: 561 RHFNAGSILLGLGVTE-----SVGGALNTWLRTGKLFPG 662 R++ A ++LG+G TE SVG + +R G LFPG Sbjct: 187 RYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPG 225
>Q5UQV1:YR354_MIMIV Uncharacterized protein R354 - Mimivirus| Length = 549 Score = 30.8 bits (68), Expect = 9.3 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = -3 Query: 868 GAHGQLVNSKTLPTISSPVGICQMKSSTLMVLSAMCRLLAVSFPF 734 G +G L +S +SP GIC K++T + + RLL + FPF Sbjct: 254 GEYGLLQHSGHKFIAASPDGICSKKANTGGLSKLVGRLLEIKFPF 298 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 103,695,923 Number of extensions: 1775447 Number of successful extensions: 6270 Number of sequences better than 10.0: 4 Number of HSP's gapped: 6266 Number of HSP's successfully gapped: 4 Length of query: 340 Length of database: 100,686,439 Length adjustment: 114 Effective length of query: 226 Effective length of database: 69,416,809 Effective search space: 15688198834 Effective search space used: 15688198834 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)